KR20150117317A - Pharmaceutical composition comprising compound having inhibitory activity against capsid assembly of Hepatitis B Virus for treating or preventing liver disease due to HBV infection - Google Patents
Pharmaceutical composition comprising compound having inhibitory activity against capsid assembly of Hepatitis B Virus for treating or preventing liver disease due to HBV infection Download PDFInfo
- Publication number
- KR20150117317A KR20150117317A KR1020140042227A KR20140042227A KR20150117317A KR 20150117317 A KR20150117317 A KR 20150117317A KR 1020140042227 A KR1020140042227 A KR 1020140042227A KR 20140042227 A KR20140042227 A KR 20140042227A KR 20150117317 A KR20150117317 A KR 20150117317A
- Authority
- KR
- South Korea
- Prior art keywords
- formula
- compound
- bcm
- pharmaceutical composition
- hbv
- Prior art date
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/16—Amides, e.g. hydroxamic acids
- A61K31/165—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
- A61K31/167—Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the nitrogen of a carboxamide group directly attached to the aromatic ring, e.g. lidocaine, paracetamol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
Abstract
Description
본원은 B형 간염바이러스로 인한 질환 치료제 분야이다.This is a therapeutic agent for diseases caused by hepatitis B virus.
B형 간염 바이러스 (Hepatitis B Virus, HBV)는 간세포를 감염하여 만성 간염을 일으키는 바이러스로, 전 세계적으로 약 3억 5천만명이 HBV에 감염 된 것으로 추정되며, 이 중 5 내지 10 %는 평생 만성 B형 간염으로 고생하는데, 만성간염은 간경변, 간부전을 거쳐, 간세포암 (Hepatocellular Carcinoma, HCC)으로 발전된다(Ahn et al., 2005. J. Hepatol 42(2): 188-94; Montalto, G. et al. 2002. Ann NY Acad Sci 963: 13-20). Hepatitis B virus (HBV) is a virus that causes chronic hepatitis by infecting hepatocytes. It is estimated that about 350 million people worldwide are infected with HBV, and 5 to 10% (Ahn et al., 2005. J. Hepatol 42 (2): 188-94; and Montalto, G., et al., Hepatocellular carcinoma and hepatocellular carcinoma. et al. 2002. Ann NY Acad Sci 963: 13-20).
특히 간세포암은 우리나라에서 4번째로 발병률이 높은 암이나 (국가암정보센터, 2003년-2005년 분석자료) 간암 특이적 치료법은 답보상태이다. 간암의 주 치료법은 간절제술, 간동맥 화학색전술, 항암 화학요법, 방사선치료, 및 간이식술 등을 들 수 있으나, 효과적인 치료를 위해서는 질환의 원인인 바이러스의 증식을 억제하는 것이 급선무로 이를 기본으로 하는 치료 방법의 개발이 필요하다. In particular, hepatocellular carcinoma is the fourth most common cancer in Korea (National Cancer Information Center, 2003-2005). The main treatment for liver cancer is hepatic resection, hepatocellular chemoembolization, chemotherapy, radiation therapy, and liver transplantation. Effective treatment, however, is to inhibit the growth of the virus, which is the cause of the disease, Development of a method is needed.
특히 바이러스의 형성과 생존에 있어 캡시드는 필수적이기 때문에 이러한 캡시드의 형성을 차단 또는 억제할 수 있는 물질은 강력한 항 바이러스제로 기능할 수 있으나, 이러한 치료제는 아직까지 존재하지 않는다.Especially, since capsids are essential for the formation and survival of viruses, substances capable of blocking or inhibiting the formation of these capsids can function as potent antiviral agents, but such therapeutic agents do not yet exist.
Stray 등은 헤테로아릴디하이드로피리미딘 (HAP) 구체적으로 methyl 4-(2-chloro-4-fluorophenyl)-6-methyl-2-(pyridin-2-yl)-1,4-dihydropyrimidine-5-carboxylate (HAP-1)을 이용한 캡시드 어셈블리 억제제를 개시한다 (Proc Natl Acad Sci U S A. 2005; 102(23): 8138-8143). Stray et al. Have reported that heteroaryldihydropyrimidine (HAP) specifically reacts with methyl 4- (2-chloro-4-fluorophenyl) -6-methyl-2- (pyridin-2-yl) -1,4-dihydropyrimidine-5-carboxylate (HAP-1) (Proc Natl Acad Sci US A. 2005; 102 (23): 8138-8143).
미국 특허 제6,544,520호는 HBV 바이러스 억제제에 관한 것으로 코어 항원에 결합하여 HBV의 어셈블리를 억제하는 특정 서열을 갖는 펩타이드를 개시한다. U.S. Patent No. 6,544,520 relates to HBV virus inhibitors and discloses peptides with specific sequences that bind to core antigens and inhibit the assembly of HBV.
또한 뉴클레오사이드 유사체와 같은 항바이러스제가 시도되기도 하였으나, 큰 부작용으로 인해 사용되지 못하고 있다. Antiviral agents such as nucleoside analogs have also been attempted, but they have not been used due to significant side effects.
HBV의 증식의 억제에 초점을 맞춘 안정하고 효과적인 치료제의 개발이 요구된다.
Development of a stable and effective therapeutic agent focused on inhibiting HBV proliferation is required.
본원은 캡시드 어셈블리 과정을 표적으로 하는 HBV 증식 억제제를 제공하고자 한다.
The present disclosure seeks to provide an inhibitor of HBV proliferation that targets the capsid assembly process.
한 양태에서 본원은 하기 화학식 1의 화합물 는 그 염을 유효성분으로 포함하는 HBV 감염으로 인한 간질환 예방 또는 치료용 약학 조성물을 제공한다:In one embodiment, the present invention provides a pharmaceutical composition for preventing or treating liver disease caused by HBV infection comprising a salt thereof as an active ingredient:
<화학식 1>≪ Formula 1 >
상기 화학식 1에서, In Formula 1,
A 는 C 또는 N 이고;A is C or N;
R1 및 R2 는 각각 수소 또는 할로겐이고, R 1 and R 2 are each hydrogen or halogen,
R3 및 R4 는 각각 수소, C1-C6의 직쇄 또는 분쇄상 알킬기, -C(=O)Ra, -S(=O)2Ra 이고, 상기 Ra 는 C1-C6의 직쇄 또는 분쇄상 알킬기, 치환 또는 비치환된 아릴기, 치환 또는 비치환된 헤테로 아릴기이다. R 3 and R 4 are a straight or branched chain alkyl group each represent a hydrogen, C 1 -C 6, -C ( = O) R a, -S (= O) 2 R a , and wherein R is a straight chain of C1-C6 Or a branched alkyl group, a substituted or unsubstituted aryl group, or a substituted or unsubstituted heteroaryl group.
본원에 따른 일 구현예에서 상기 화학식 1의 화합물은 하기 화학식 2 또는 화학식 3으로 표시된다:In one embodiment according to the present invention, the compound of formula (1) is represented by the following formula (2) or (3)
<화학식 2>(2)
<화학식 3>(3)
상기 화학식 2 또는 3에서,In the general formula (2) or (3)
R'1, R'2 , R'4 및 R'5 는 각각 수소 또는 할로겐이고, R ' 1 , R' 2 , R ' 4 and R' 5 are each hydrogen or halogen,
R'3 및 R'6 는 각각 수소, C1-C6의 직쇄 또는 분쇄상 알킬기, -C(=O)Ra, -S(=O)2Ra 이고, 상기 Ra 는 C1-C6의 직쇄 또는 분쇄상 알킬기, 치환 또는 비치환된 아릴기, 치환 또는 비치환된 헤테로 아릴기다. R '3 and R' 6 are each a hydrogen, a linear or branched alkyl group of 6 C 1 -C, -C (= O) R a, -S (= O) 2 R a, wherein Ra is C 1 -C A substituted or unsubstituted alkyl group, a substituted or unsubstituted aryl group, a substituted or unsubstituted heteroaryl group,
본원에 따른 일 구현예에서, 상기 화학식 1의 화합물은 후술하는 화학식 4 내지 화학식 16 중 어느 하나의 화합물이며, 특히 상기 화학식 1의 화합물은 화학식 5 (BCM-599), 화학식 6 (BCM-600), 화학식 8 (BCM-602), 화학식 10 (BCM-604) 화학식 12 (BCM-606) 또는 화학식 14 (BCM-608)이다. (BCM-599), (6) (BCM-600), and the compound of the formula (1) is a compound of the formula (BCM-602), Formula 10 (BCM-604), Formula 12 (BCM-606) or Formula 14 (BCM-608).
본원에 따른 화합물은 HBV 감염으로 인한 간질환 예방 또는 치료용으로 유용하며, 예를 들면 간염, 지방간, 간부전, 간경변, 또는 간암의 예방 또는 치료에 사용될 수 있다. 본 이론으로 한정하는 것은 아니지만, 본원에 따른 화합물은 HBV 캡시드 어셈블리의 억제 또는 차단에 의해 이러한 효과를 발휘한다. The compounds according to the present invention are useful for the prevention or treatment of liver disease due to HBV infection and can be used, for example, in the prevention or treatment of hepatitis, fatty liver, liver failure, cirrhosis, or liver cancer. Without being limited to this theory, compounds according to the present invention exert this effect by inhibiting or blocking HBV capsid assembly.
다른 양태에서 본원은 본원의 화합물 또는 그 염을 포함하는, 캡시드 어셈블리 차단 또는 억제용 약학 조성물을 제공한다. 본원의 약학 조성물은 HBV 감염으로 인한 간염, 지방간, 간부전, 간경변, 또는 간암을 포함하는 간질환의 치료 또는 예방에 효과가 있다. In another aspect, the present disclosure provides a pharmaceutical composition for blocking or inhibiting capsid assembly, comprising a compound of the present invention or a salt thereof. The pharmaceutical compositions of the present application are effective for the treatment or prevention of liver diseases including hepatitis, fatty liver, liver failure, liver cirrhosis, or liver cancer due to HBV infection.
다른 양태에서 본원의 약학 조성물은 기존의 간질환 치료에 사용되는 HBV 폴리머라제 억제제와 조합으로 사용될 수 있으며, 본원 화합물 대 상기 HBV 폴리머라제 억제제의 비는 이로 제한하는 것은 아니나 약 1:1 내지 40:1 로 사용될 수 있다. 본원에 따른 일 구현예에서, 이러한 HBV 폴리머라제 억제제는 라미부딘(Lamivudin), 아데포비르 (Adefovir, ADV), 텔비부딘 (Telbivudine), 엔테카비르(Entecavir) 또는 테노포비르 (Tenofovir)를 포함할 수 있으나, 이로 제한되는 것은 아니다. 본원에 따른 일 구현예에서 약학조성물은 화학식 5 (BCM-599), 화학식 6 (BCM-600), 화학식 8 (BCM-602), 화학식 10 (BCM-604), 화학식 12 (BCM-606) 또는 화학식 14 (BCM-608)의 화합물을 포함할 수 있다.
In another embodiment, the pharmaceutical compositions herein may be used in combination with an HBV polymerase inhibitor used in the treatment of existing liver diseases, and the ratio of the present compound to the HBV polymerase inhibitor may range from about 1: 1 to 40: 1 < / RTI > In one embodiment according to the present disclosure, such an HBV polymerase inhibitor may comprise Lamivudin, Adefovir (ADV), Telbivudine, Entecavir or Tenofovir. But is not limited thereto. In one embodiment according to the present invention, the pharmaceutical composition comprises a compound of Formula 5 (BCM-599), Formula 6 (BCM-600), Formula 8 (BCM-602), Formula 10 (BCM-604) (BCM-608). ≪ / RTI >
다른 양태에서 본원은 B형 간염 바이러스 유래의 6개의 코어 단백질 단량체로 이루어진 헥사머를 제공한다. 헥사머의 구조는 도 1을 참조할 수 있다. 헥사머는 HBV 캡시드와 상호작용하여 이의 어셈블리를 억제하는 물질의 스크리닝, 동정, 분리, 발굴 등에 유용하게 사용될 수 있다. 코어 단백질은 공지된 서열로 전장 또는 149개만이 사용될 수 있다. HBV 코어 단백질 서열은 공지된 것으로 예를 들면 전장 서열은 서열번호 1의 서열을 가지며, 149개의 서열은 상기 서열에서 1 내지 149개 잔기의 서열을 가진다. 본원에 따른 일 구현예에서 각 코어단백질 단량체 149개의 잔기를 가지며 서열번호 1의 서열을 기준으로 아미노산 잔기 21-35, 101-120, 및 136-140로 형성된 홈구조(groove)를 포함한다. In another embodiment herein, we provide a hexamer consisting of six core protein monomers derived from hepatitis B virus. The structure of the hexamer can be referred to FIG. Hexamers can be useful for screening, identification, isolation, and excavation of substances that interact with HBV capsids and inhibit their assembly. The core protein can be a full-length or only 149 known sequences. The HBV core protein sequence is known, for example, the full-length sequence has the sequence of SEQ ID NO: 1, and the 149 sequence has the sequence of 1 to 149 residues in the sequence. In one embodiment according to the present disclosure, each core protein monomer has 149 residues and comprises a groove formed of amino acid residues 21-35, 101-120, and 136-140 on the basis of the sequence of SEQ ID NO: 1.
다른 양태에서 본원은 본원에 따른 헥사머를 이용한, 상기 헥사머에 형성된 홈구조와 후보 화합물간의 결합력을 측정하는 단계를 포함하는, HBV의 캡시드 어셈블리 억제제를 스크리닝하는 방법을 제공한다.
In another aspect, the present invention provides a method of screening a capsid assembly inhibitor of HBV comprising measuring the binding force between a candidate compound and a groove structure formed in the hexamer using a hexamer according to the present invention.
본원에 따른 약학 조성물은 높은 친화도로 Cp의 홈 (groove) 구조에 결합을 통해 HBV의 캡시드 어셈블리를 효과적으로 억제 또는 차단하여, HBV로 인한 다양한 질환의 예방 또는 치료에 유용하게 사용될 수 있다.
The pharmaceutical composition according to the present invention can be effectively used to prevent or treat various diseases caused by HBV by effectively inhibiting or blocking the capsid assembly of HBV through binding to the groove structure of Cp with high affinity.
도 1은 인실리코 모델링을 통해 수득된 cp149 이량체 (A) 및 육량체 (B)의 구조이다.
도 2는 cp149의 결합 포즈(pose)와 어셈블리 억제제 후보물질 간의 유사도를 나타내는 것으로, A는 cp149 이량체 수용체 상의 cp149 루프 구조 (Ser121-Pro135)에 대한 예측된 결합 포즈이고, B는 상기 수용체 상의 ARG127-THR128-PRO129 세 개 펩타이드에 대하여 예측된 결합 포즈이고, C는 BCM-599의 cp149 이량체 수용체에 대한 예측된 결합 포즈이고, D는 BCM-599와 cp149의 근접 아미노산 잔기사이의 상호작용을 나타내는 수용체-리간드 상호작용을 나타내는 모식도이다.
도 3은 예측 분자의 억제 효과를 인비트로 어셈블리 분석 및 아가로스 젤 분석을 통해 조사한 결과로, A, B에서 cp149는 최종농도 25μM의 13개의 각 분자로 처리되었으며, 0.9% (위 패널) 및 1.5% (아래 패널) SDS-PAGE로 분석하였으며, 시료의 순서는 다음과 같다; A: -, +, 599, 598, 600, 601, 602, 603, 604; B: -, +, 5999, 605, 606, 607, 608, 609, 610. C 내지 H는 [C] BCM-599, [D] BCM-600, [E] BCM-602, [F] BCM-604, [G] BCM-606, [H] BCM-608로 상기 각 물질을 1μM 내지 25μM의 농도로 처리 후 위와 같이 분석한 결과이다.
도 4는 인비트로에서 어셈블된 cp149의 슈크로스 농도구배 원심분리 결과를 나타낸다. A 내지 F는 슈크로스 농도구배에 분포된 단백질 분자를 나타내고, A는 음성 대조군, B는 양성 대조군이며, C는 BCM-599, D는 BCM-600, E는 BCM-602, F는 BCM-606 처리된 것이고, G는 단백질의 분로를 보다 명확하게 나타내기 위해 밴드 강도를 분석한 결과로, N은 음성 대조군이고, P는 양성 대조군이다.
도 5는 억제제 후보 물질은 HepG2.2.15 물질에 처리한 후 바이러스 타이터를 분석한 정량 PCR 결과 및 IC50 값을 나타낸다. 또한 억제제 후보물질과 라미부딘(Lamivudine)을 특정 비로 혼합한 후 위와 같은 실험을 수행하여 상대적 시너지 효과를 측정한 CI-인덱스 결과이다. A는 화합물 라미뷰딘 시너지 패턴을 나타내는 아이소볼믹 그래프로, 값은 각 화합물의 IC50에 대하여 적정화(normalized)되었다. B는 BCM-599/라미뷰딘 조합의 CI 인덱스이고, C는 일정 농도 (=0.07μM)의 라미뷰딘에서 BCM-599의 첨가에 의한 바이러스 타이터의 변화를 나타내는 결과이다.
도 6은 비처리 cp149 및 억제제 후보화합물 처리된 cp149 캡시드에 대한 전자 현미경 사진이다 (배율: X80,000). 어셈블된 코어 입자를 2% 유라닐 아세테이틀 사용하여 네가티브 염색을 하였다. A는 비-어셈블된 cp149 사진이고, B는 반응 용액 (50 mM Hepes, 15mM NaCl, 및 10 mM CaCl2 in pH 7.5) 중의 완전히 어셈블된 cp149의 사진이고, C 내지 F는 BCM-599, BCM-600, BCM-602, 및 BCM-606의 각 억제제를 25μM로 처리한 후 어셈블된 cp149의 사진이다.
도 7은 인실리코 모델링을 통해 예측된 결합에너지와 인비트로/인비보 실험 결과에서 수득한 IC50 값을 비교한 결과이다. 이들 값을 로그 스케일로 변환하여 나타냈으며, A는 인비트로/인실리코 관련성이고, B는 인비보/인실리코 관련성을 나타낸다. 그 결과 RMSD (Root Mean Square Deviation)가 약 0.80으로 나타났으며 이는 본원에서 구축된 cp149 모델이 억제제 스크리닝에 있어 매우 효과적인 수단임을 나타내는 것이다.Fig. 1 shows the structure of the cp149 dimer (A) and the plasma mass (B) obtained through silico modeling.
Figure 2 shows the similarity between the binding pose of cp149 and the assembly inhibitor candidate, where A is the predicted binding pose for the cp149 loop structure (Ser121-Pro135) on the cp149 dimer receptor and B is the predicted binding pose for the ARG127 -THR128-PRO129, C is the predicted binding pose for the cp149 dimer receptor of BCM-599, D is the predicted binding pose for the three peptides, and D represents the interaction between the proximal amino acid residues of BCM-599 and cp149 Lt; / RTI > receptor-ligand interaction.
FIG. 3 shows that the inhibitory effect of the predictive molecule was examined by in vitro assembly analysis and agarose gel analysis. In A and B, cp149 was treated with 13 molecules each having a final concentration of 25 μM, 0.9% (upper panel) and 1.5 % (Bottom panel) analyzed by SDS-PAGE and the order of the samples was as follows; A: -, +, 599, 598, 600, 601, 602, 603, 604; [C] BCM-599, [D] BCM-600, [E] BCM-602, [F] BCM- 604, [G] BCM-606, and [H] BCM-608 at a concentration of 1 μM to 25 μM.
Figure 4 shows the sucrose concentration gradient centrifugation results of cp149 assembled in Invitro. A to F represent protein molecules distributed in a sucrose concentration gradient, A is a negative control, B is a positive control, C is BCM-599, D is BCM-600, E is BCM-602, F is BCM-606 G is the result of analyzing the band intensity to more clearly show the shunt of the protein, N is the negative control group and P is the positive control group.
Figure 5 shows the quantitative PCR results and IC 50 values of virus titer after treatment of inhibitor candidate material with HepG2.2.15 material. In addition, CI-index results of relative synergy effects by mixing the inhibitor candidate with lamivudine at a specific ratio and performing the above-mentioned experiment. A is an isobolyte graph showing the compound lamubendin synergy pattern, the values normalized to the IC 50 of each compound. B is the CI index of the combination of BCM-599 / lamivudine and C is the result of the change of virus titer due to the addition of BCM-599 at a constant concentration (= 0.07 μM) of lamivudine.
Figure 6 is an electron micrograph (magnification: X80,000) of untreated cp149 and inhibitor candidate compound treated cp149 capsids. The assembled core particles were negatively stained using a 2% eurosilyl acetate. A is a non-assembled cp149 photograph and B is a photograph of fully assembled cp149 in reaction solution (50 mM Hepes, 15 mM NaCl, and 10 mM CaCl2 in pH 7.5) and C to F are BCM-599, BCM-600 , BCM-602, and BCM-606 treated with 25 [mu] M, respectively.
FIG. 7 shows the result of comparing the IC 50 values obtained from the results of the in vitro / in vivo information experiment with the binding energy predicted by the silico modeling. These values were converted to logarithmic scales, where A is the Invitro / Insilico relation and B is the Invivo / Incillico relation. As a result, the Root Mean Square Deviation (RMSD) was about 0.80, indicating that the cp149 model constructed here is a very effective means of screening inhibitors.
본원에서는 화학식 1의 아미드계 물질들이 높은 친화도로 코어 단백질 이량체의 다른 이량체와의 상호작용부위에 결합을 통해, 캡시드 형성을 억제함으로서 바이러스 생성을 억제할 수 있다는 발견에 근거한 것이다. 본원에서는 HBV 캡시드를 구성하는 코어 단백질 (core protein, cp) 의 X-선 회절분석 데이터를 바탕으로 이량체/육량체 구조의 모델을 구축한 후 라이브러리 스크리닝을 통해 물질을 발굴한 후, 이러한 물질이 캡시드 어셈블리를 억제할 수 있음을 실험적으로 검증하였다. The present invention is based on the discovery that the amide-based materials of formula (1) can inhibit virus production by inhibiting formation of capsid through binding to interaction sites of other dimers of the core protein dimer with high affinity. In this study, a model of the dimer / hemimeric structure was constructed based on the X-ray diffraction analysis data of the core protein (cp) constituting the HBV capsid, and the material was excavated through library screening. It is experimentally verified that the capsid assembly can be inhibited.
이에 한 양태에서 본원은 하기 화학식 I의 화합물 또는 그 염을 유효성분으로 포함하는 HBV 감염으로 인한 간질환 예방 또는 치료용 약학 조성물에 관한 것이다. In one aspect, the present invention relates to a pharmaceutical composition for preventing or treating liver disease caused by HBV infection comprising a compound of the formula (I) or a salt thereof as an active ingredient.
상기 화학식 1에서, In Formula 1,
A 는 C 또는 N 이고;A is C or N;
R1 및 R2 는 각각 수소 또는 할로겐이고, R 1 and R 2 are each hydrogen or halogen,
R3 및 R4 는 각각 수소, C1-C6의 직쇄 또는 분쇄상 알킬기, -C(=O)Ra, -S(=O)2Ra 이고, 상기 Ra 는 C1-C6의 직쇄 또는 분쇄상 알킬기, 치환 또는 비치환된 아릴기, 치환 또는 비치환된 헤테로 아릴기이다.
R 3 and R 4 are each a hydrogen, a C 1 -C 6 linear or branched alkyl group, -C (═O) R a , -S (═O) 2 R a wherein R a is C 1 -C 6 , A substituted or unsubstituted aryl group, or a substituted or unsubstituted heteroaryl group.
본원에 따른 화학식에서 사용되는 아릴기, 헤테로아릴기가 갖는“치환된”에서의 “치환”은 할로겐 원자, 할로겐 원자로 치환된 C1-C20의 알킬기(예: CCF3,CHCF2,CH2F,CCl3등), 히드록시기, 니트로기, 시아노기, 아미노기, 아미디노기, 히드라진, 히드라존, 카르복실기나 그의 염, 술폰산기나 그의 염, 인산이나 그의 염, 또는 C1-C20의 알킬기, C2-C20의 알케닐기, C2-C20의 알키닐기, C1-C20의 헤테로알킬기, C6-C20의 아릴기, C6-C20의 아릴알킬기, C6-C20의 헤테로아릴기, 또는 C6-C20의 헤테로아릴알킬기로 치환된 것을 의미한다.The "substituted" in the "substituted" group of the aryl group or the heteroaryl group used in the formula according to the present invention is a halogen atom, a C 1 -C 20 alkyl group substituted with a halogen atom (eg, CCF 3 , CHCF 2 , CH 2 F , CCl 3, etc.), a hydroxy group, a nitro group, a cyano group, an amino group, an amidino group, hydrazine, hydrazone, a carboxyl group or a salt thereof, a sulfonic acid group or a salt thereof, phosphoric acid or a salt thereof, or an alkyl group of C 1 -C 20, C 2 -C 20 alkenyl, C 2 -C 20 alkynyl group, C 1 -C 20 heterocyclic group, C 6 -C 20 aryl group, C 6 -C 20 arylalkyl group, C 6 -C 20 of the A heteroaryl group, or a C 6 -C 20 heteroarylalkyl group.
상기 화학식 1에서 사용되는 C1-C6의 알킬기의 구체적인 예로는 메틸, 에틸, 프로필, 이소부틸, sec-부틸, ter-부틸, neo-부틸, iso-아밀, 헥실 등을 들 수 있다.Specific examples of the C 1 -C 6 alkyl group used in
상기 화학식 1에서 사용되는 아릴기는 단독 또는 조합하여 사용되어, 하나 이상의 고리를 포함하는 방향족 시스템인 것을 의미하며, 예를 들어 페닐, 나프틸, 테트라히드로나프틸 등을 들 수 있다. 또한 상기 아릴기 중 하나 이상의 수소 원자는 상술한 “치환”에서 정의한 바와 같은 치환기로 치환가능하다.The aryl group used in the above formula (1) is used alone or in combination to mean an aromatic system containing at least one ring. Examples thereof include phenyl, naphthyl, tetrahydronaphthyl and the like. Also, at least one hydrogen atom of the aryl group may be substituted with a substituent as defined in the above-mentioned " substitution ".
화학식 1에서 사용되는 헤테로아릴기는 N, O, P 또는 S 중에서 선택된 하나 이상의 헤테로원자를 포함하고, 나머지 고리원자가 탄소인 유기 화합물인 것을 의미하며, 예를 들어 피리딜 등을 들 수 있다. 또한 상기 헤테로아릴기 중 하나 이상의 수소 원자는 상술한 “치환”에서 정의한 바와 같은 치환기로 치환가능하다.The heteroaryl group used in formula (1) means an organic compound having at least one heteroatom selected from N, O, P or S and the remaining ring atoms carbon, and examples thereof include pyridyl and the like. Further, at least one hydrogen atom of the heteroaryl group may be substituted with a substituent as defined in the above-mentioned " substitution ".
본원에서 할로겐은 F, Cl, Br, 또는 I 중 하나이다.
Halogen is one of F, Cl, Br, or I.
본원에 따른 한 구현예에서 상기 화학식 1의 화합물은 하기 화학식 2 또는 3으로 표시된다. In one embodiment according to the present application, the compound of formula (1) is represented by the following formula (2) or (3).
상기 화학식 2 또는 3에서,In the general formula (2) or (3)
R'1, R'2 , R'4 및 R'5 는 각각 수소 또는 할로겐이고, R ' 1 , R' 2 , R ' 4 and R' 5 are each hydrogen or halogen,
R'3 및 R'6 는 각각 수소, C1-C6의 직쇄 또는 분쇄상 알킬기, -C(=O)Ra, -S(=O)2Ra 이고, 상기 Ra 는 C1-C6의 직쇄 또는 분쇄상 알킬기, 치환 또는 비치환된 아릴기, 치환 또는 비치환된 헤테로 아릴기를 포함한다. 화학식 2 또는 3에서 알킬기, 치환 또는 비치환된 아릴기, 및 치환 또는 비치환된 헤테로 아릴기의 정의는 앞서 언급한 바와 같다.
R '3 and R' 6 are each a hydrogen, a linear or branched alkyl group of 6 C 1 -C, -C (= O) R a, -S (= O) 2 R a, wherein Ra is C 1 -C A substituted or unsubstituted aryl group, or a substituted or unsubstituted heteroaryl group. The definition of an alkyl group, a substituted or unsubstituted aryl group, and a substituted or unsubstituted heteroaryl group in the general formula (2) or (3) is as mentioned above.
화학식 1의 화합물의 예로는 다음과 화학식 4 내지 16으로 표시되는 화합물을 들 수 있다. Examples of the compound represented by the formula (1) include the compounds represented by the following formulas (4) to (16).
..
본원에 따른 화합물은 HBV 증식의 최전방에서 중요한 역할을 하는 캡시드 어셈블리를 억제 또는 차단할 수 있다. HBV는 유전체가 부분적으로 이중가닥인 3.2 kb의 원형 DNA 바이러스로, 유전체에는 4개의 겹친 해독틀이 존재하며, 이로부터 표면단백질 (HBs), 코어단백질 (HBc, Cp), 중합효소 (HBV pol), 및 X 단백질 (HBx)이 발현된다 (Seeger C, et al., Microbiol. Mol. Biol. Rev., 2000;64: 51-68). 코어단백질은 HBV pol, 프리게놈 RNA (pgRNA) 및 타 다른 단백질의 패키징에 관여하며, HBV 라이프사이클에서 중요한 역활을 하는 것으로 알려져 있다 (ibid.). 바이러스의 생성에는 코어단백질과 바이러스 게놈 및 타 단백질의 어셈블리가 필요하기 때문에, 코어단백질의 어셈블리는 HBV 복제에 있어 중요한 단계이다.Compounds according to the present invention can inhibit or block capsid assemblies that play an important role in the forefront of HBV proliferation. HBV, a core protein (HBc, Cp), a polymerase (HBV pol), and a surface protein (HBs), is a 3.2 kb circular DNA virus with a partially double stranded genome. , And X protein (HBx) are expressed (Seeger C, et al., Microbiol. Mol. Biol. Rev., 2000; 64: 51-68). Core proteins are involved in the packaging of HBV pol, free genomic RNA (pgRNA) and other proteins, and are known to play an important role in the HBV life cycle ( ibid. ). Assembly of core proteins is an important step in HBV replication, as the production of viruses requires assembly of core proteins, viral genomes and other proteins.
코어 단백질은 코어 어셈블리에 필요한 N-말단 부위와 바이러스 복제를 조절하는 C 말단으로 이루어진 두 개의 영역을 갖는 183-185개 아미노산으로 구성되어있다 (ibid.). 코어단백질은 바이러스의 캡시드를 형성하며, 과정에서 코어단백질은 이량체를 형성하고, 이어 이량체간의 상호작용에 의해 궁극적으로 180개 또는 240개의 코어단백질이 캡시드를 형성하게 된다. 캡시드는 패키지된 바이러스와 숙주 인자 (host factor)의 보호에 필수적인 역활을 한다. 따라서 캡시드의 형성을 억제 방해할 경우, HBV 증식으로 인한 질환의 예방 또는 치료에 유용하게 사용될 수 있다. The core protein is composed of 183-185 amino acids (ibid.) With two regions consisting of the N-terminal region required for core assembly and the C-terminus regulating viral replication. The core protein forms the capsid of the virus, and in the process the core protein forms a dimer, which in turn interacts with the dimer to ultimately form capsids of 180 or 240 core proteins. Capsid is essential for the protection of packaged viruses and host factors. Therefore, when inhibiting the formation of capsid, it can be usefully used for the prevention or treatment of diseases caused by HBV proliferation.
따라서 본원에 따른 화학식 1의 화합물은 캡시드 이량체 및/또는 육량체와의 결합을 통한 캡시드 어셈블리를 효과적으로 억제하여 바이러스 증식을 억제하여, 바이러스로 인한 다양한 간질환의 치료 또는 예방에 효과적으로 사용될 수 있다. Therefore, the compound of formula (1) according to the present invention can effectively inhibit the capsid assembly through binding with capsid dimer and / or plasma to inhibit viral proliferation, and can be effectively used for the treatment or prevention of various liver diseases caused by viruses.
본원에서 사용된 용어 "간질환" 이란, 간 기능에 장해가 있는 증상을 가리킨다. 예를 들어, 바이러스성 간염(특히, HBV에 의해 매개된 간염), 지방간, 간부전, 간경화 및 간세포암을 들 수 있다. 병명이 확실치 않은 경우라도, GOT, GPT, γ-GTP 등의 간 기능의 지표에 이상이 관찰되는 증상도 간질환에 포함되며, 특히 HBV 감염으로 인한 것이다.As used herein, the term " liver disease "refers to a symptom in which the liver function is impaired. For example, viral hepatitis (especially hepatitis mediated by HBV), fatty liver, liver failure, liver cirrhosis and hepatocellular carcinoma. Even if the pathology is unclear, symptoms of abnormalities in liver function indicators such as GOT, GPT, and γ-GTP are also included in liver disease, especially due to HBV infection.
특히 간세포암은 간에서 발생하는 원발성 간암을 의미하며, 다른 부위에서 생겨서 간으로 전이된 암은 간세포암은 포함되지 않는다. 간세포암은 전체 간암의 90% 이상을 차지하며, 환자의 40 내지 80%는 재발하는데, 대부분 다시 간에 재발하지만, 폐와 림프절, 복강을 둘러싸고 있는 안쪽 벽과 종격동에서 나타날 수도 있으며, 이러한 암도 본원에 포함된다. In particular, hepatocellular carcinoma refers to primary hepatocellular carcinoma originating in the liver, and cancer that has spread to other parts of the liver and has spread to the liver does not include hepatocellular carcinoma. Hepatocellular carcinoma accounts for more than 90% of all cancers and 40 to 80% of patients recur, most often recurring in the liver, but may also appear in the lining of the lungs, the inner wall surrounding the abdominal cavity, and the mediastinum. .
본원에서 사용된 용어 "치료" , “완화” 또는 “개선” 이란 본원에 따른 조성물의 투여로 HBV 감염으로 인한 질환의 증세를 호전시키거나 이롭게 변경하는 모든 행위를 의미한다. 본원이 속하는 기술분야에서 통상의 지식을 가진 자라면, 대한의학협회 등에서 제시된 자료를 참조하여 질환의 정확한 기준을 알고, 개선, 향상 및 치료된 정도를 판단할 수 있을 것이다.The term " treatment ", " alleviation ", or " improvement ", as used herein, refers to any act that improves or alleviates the symptoms of a disease caused by HBV infection upon administration of a composition according to the invention. Those skilled in the art will be able to ascertain the precise criteria of the disease by referring to the data provided by the Korean Medical Association, and to judge the degree of improvement, improvement, and treatment of the disease.
본 명세서에서 사용된 용어 "예방" 은 본원에 따른 조성물의 투여로 HBV 감염으로 인한 질환의 발병을 억제 또는 지연시키는 모든 행위를 의미한다. 본원의 추출물은 감염 초기 또는 증상이 나타나기 전에 투여할 경우 이러한 질환을 예방할 수 있다는 것은 당업자에게 자명할 것이다.
As used herein, the term "prophylactic " refers to any act that inhibits or delays the onset of a disease due to HBV infection upon administration of a composition according to the invention. It will be apparent to those skilled in the art that the extract of the present invention can prevent such diseases when administered at the early stage of infections or before symptoms appear.
이에 다른 양태에서 본원은 또한 화학식 I의 화합물을 포함하는 HBV 캡시드 어셈블리 억제 또는 차단용 조성물에 관한 것이다. In another aspect thereof, the present invention is also directed to compositions for inhibiting or blocking HBV capsid assembly comprising a compound of formula (I).
또다른 양태에서 본원은 화학식 I의 화합물을 포함하는 HBV 캡시드 어셈블리 억제 또는 차단을 통한 간질환 예방 또는 치료용 조성물에 관한 것으로, 간질환에 대하여는 앞서 설명한 바와 같다. In another aspect, the present invention relates to a composition for preventing or treating liver disease through inhibition or blocking of HBV capsid assembly comprising a compound of formula (I), and liver diseases are as described above.
본원 조성물은 상기 언급한 유효성분 이외에 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 또는 유효성분의 용해성 및/또는 흡수성을 유지/증가시키는 화합물을 추가로 함유할 수 있다. 또한 본원의 조성물은 간질환의 치료 또는 예방을 위하여 단독으로, 또는 수술, 기타 약물치료 및 생물학적반응조절제를 사용하는 방법들과 병용하여 사용할 수 있다. The composition of the present invention may further contain, in addition to the above-mentioned effective ingredients, one or more active ingredients exhibiting the same or similar functions, or a compound that maintains / increases the solubility and / or absorbency of the active ingredient. The composition of the present invention can also be used alone or in combination with other methods for the treatment or prevention of liver diseases or using surgery, other drug therapy and biological response modifiers.
예를 들면 공지된 항바이러스제, 예를 들면 DNA 폴리머라제에 작용하여 증식을 억제하는 하나 이상의 약제와 함께 사용되어 상승작용을 유도할 수 있다. 한 구현예에서는 예를 들면 라미부딘(Lamivudin), 아데포비르 (Adefovir, ADV), 텔비부딘 (Telbivudine), 엔테카비르(Entecavir) 또는 테노포비르 (Tenofovir) 중 하나 이상과 함께 사용될 수 있으며, 이와의 병용 요법 즉 칵테일 요법으로 바이러스 증식을 더욱 효과적으로 억제할 수 있어, 관련 질환의 치료에 매우 유용하다. 각 성분의 비는 치료 목적 및 구체적 성분을 고려하여 절절한 비를 선택할 수 있으며, 이로 제한하는 것은 아니다 화학식 I의 화합물 대 HBV DNA 폴리머라제 억제제, 특히 라미부딘의 비는 약 1:1 내지 40:1이나 이로 제한하는 것은 아니다.
For example, a known antiviral agent, for example, a DNA polymerase, so as to induce synergism with one or more agents that inhibit proliferation. In one embodiment, for example, it can be used in combination with one or more of Lamivudin, Adefovir (ADV), Telbivudine, Entecavir or Tenofovir, Combination therapy, i.e., cocktail therapy, can inhibit virus proliferation more effectively and is very useful for the treatment of related diseases. The ratio of each component can be selected, but is not limited to, a reasonable ratio taking into account the therapeutic purpose and the specific ingredients. The ratio of compound of formula I to HBV DNA polymerase inhibitor, especially lamivudine, is about 1: 1 to 40: 1 But is not limited thereto.
본원의 조성물은 상기 언급한 유효성분 이외에 추가로 약제학적으로 허용 가능한 담체를 1종 이상 포함하여 제조할 수 있다. 약학적으로 허용 가능한 담체는 식염수, 멸균수, 링거액, 완충 식염수, 덱스트로즈 용액, 말토덱스트린 용액, 글리세롤, 에탄올, 리포좀 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있으며, 표적 기관에 특이적으로 작용할 수 있도록 표적 기관 특이적 항체 또는 기타 리간드를 상기 담체와 결합시켜 사용할 수 있다. 더 나아가 당해 기술분야의 적정한 방법으로 또는 레밍턴의 문헌(Remington's Pharmaceutical Science(최근판), Mack Publishing Company, Easton PA)에 개시되어 있는 방법을 이용하여 각 질환에 따라 또는 성분에 따라 바람직하게 제형화할 수 있다. In addition to the above-mentioned active ingredients, the composition of the present invention may further comprise at least one pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier may be a mixture of saline, sterilized water, Ringer's solution, buffered saline, dextrose solution, maltodextrin solution, glycerol, ethanol, liposome and at least one of these components. , A buffer solution, a bacteriostatic agent, and the like may be added. In addition, it can be formulated into injection formulations, pills, capsules, granules or tablets such as aqueous solutions, suspensions, emulsions and the like by additionally adding diluents, dispersants, surfactants, binders and lubricants, Specific antibody or other ligand can be used in combination with the carrier. Can further be suitably formulated according to the respective disease or ingredient according to the appropriate method in the art or using the methods disclosed in Remington's Pharmaceutical Science (recent edition), Mack Publishing Company, Easton PA have.
본원 조성물의 투여방법은 특별히 이에 제한되는 것은 아니며, 공지된 억제제의 투여방법을 적용할 수 있으며, 목적하는 방법에 따라 비경구 투여(예를 들어 정맥 내, 피하, 복강 내 또는 국소에 적용)하거나 경구 투여할 수 있으며, 비경구 투여의 경우 피부에 붙이는 패치형, 코/호흡기를 통해 투여할 수 있으며, 신속한 치료효과를 얻기 위해서는 정맥내 주사에 의한 투여가 바람직하다. 투여량은 환자의 체중, 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설률 및 질환의 중증도 등에 따라 그 범위가 매우 다양하다. 전형적인 약물의 경우 투약단위체는, 예를 들어 약 0.01 mg 내지 100 mg를 포함하나 상기 범위의 이하 및 이상의 범위를 배제하는 것은 아니다. 일일 투여량은 약 1μg 내지 10g 일 수 있으며, 하루 일회 내지 수회에 나누어 투여할 수 있다.
The method of administering the composition of the present invention is not particularly limited thereto, and the known method of administering the inhibitor may be applied. The composition may be administered parenterally (for example, intravenously, subcutaneously, intraperitoneally or topically) In case of parenteral administration, it can be administered through a patch type nasal / respiratory patch attached to the skin. In order to obtain a rapid therapeutic effect, administration by intravenous injection is preferable. The dosage varies widely depending on the patient's body weight, age, sex, health condition, diet, administration time, administration method, excretion rate, and severity of disease. For typical drugs, the dosage unit comprises, for example, from about 0.01 mg to 100 mg, but does not exclude the following ranges and ranges above. The daily dose may be about 1 μg to 10 g, and may be administered once a day or divided into several times a day.
다른 양태에서 본원은 B형 간염 바이러스 유래의 6개의 코어 단백질 단량체로 이루어진 헥사머에 관한 것이다. In another embodiment, the disclosure is directed to a hexamer consisting of six core protein monomers derived from hepatitis B virus.
헥사머를 구성하는 코어 단백질은 전장 또는 N 말단부터 149개 아미노산 잔기를 가질 수 있다. 전장은 183 개 내지 185개 아미노산 잔기를 가질 수 있다. 코어단백질 서열은 공지된 것으로 이로 제한하는 것은 아니나, 예를 들면 하기와 같은 서열번호 1의 서열을 가진다:The core protein constituting the hexamer may have 149 amino acid residues from the full length or N terminus. The total length may have from 183 to 185 amino acid residues. The core protein sequence is known and includes, but is not limited to, the sequence of SEQ ID NO: 1, for example:
:MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC. : MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRSPSPRRRSQSPRRRRSQSPASQC.
코어 단백질은 코어 어셈블리에 필요한 N-말단 부위와 바이러스 복제를 조절 하는 C 말단으로 이루어진 두 개의 영역을 갖는 183 내지 185개 아미노산으로 구성되어 있다. 코어단백질은 바이러스의 캡시드를 형성하며, 과정에서 코어단백질은 이량체를 형성하고, 이어 이량체간의 상호작용에 의해 궁극적으로 180개 또는 240개의 코어단백질이 캡시드를 형성하게 된다. 캡시드는 패키지된 바이러스와 숙주 인자 (host factor)의 보호에 필수적인 역활을 한다. 따라서 캡시드의 형성을 억제 방해할 경우, HBV 증식으로 인한 질환의 예방 또는 치료에 유용하게 사용될 수 있다. 본원에서는 캡시드 형성을 억제하는 물질을 발굴함에 있어서, 180 개 또는 240개의 코어단백질로 이루어진 캡시드가 아닌, 6개 코어단백질로 구성된 헥사머가 캡시드 억제제 발굴에 유용하게 사용될 수 있음을 발견하였다.The core protein consists of 183 to 185 amino acids with two regions consisting of the N-terminal region required for core assembly and the C-terminus regulating viral replication. The core protein forms the capsid of the virus, and in the process the core protein forms a dimer, which in turn interacts with the dimer to ultimately form capsids of 180 or 240 core proteins. Capsid is essential for the protection of packaged viruses and host factors. Therefore, when inhibiting the formation of capsid, it can be usefully used for the prevention or treatment of diseases caused by HBV proliferation. In the present invention, it has been found that a hexamer composed of six core proteins, rather than a capsid consisting of 180 or 240 core proteins, can be usefully used in the discovery of a capsid inhibitor in the discovery of substances inhibiting capsid formation.
본원에 따른 헥사머는 코어 단백질 이량체를 단위체로 하여, 이량체가 3개 결합한 육랑체로 단량체 당 1개의 홈 (groove)이 형성되며, 헥사머에는 총 6개의 홈이 형성된다. 이 중 6개 중 3개는 헥사머의 형성에 참여하고, 외부의 3개의 홈이 스크리닝에 사용된다. 상기 외부 3개의 홈은 하기 서열번호 1의 서열번호를 기준으로 아미노산 잔기 21-35, 101-120, 및 136-140로 형성된다. 상기와 같은 홈 구조를 형성하는 한 상기 서열에 일부 변이가 발생한 것도 포함되며, 홈을 형성하는 잔기의 구체적 위치도 이에 따라 변동이 있을 수 있다. A hexamer according to the present invention is a hexagonal body in which three dimers are combined with a core protein dimer as a unit, and one groove is formed per monomer, and a total of six grooves are formed in the hexamer. Three out of six of them participate in the formation of hexamers, and three external grooves are used for screening. The three external grooves are formed from amino acid residues 21-35, 101-120, and 136-140 based on the sequence numbers in SEQ ID NO: 1 below. As long as the groove structure as described above is formed, a part of the mutation occurs in the sequence, and the specific position of the residue forming the groove may vary accordingly.
다른 양태에서 본원은 또한 본원에 따른 헥사머를 이용한 상기 HBV의 캡시드 어셈블리 억제제를 스크리닝하는 방법에 관한 것이다. 상기 방법은 헥사머에 형성된 홈구조와 후보 화합물간의 결합력을 측정하는 단계; 및 결합을 억제하지 않는 대조군 화합물과 비교하여, 억제능이 있는 화합물을 후보 화합물로 선별하는 단계를 포함한다. 본원에 따른 헥사머를 이용한 구체적 예로는 이로 제한하는 것은 아니나, 본원에 따른 실시예에 기재된 것을 참조할 수 있다.
In another aspect, the present disclosure is also directed to a method of screening a capsid assembly inhibitor of the HBV with a hexamer according to the present disclosure. The method comprises: measuring a binding force between a groove structure formed in a hexamer and a candidate compound; And selecting the inhibitory compound as a candidate compound, as compared to a control compound that does not inhibit binding. Specific examples using hexamers according to the present invention include, but are not limited to, those described in the examples according to the present application.
이하, 본 발명을 하기의 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 의해 한정되는 것은 아니다.
Hereinafter, the present invention will be described in detail with reference to the following examples. However, the following examples are illustrative of the present invention, and the contents of the present invention are not limited by the following examples.
본 발명은 달리 언급이 없는 한 세포생물학, 세포배양, 분자생물학, 유전자 형질전환 기술, 미생물학, DNA 재조합기술에 관한 당업자의 기술수준 내인 통상의 기술을 사용하여 실시될 수 있다. 또한 일반적인 기술에 관한 보다 자세한 설명은 Molecular Biotechnology: (Bernard et al., ASM press 1994); Molecular Cloning: A Laboratory Manual, 3rd Ed. (Sambrook et al., Harbor Laboratory Press 2001); Short Protocols in Molecular Biology, 4th Ed. (Ausubel et al. eds., John Wiley &Sons 1999); DNA Cloning, Volumes I and II (Glover ed., 1985)을 참고할 수 있다.
The present invention may be practiced using conventional techniques within the skill of those skilled in the art of cell biology, cell culture, molecular biology, gene transformation techniques, microbiology, DNA recombinant techniques, unless otherwise indicated. A more detailed description of common techniques can also be found in Molecular Biotechnology: (Bernard et al., ASM press 1994); Molecular Cloning: A Laboratory Manual, 3rd Ed. (Sambrook et al., Harbor Laboratory Press 2001); Short Protocols in Molecular Biology, 4th Ed. (Ausubel et al., Eds., John Wiley & Sons 1999); DNA Cloning, Volumes I and II (Glover ed., 1985).
실시예Example
실시예 1 실험 물질 및 방법Example 1 Experimental Material and Method
본 실시예에서 사용된 물질 및 실험 방법은 다음과 같다.
Materials and experimental methods used in this example are as follows.
1-1. 실험에 사용한 물질1-1. Materials used in the experiment
항 Anti-HBcAb (Polyclonal Rabbit, 1:4000)은 Dako (Glostrup, Denmark)에서 수득하였다. Horseradish-conjugated 항-rabbit Ab (1:40,000) 및 마우스 단클론 항-FLAG Ab (5 μg/ml)는 Sigma (St. Louis, MO, United States) 유래이다. BL21 (DE3) + pLysS E. coli 및 pET28b 벡터는 Novagen (Madison, WI, United States) 유래이다. Isopropyl-h-d-1-thiogalactoside (IPTG)는 Duchefa Biochemie (Haarkem, Netherlands) 유래이다. Dulbecco's modified Eagle's medium (DMEM)은 Welgene (Daegu, Republic of Korea) 유래이다. 소태아 혈청은 Invitrogen (Carlsbad, CA, United States) 유래이다. 실시간 정량 PCR용 PCR SYBR-Green 반응혼합물은 Qiagen (Hilden, Germany) 유래이다. 화합물 라이브러리는 B&C Company (Seoul, Korea)에서 제공받았다.
Anti-Anti-HBcAb (Polyclonal Rabbit, 1: 4000) was obtained from Dako (Glostrup, Denmark). Horseradish-conjugated anti-rabbit Ab (1: 40,000) and mouse monoclonal anti-FLAG Ab (5 μg / ml) are from Sigma (St. Louis, MO, United States). BL21 (DE3) + pLysS E. coli and pET28b vectors are from Novagen (Madison, Wis., United States). Isopropyl-hd-1-thiogalactoside (IPTG) is derived from Duchefa Biochemie (Haarkem, Netherlands). Dulbecco's modified Eagle's medium (DMEM) is derived from Welgene (Daegu, Republic of Korea). Fetal serum is derived from Invitrogen (Carlsbad, CA, United States). Real-time quantitative PCR PCR The SYBR-Green reaction mixture is from Qiagen (Hilden, Germany). The compound library was provided by B & C Company (Seoul, Korea).
1-2. 바이러스 및 세포1-2. Viruses and cells
HepG2.2.15 세포는 10% 소태아 혈청을 포함하는 DMEM 배지를 사용하여 37℃ 5% CO2에서 조건에서 배양하였다.
HepG2.2.15 cells were cultured in DMEM medium containing 10% fetal bovine serum at 37 ° C and 5% CO 2 .
1-3. 1-3. 캡시드Capsid 단백질 구조 Protein structure 모델링modelling
이량체/헥사머 Cp149-HBcAg에 대하여 X-선 회절 분석을 통해 결정을 규명하였다(3.5 Å). cp149 및 cp183 각각에 대한 단량체 및 이량체 구조에 대한 인실리코 모델을 구축하였다. 이들 단백질의 구조는 종전 X-선 회절 분석 결과를 이용하였다 (Packianathan C et al., J. Virol. 2009;84(3): 1607-1615; Wynne SA, et al., Mol Cell. 1999;3(6): 771-780). 결정격자 중의 물분자는 빼내고, 사라진 잔기 및 원자를 추가하여 전장 모델을 구축하였다. 단백질 구조 시물레이션은 AMBER 및 CHARMM 힘의 장(Forece Field) 세트를 근거로 수행하였다. 각 원자의 부분 전하는 Momany-Rone 방법 (CHARMm FF)으로 적용하였다. 에너지 수준은 Adopted Basis-set Newton-Raphson (ABNR) 알고리즘으로 최소화하였다. 수득한 구조는 molecular volume integration (GBMV) 방법에 의한 Generalized Born model을 사용하여 1,000,000 사이클 동안 37℃에서 평형화되었고, 용매내 및 단백질 내부의 유전상수는 각각 80 및 4이었다(Smith JR, et al., Bioorg Med Chem 2012;20:1354-1363). 이를 근거로 인실리코에서 캡시드 어셈블리 억제제 후보 물질을 탐색하였으며, 구체적으로 이량체 모델을 이용하여 후보분자와 자유 이량체 간의 상호작용을 시물레이션하고, 헥사머 모델을 이용하여 HbcAg 분자 상호작용의 차이점을 관찰하여 보다 정교한 스크리닝과정을 수행하였다.
The crystal was identified by X-ray diffraction analysis on dimer / hexamer Cp149-HBcAg (3.5 A). A silico model for monomer and dimer structures was constructed for each of cp149 and cp183. The structure of these proteins was determined by X-ray diffraction analysis (Packianathan C et al., J. Virol. 2009; 84 (3): 1607-1615; Wynne SA et al., Mol Cell. 1999; (6): 771-780). The water molecules in the crystal lattice were removed, and dislodged residues and atoms were added to construct a full-field model. Protein structure simulation was performed based on the AMBER and CHARMM force field sets. The partial charges of each atom were applied as a Momany-Rone method (CHARMm FF). Energy levels were minimized by the Adopted Basis-set Newton-Raphson (ABNR) algorithm. The resulting structures were equilibrated at 37 DEG C for 1,000,000 cycles using a Generalized Born model by molecular volume integration (GBMV) method, and the dielectric constants in the solvent and in the protein were 80 and 4, respectively (Smith JR, et al. Bioorg Med Chem 2012; 20: 1354-1363). Based on these results, we have searched candidates for capsid assembly inhibitors in Insilico and simulated the interaction between candidate molecules and free dimers using a dimer model and observed the difference of HbcAg molecular interaction using a hexamer model A more elaborate screening process was performed.
1-4. 분자 1-4. molecule 다이나믹dynamic 시물레이션Simulation 및 And 다킹Dark 시물레이션Simulation
본 실시예에서 코어 단백질 아미노산 잔기 21-35, 101-120, 및 136-140로 둘러쌓인, 억제제와 같은 화합물 분자의 가능한 결합 부위로 작용할 수 있는 홈(groove) 구조를 규명하였다. 이 홈의 원래 기능은 이량체-이량체 상호작용 부위로서, 다른 이량체의 루프구조인 잔기 126-135에 결합한다. 이량체 모델에서 각 폴리펩타이드 사슬 당 2 개의 자유 홈이 있다. 육량체 모델에서 3 개의 내부 홈 구조는 루프 구조가 차지하여, 3개의 바깥 홈만을 라이브러리 스크리닝 및 수용체-리간드 상호작용 시물레이션에 사용할 수 있다. 본 실시예에서는 이와 같은 3개의 독립적 기전으로, CDOCKER, LibDock, 및 LigandFit 알고리즘 (Discivery Studio 3.1, accelrys, USA)을 사용하여 상기 홈에 맞춤으로 결합할 수 있는 분자를 규명하였다. 독킹 시물레이션을 사용하여 스크리닝을 수행한 후, 에너지 레벨 최소화 및 1,000,000 사이클 동안 37℃ 조건에서 평형화를 통해 상술한 바와 같이 가장 우수한 결합 포즈를 조사하였다.
In this example, a groove structure was identified that could act as a possible binding site for a compound molecule, such as an inhibitor, surrounded by core protein amino acid residues 21-35, 101-120, and 136-140. The original function of this groove is the dimer-dimer interaction site, which binds to moieties 126-135 which are loop structures of other dimers. In the dimer model there are two free grooves per each polypeptide chain. In the model, three inner groove structures occupy the loop structure, and only three outer grooves can be used for library screening and receptor-ligand interaction simulation. In this embodiment, the molecules capable of binding to the grooves were identified using the CDOCKER, LibDock, and LigandFit algorithms (Discivery Studio 3.1, accelrys, USA) with these three independent mechanisms. After performing the screening using the singing simulation, the best binding pose was investigated as described above through energy level minimization and equilibration at 37 DEG C for 1,000,000 cycles.
1-5. 1-5. 인비트로Invitro 어셈블리 분석 및 Assembly analysis and 슈크로스Sucrose 농도구배Concentration gradient 전기영동 Electrophoresis
Cp149는 종전에 기술된 바와 같이 준비하였다 (Kang HY, et al., Biochem. J. 2006;398: 311-317). Cp149 어셈블리를 위해, 일정 농도의 후보 화합물과 Cp149 (최종 농도 60μM) 를 어셈블리 반응 완충액 (50 mM HEPES (pH 7.5), 15mM NaCl, 10mM CaCl2)에서 혼합한 후 37℃에서 1시간 동안 정치하였다. 이어, 각 시료의 어셈블된 입자를 분리하여 0.9% 비변성 아가로스 젤에서 전기영동을 수행한 후 종전에 기술된 바와 같이 면역블롯을 수행되었다 (ibid). 슈크로스 농도구배 원심분리 및 뒤 이은 면역블롯도 종전에 기술된 바와 같이 면역블롯을 수행되었다 (ibid).
Cp149 was prepared as previously described (Kang HY, et al., Biochem. J. 2006; 398: 311-317). For the Cp149 assembly, a constant concentration of the candidate compound and Cp149 (
1-6. 실시간 1-6. real time PCRPCR 을 이용한 Using HBVHBV DNADNA 정량 dose
24웰 플레이트 각 웰을 가득채운(confluent)한 HepG2.2.15 세포를 도면에 기재된 바와 같은 일정 농도의 후보 화합물로 처리하였다. 24시간 후에, 배지를 수집한 후 방출된 비리온을 수확한 후 페놀로 추출하고, 에탄올로 침전하였다. 타이터를 정량 PCR로 종전에 기술된 바와 같이 측정하였다 (Shim HY, et al., Virology, 2011;410: 161-169). 요약하면 추출한 DNA를 HotStartTaq 폴리머라제를 포함하는 PCR SYBR Greeen 반응 혼합물 (Qiagen)에 추가한 후, 프라이머로 F-5′-GTGTCTGCGGCGTTTTATCA-3′, 및 R-5′-GACAAACGGGCAACATACCTT-3′를 사용하여 분석하였다. 상기 프라이머는 HBV 유전체의 379 내지 476 nt 부위를 증폭하여 98 bp의 산물이 생성된다. 반응조건은 다음과 같다: 95 °C에서 15 min, 이어 94 °C에서 15 s, 55 °C에서 30 s 및 72 °C에서 30 s 반응을 45주기. 배지에 포함된 HBV 농도는 pHBV 1.2 ×를 연속희석 (5.28× 106 copies per milliliter (cpm), 5.28× 105 cpm, 5.28× 104 cpm, 5.28× 103 cpm, 5.28× 102 cpm)하여 표준 곡선을 작성하여 사용하였다.
24 well plates HepG2.2.15 cells confluent in each well were treated with a certain concentration of candidate compound as shown in the figure. After 24 hours, the medium was collected and the released virions were harvested, extracted with phenol, and precipitated with ethanol. The titer was determined by quantitative PCR as previously described (Shim HY, et al., Virology, 2011; 410: 161-169). In brief, the extracted DNA was added to a PCR SYBR Greeen reaction mixture (Qiagen) containing a HotStartTaq polymerase and analyzed using F-5'-GTGTCTGCGGCGTTTTATCA-3 'and R-5'-GACAAACGGGCAACATACCTT-3' as primers Respectively. The primers amplify the 379-476 nt region of the HBV genome, resulting in a 98 bp product. The reaction conditions are as follows: 45 cycles at 95 ° C for 15 min, followed by 15 s at 94 ° C, 30 s at 55 ° C, and 30 s at 72 ° C. The concentration of HBV in the medium was determined by continuous dilution of pHBV 1.2 × (5.28 × 10 6 copies per milliliter (cpm), 5.28 × 10 5 cpm, 5.28 × 10 4 cpm, 5.28 × 10 3 cpm, and 5.28 × 10 2 cpm) A standard curve was created and used.
1-7. 1-7. ICIC 5050 의 계산Calculation of
각 화합물의 50% 억제효과를 나타내는 농도인 IC50을 결정하기 위해, 상술한 바와 같이 정량 PCR을 수행하였다. 단, 각 억제제는 100% DMSO로 희석하여 0.25 내지 50μM 농도로 사용하였다. 각 웰의 최종 DMSO 농도는 1% 이었다. 바이러스 유전체 타이터 수치를 % 억제로 전환하였다. 결과는 용량 대비 반응의 함수를 나타내는 시그모이드 커브로 작성하였으며, 이로부터 IC50을 계산하였다. 세포독성은 종전에 기술된 바와 같이 각 처리 24시간 후에 중성 적색 염료의 업테이크로 측정되었다 (Korba BE, et al., Antiviral Res, 1992;19: 55-70).
Quantitative PCR was performed as described above to determine the IC 50 , which is a concentration that represents a 50% inhibitory effect of each compound. Each inhibitor was diluted with 100% DMSO and used at a concentration of 0.25 to 50 μM. The final DMSO concentration in each well was 1%. The virus genome titer values were converted to% inhibition. The results were written as sigmoid curves representing the capacity-to-dose response, from which the IC 50 was calculated. Cytotoxicity was measured as an uptake of neutral
1-8. 라미뷰딘과 인비보 조합 분석1-8. Analysis of combination of lamivudine and invivo
라미뷰딘과 어셈블리는 억제하는 후보 화합물이 조합으로 사용된 경우 시너지여부를 조사하기 위하여 이들 분자를 도면에 기재된 바와 같은 다양한 농도로 24웰 플레이트의 HepG2.2.15 세포에 처리하였다. 24시간 후에 배지를 수집하여 종전에 기술된 바와 같이 바이러스 타이터를 측정하였다 (Shim HY, et al., Virology, 2011;410: 161-169). CI 지수는 종전과 같이 결정되었다 (Chou T. et al., Pharmacological Review, 2006;58(3): 621-681).
The lamivudine and assembly were treated with 24-well plates of HepG2.2.15 cells at various concentrations as described in the figure to investigate synergy if inhibitory candidate compounds were used in combination. After 24 hours, the medium was collected and the virus titer was measured as previously described (Shim HY, et al., Virology, 2011; 410: 161-169). The CI index was determined as before (Chou T. et al., Pharmacological Review, 2006; 58 (3): 621-681).
1-9. 전자현미경1-9. Electron microscope
네가티브 염색을 위해, 어셈블된 코어 입자를 포함하는 10ul의 시료를 카본 코팅된 그리드에 적용한 후 1분간 정치하였다. 이어 그리드를 물로 세척한 후 2% 유라닐 아세테이트로 1분간 염색하였다. 사용된 전자 현미경은 80 kV에서 작동하는 LIBRA 120 (Carl Zeiss, Oberkochen, Germany)으로, 전자현미경 분석은 National Instrumentation Center for Environmental Management (대한민국)에 의뢰하여 수행하였다.
For negative staining, 10ul samples containing assembled core particles were applied to a carbon coated grid and allowed to stand for 1 minute. The grid was then washed with water and stained with 2% eurosyl acetate for 1 minute. The electron microscope used was LIBRA 120 (Carl Zeiss, Oberkochen, Germany) operating at 80 kV and electron microscopy was performed with the National Instrumentation Center for Environmental Management (Korea).
실시예 2 코어 단백질 구조를 근거한 라이브러리 스크리닝 및 발굴된 Example 2 Library Screening and Excavation Based on Core Protein Structure 캡시드Capsid 어셈블리 억제제 Assembly inhibitor
도 1에 기재된 바와 같이 이량체 및 육량체에 대한 구조 모델을 구축하였다. 이 중 이량체 모델을 이용하여 라이브러리의 화합물과 자유 이량체 간의 상호작용을 시물레이션하였고, 육량체 모델은 화합물-단백질 간 상호작용에 있어 차이점을 관찰하고, 스크리닝 방법의 효율 개선에 사용하였다. As shown in Fig. 1, a structural model for the dimer and the mass was constructed. Among them, the dimer model was used to simulate the interaction between the library compound and the free dimer, and the model was used to observe the differences in the compound - protein interaction and to improve the efficiency of the screening method.
본 실시예에서 사용한 라이브러리는 1128개의 약물유사 분자로 구성되며, 이 중 이량체 또는 육량체의 홈 구조에 맞아 떨어질 수 있는 구조를 갖는 화합물을 발굴하여, 결합 친화도 및 안정성을 조사하였다. 그 결과 표 1에 나타난 바와 같이 총 13개의 화합물을 선별하였다. 이 들은 두 종류의 분자 패밀리 즉 이들은 유사한 골격 구조 및 잔기 구조를 갖는 2-아미노-N-(2,6-디클로로피리딘-3-일)아세트아미드 계 및 N-(2,4-디클로로페닐)-2-(메틸아미노)아세트아미드 계에 속하며 이들은 모두 전반적 구조적 유사성을 가진다. 특히 이 중 BCM-599 및 BCM-606이 이량체 및 육량체 모델 모두에서 우수한 결합 에너지 및 결합 안정성을 나타냈다. 이량체 모델에서 2개의 홈 간의 친화도 차이는 무시할 만한 것이었으나, 육량체 및 이량체 모델의 홈 간의 친화도 차이는 유의성이 있었다. 이러한 차이는 이량체 및 육량체 간의 구조(conformation) 적 차이로 인한 것으로 판단된다. 그 이유는 육량체의 홈이 이량체의 경우와 비교하여 보다 넓고 느슨해졌기(relaxed) 때문이다. 발굴된 분자의 결합 포즈는 홈의 중앙에 결합하는 ARG127-THR128-PRO129 트리펩타이드의 포즈와 매우 유사하였다 (도 2). 최종적으로 상기 두 개의 분자를 포함하는 13개의 분자를 라이브러리부터 선별하였다. The library used in this Example was composed of 1128 drug-like molecules, and the compound having a structure capable of matching with the groove structure of a dimer or a hemoglobin was excavated and its binding affinity and stability were investigated. As a result, a total of 13 compounds were selected as shown in Table 1. These include two kinds of molecular families: 2-amino-N- (2,6-dichloropyridin-3-yl) acetamide and N- (2,4-dichlorophenyl) 2- (methylamino) acetamide system, all of which have overall structural similarity. Among them, BCM-599 and BCM-606 exhibited excellent binding energy and binding stability in both dimer and hematological models. The difference in affinity between the two grooves in the dimer model was negligible, but the affinity difference between the grooves in the dimer and dimer models was significant. These differences are thought to be due to conformational differences between the dimers and the plasma masses. The reason for this is that the groove of the mass body is wider and more relaxed than the case of the dimer. The binding pose of the excavated molecule was very similar to the pose of the ARG127-THR128-PRO129 tripeptide binding at the center of the groove (FIG. 2). Finally, thirteen molecules containing the two molecules were selected from the library.
[표 1][Table 1]
실시예 3 발굴된 Example 3 캡시드Capsid 어셈블리 억제제의 Assembly inhibitor 캡시드Capsid 타이터TITER 감소효과 Reduction effect
실시예 2에서 발굴된 13개의 분자 중 6개가 캡시드 어셈블리를 강하게 감소시키는 것으로 나타났다 (도 3 참조). 이 중 BCM-606 및 BCM-599가 가장 강력한 것으로 나타났으며, 모든 이량체의 어셈블리는 차단하였다. 다른 4개의 분자 즉 BCM-600, BCM-602, BCM-604, 및 BCM-608도 형성된 캡시드 농도를 상당히 감소시키는 것으로 나타났다. 이후 실험에서 6개의 화합물을 사용하였다.Six of the 13 molecules found in Example 2 were found to strongly reduce capsid assembly (see FIG. 3). Of these, BCM-606 and BCM-599 were found to be the strongest, and assembly of all dimers was blocked. The other four molecules, BCM-600, BCM-602, BCM-604, and BCM-608 were also shown to significantly reduce the capsid concentration formed. Six compounds were used in the subsequent experiments.
6개 화합물에 대한 EC50을 1-50μM 농도구배에서 어셈블리 분석을 이용하여 측정한 결과는 다음 표 2와 같다. 특히 4개 분자 BCM-600, BCM-602, BCM-604, 및 BCM-608에 대한 EC50은 20μM을 넘었다. The EC 50 values for the six compounds were determined using the assembly assay at a concentration gradient of 1-50 μM as shown in Table 2 below. In particular, the EC 50 for the four molecules BCM-600, BCM-602, BCM-604, and BCM-608 exceeded 20 μM.
[표 2][Table 2]
상기 표 2에 사용된 약어는 다음과 같다: NA: IC50 값이 범위를 벋어나 표준편차 해당사항 없음. ND: 저용해도로 인해 IC50, IC90, 및 표준편차 검출되지 않음. Stdev(50): IC50에 대한 표준편차
Abbreviations used in the above Table 2 are as follows: NA: Standard deviation over the range of IC 50 values Not applicable. ND: IC 50 , IC 90 , and standard deviation are not detected due to low solubility. Stdev (50): Standard deviation for IC 50
실시예 5 슈크로스 농도구배 전기영동 분석을 통한 캡시드 어셈블리 억제 과정 규명Example 5 Identification of capsid assembly inhibition process by sucrose concentration gradient electrophoresis analysis
BCM-599, BCM-600, BCM-602 및 BCM-606 화합물을 이용하여 슈크로스 농도구배 원심분리를 통한 억제 효과를 추가로 분석하였다. 결과는 도 4에 기재되어 있다. 이에 나타난 바와 같이, 10-50%의 슈크로스 농도구배를 이용한 결과, 침강계수의 차이로 인해 어셈블되지 않은 캡시드는 분획 1-4에서 검출되었으며, 완전히 어셈블된 캡시드는 분획 7-8에서 검출되었다. BCM-599 및 BCM-606 화합물의 경우 어셈블되지 않은 대조군과 유사한 분포 양상을 나타냈다. 즉 자유 이량체는 분획 1-4에서 검출되었으며, 다른 분획에서는 무시할 만큼의 신호가 검출되었다. 이는 BCM-599 및 BCM-606 화합물이 강력한 캡시드 어셈블리 억제제임을 나타내는 것이며, 이러한 양상은 cp149 이량체가 자유상태로 있는 경우에만 관찰되었다. BCM-600 또는 BCM-602의 경우도 캡시드는 비어셈블된 분획에서 상당히 많은 양이 검출되었다.
The inhibitory effect of BCM-599, BCM-600, BCM-602 and BCM-606 compounds on sucrose concentration gradient centrifugation was further analyzed. The results are shown in FIG. As shown above, as a result of using a sucrose concentration gradient of 10-50%, unassociated capsids were detected in fractions 1-4 due to differences in sedimentation coefficients, and fully assembled capsids were detected in fractions 7-8. BCM-599 and BCM-606 compounds showed a similar distribution pattern to the unassembled control group. That is, free dimer was detected in fractions 1-4 and negligible signals were detected in other fractions. This indicates that the BCM-599 and BCM-606 compounds are potent capsid assembly inhibitors, and this aspect was observed only when the cp149 dimer was in the free state. In the case of BCM-600 or BCM-602 too, a large amount of capsid was detected in the nonassembled fraction.
실시예 6 캡시드 억제제 화합물의 HepG2.2.15 세포에서의 비리온 타이터 (titer) 감소 효과Example 6 Virion titer reduction effect of capsid inhibitor compound in HepG2.2.15 cells
본원에서 발굴된 13개의 억제제를 HepG2.2.15 세포에 처리하여 세포질 환경에서의 억제 효과를 측정하였다. 결과는 표 2에 기재되어 있다. 표 2에 기재된 바와 같이 13개 중 3개의 화합물이 IC50 수치가 10μM 이하로 항 바이러스 활성을 나타냈다. 반면 각 화합물의 억제 강도는 인비트로 어셈블리에서 관찰될 결과와 상당히 상이하였다. 5개의 화합물은 50μM 아래의 억제 강도를 나타냈다. Thirteen inhibitors identified here were treated with HepG2.2.15 cells to determine the inhibitory effect in the cytoplasmic environment. The results are shown in Table 2. As shown in Table 2, three of the thirteen compounds showed antiviral activity with an IC 50 value of 10 μM or less. In contrast, the inhibition intensity of each compound was significantly different from that observed in the in vitro assembly. Five compounds showed inhibitory strength below 50 μM.
가장 강한 억제 효과는 BCM-599에서 나타났다 (표 2 참조). 인비트로 어셈블리와 비교하여, BCM-599의 IC50 수치는 10배 이상 감소하였다. 나아가, BCM-600의 경우도 IC50 수치가 5배 이상 감소하였다. 하지만, BCM-606 의 경우 IC50 수치는 약간 증가하였으며, BCM-600 수치를 상회하였다. 이러한 결과는 세포배양 조건에서는 BCM-606이 효과적으로 기능하지 않음을 나타낸다.
The strongest inhibitory effect was seen in BCM-599 (see Table 2). Compared to the in vitro assembly, the IC 50 value of BCM-599 was reduced by more than 10-fold. Furthermore, the IC 50 value of BCM-600 also decreased more than five-fold. However, in the case of BCM-606, the IC 50 value slightly increased, exceeding the BCM-600 value. These results indicate that BCM-606 does not function effectively under cell culture conditions.
실시예 7 캡시드 억제제 화합물 및 라미부딘의 조합에 의한 시너지 효과Example 7 Synergistic Effect of Combination of Capsid Inhibitor Compound and Lamivudine
억제제 후보 화합물을 라미부딘과 함께 사용하여 시너지 효과를 측정하였다. 결과는 도 5에 기재되어 잇다. 인비보에서 낮은 IC50 수치를 갖는 6개의 화합물을 선정하여 라미부딘과의 IC50 수치 및 조합 지수를 계산하였다 (표 3 참조).
라미부딘과 각각의 각 화합물의 인비보 IC50 수치를 기초로 25:75, 50:50; 75:25 비를 구성하여 모든 비에 대해 부가적 효과는 50% 억제가 되도록 하였다. 50:50의 경우 CI = 0.563의 값을 나타냈으며 그 외의 25:75, 75:25 비율에서도 CI = 0.65 수준을 나타냈다. 아래 표 3 에서 모든 조합은 화합물 양: 라미부딘의 양으로 표시하였으며, CI (combination 지수)는 Calcusyn 소프트웨어 (BIOSOFT, UK)를 사용하였다. 지수는 실험에 사용된 화합물 간의 상호작용에 대한 정량적 분석이다.
Synergistic effects were measured using the inhibitor candidate compound with lamivudine. The results are shown in FIG. Six compounds with low IC 50 values were selected in the infibox to calculate IC 50 values and combination index with lamivudine (see Table 3). Based on the in vivo IC 50 values of each compound of lamivudine and 25:75, 50:50; A 75:25 ratio was constructed so that the additive effect was 50% inhibition for all ratios. CI = 0.563 for 50:50 and CI = 0.65 for the other 25:75 and 75:25 ratios. In Table 3 below, all combinations are expressed in terms of the amount of compound: lamivudine, and the CI (combination index) is Calcusyn software (BIOSOFT, UK). The index is a quantitative analysis of the interactions between the compounds used in the experiment.
[표 3][Table 3]
실험 결과 모든 조합에서 시너지 효과를 나타내는 것으로 나타났다. 라미부딘 및 BCM-599를 함께 사용한 결과 CI 값이 0.7 미만으로, 이는 조합 사용으로 인한 상당한 시너지 효과를 의미한다. 시너지 효과는 하기 문헌 (Chou T. Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies. Pharmacological Review, 2006;58(3): 621-681)에 기재된 기준에 의해 판단된 것으로, 0.7 이하의 값이 일반적 시너지가 있는 것으로 정의한다. Experimental results show that synergistic effects are exhibited in all combinations. The combination of lamivudine and BCM-599 together resulted in a CI value of less than 0.7, indicating significant synergistic effects from combination use. The synergistic effect was judged by the criteria described in Chou T. Theoretical Basis, Experimental Design, and Computerized Simulation of Synergism and Antagonism in Drug Combination Studies, Pharmacological Review, 2006; 58 (3): 621-681, A value of 0.7 or less is defined as having a general synergy.
이어 최적 비율을 확인하기 위하여, 라미부딘 및 BCM-599를 다양한 농도 조합으로 사용하였다. 가장 낮은 CI 지수 (CI = 0.55) 는 12:1의 조합비에서 관찰되었다. 또한 라미부딘의 양을 고정하고 BCM-599의 양을 변화시키면서 시험한 결과 (표 4 참조), 라미부딘 0.07μM의 IC50에서, 1x 및 2x 배로 라미부딘을 추가에 의해 바이러스 타이터가 각각 27% 및 40% 감소하였다. 이러한 결과는 항 바이러스 효과를 증대시키기 위해 기존의 항바이러스제와 함께 본원 화합물이 유용하게 사용될 수 있음을 나타내는 것이다.In order to confirm the optimal ratio, lamivudine and BCM-599 were used in various concentration combinations. The lowest CI index (CI = 0.55) was observed at a combination ratio of 12: 1. In addition, lamivudine was fixed and the amount of BCM-599 was varied (see Table 4). In the IC 50 of lamivudine of 0.07 μM, virus titer was 27% and 40%, respectively, by adding lamivudine at 1 × and 2 ×, Respectively. These results indicate that the present compounds can be usefully used in combination with existing antiviral agents to enhance the antiviral effect.
[표 4][Table 4]
실시예 8 전자현미경 분석을 통한 억제 효과 규명Example 8 Identification of inhibitory effect by electron microscopic analysis
전자현미경 분석에서, 캡시드 입자는 원주가 30-35 nm의 원형의 속이 빈 입자로 검출된다. 네가티브 염색을 하면 캡시드는 중앙이 검은 밝은 고리모양을 나타내며, 특정 경우에는 중앙에 검은 부분이 없는 흰색입자로 검출되기도 한다. 이러한 현상은 유라닐 아세테이트에 대한 노출이 부족하여 생긴 결과로 분석된다. 비어셈블된 cp149 시료를 사용한 결과, 살아있는 입자는 검출되지 않았으며, 반-규칙적인 양상의 응집체가 검출되었으며, 완전히 어셈블된 경우에 이러한 양상은 검출되지 않았다. In electron microscopic analysis, capsid particles are detected as circular hollow particles with a circumference of 30-35 nm. Negative staining reveals that the capsids have a dark, bright ring at the center, and in some cases they are detected as white particles with no black spots in the center. This phenomenon is analyzed as a result of the lack of exposure to euvaniac acetate. As a result of using the unassembled cp149 sample, living particles were not detected, semi-regular phase agglutinates were detected, and this aspect was not detected when fully assembled.
억제제 화합물로 처리한 경우, 어셈블 및 비어셈블된 양상이 혼합되어 나타났다 (도 6 참조). 상대적은 적은 부분적으로 어셈블된 입자 및 높은 단백질 백그라운드가 관찰되었으며, 이는 완전히 어셈블된 시료에서는 나타나지 않았다. 이러한 결과는 어셈블리 반응과정에서 캡시드 입자로서 어셈블되었어야 할 이량체가 본 억제제 화합물로 인해 어셈블되지 못하고 남아 있었기 때문이다. 나아가, 화합물 중에서 상대적으로 강한 억제제인 BCM-599 및 606을 BCM-600 및 BCM-602과 비교한 경우, 후자에서 구모양의 입자가 보다 많이 관찰되었다. 이러한 결과는 억제제로서의 화합물간의 차이가 캡시드 어셈블리 완성에 영향을 미친다는 것을 나타낸다.
When treated with inhibitor compounds, assembled and unassembled aspects appeared mixed (see FIG. 6). Relatively few partially assembled particles and high protein background were observed, which did not appear in fully assembled samples. This is because the dimer that should have been assembled as capsid particles during the assembly reaction remained unassembled due to the inhibitor compound. Further, when the relatively strong inhibitors BCM-599 and 606 among the compounds were compared to BCM-600 and BCM-602, more spherical particles were observed in the latter. These results indicate that the differences between the compounds as inhibitors affect capsid assembly completion.
이상의 실험 결과에서 알 수 있는 바와 같이, 본원의 화학식 I의 화합물 및 이를 포함하는 약학 조성물은 캡시드 어셈블리의 억제를 통해 효과적으로 바이러스 증식을 억제하여 HBV 바이러스로 인한 다양한 간질환에 폭 넓게 사용될 수 있다.
As can be seen from the above experimental results, the compounds of formula (I) and pharmaceutical compositions containing them can be widely used for various liver diseases caused by HBV virus by effectively inhibiting virus multiplication through inhibition of capsid assembly.
상기와 같이 본원의 실시예에 대하여 상세하게 설명하였지만 본 발명의 권리범위는 이에 한정되는 것은 아니고, 다음의 청구범위에서 정의하고 있는 본원의 기본 개념을 이용한 당업자에 의한 다양한 변형 또는 개량된 것 또한 본원의 권리범위에 속하는 것이다.
While the present invention has been described in connection with what is presently considered to be practical exemplary embodiments, it is to be understood that the invention is not limited to the disclosed embodiments, but, on the contrary, is intended to cover various modifications and equivalent arrangements included within the spirit and scope of the appended claims. Of the right.
Claims (14)
,
상기 화학식 1에서,
A 는 C 또는 N 이고;
R1 및 R2 는 각각 수소 또는 할로겐이고,
R3 및 R4 는 각각 수소, C1-C6의 직쇄 또는 분쇄상 알킬기, -C(=O)Ra, -S(=O)2Ra 이고, 상기 Ra 는 C1-C6의 직쇄 또는 분쇄상 알킬기, 치환 또는 비치환된 아릴기, 치환 또는 비치환된 헤테로 아릴기임.
A pharmaceutical composition for preventing or treating liver disease caused by HBV infection comprising a compound of the following formula 1 or a salt thereof as an active ingredient:
,
In Formula 1,
A is C or N;
R 1 and R 2 are each hydrogen or halogen,
R 3 and R 4 are a straight or branched chain alkyl group each represent a hydrogen, C 1 -C 6, -C ( = O) R a, -S (= O) 2 R a , and wherein R is a straight chain of C1-C6 Or a branched alkyl group, a substituted or unsubstituted aryl group, or a substituted or unsubstituted heteroaryl group.
<화학식 2>
;
<화학식 3>
상기 화학식 2 또는 3에서,
R'1, R'2 , R'4 및 R'5 는 각각 수소 또는 할로겐이고,
R'3 및 R'6 는 각각 수소, C1-C6의 직쇄 또는 분쇄상 알킬기, -C(=O)Ra, -S(=O)2Ra 이고, 상기 Ra 는 C1-C6의 직쇄 또는 분쇄상 알킬기, 치환 또는 비치환된 아릴기, 치환 또는 비치환된 헤테로 아릴기임.
The pharmaceutical composition for preventing or treating liver disease according to claim 1, wherein the compound of formula (1) is represented by the following formula (2) or (3)
(2)
;
(3)
In the general formula (2) or (3)
R ' 1 , R' 2 , R ' 4 and R' 5 are each hydrogen or halogen,
R '3 and R' 6 are each a hydrogen, a linear or branched alkyl group of C 1 -C 6, -C (= O) R a, -S (= O) 2 R a, wherein R a is C 1 - C 6 linear or branched alkyl group, a substituted or unsubstituted aryl group, or a substituted or unsubstituted heteroaryl group.
<화학식 4>
;
<화학식 5>
;
<화학식 6>
;
<화학식 7>
;
<화학식 8>
;
<화학식 9>
;
<화학식 10>
;
<화학식 11>
;
<화학식 12>
;
<화학식 13>
;
<화학식 14>
;
<화학식 15>
; 또는
<화학식 16>
The pharmaceutical composition for preventing or treating liver disease according to claim 1, wherein the compound of formula (1) is represented by any one of the following formulas (4) to (16)
≪ Formula 4 >
;
≪ Formula 5 >
;
(6)
;
≪ Formula 7 >
;
(8)
;
≪ Formula 9 >
;
≪ Formula 10 >
;
≪ Formula 11 >
;
≪ Formula 12 >
;
≪ Formula 13 >
;
≪ Formula 14 >
;
≪ Formula 15 >
; or
≪ Formula 16 >
The method of claim 3, wherein the compound of Formula 1 is represented by Formula 5 (BCM-599), Formula 6 (BCM-600), Formula 8 (BCM-602), Formula 10 (BCM-604) ) Or a compound of formula 14 (BCM-608), for the prophylaxis or treatment of liver disease caused by HBV infection.
The pharmaceutical composition according to claim 1, wherein the liver disease includes hepatitis, fatty liver, liver failure, liver cirrhosis, or liver cancer.
The pharmaceutical composition according to claim 5, wherein the prevention or treatment of liver disease is by inhibition or blocking of HBV capside assembly.
The pharmaceutical composition according to claim 1, wherein the composition further comprises an HBV polymerase inhibitor.
The pharmaceutical composition according to claim 7, wherein the ratio of the compound to the HBV polymerase inhibitor is 1: 1 to 40: 1.
8. The method of claim 7 wherein the HBV polymerase inhibitor is selected from the group consisting of Lamivudin, Adefovir (ADV), Telbivudine, Entecavir or Tenofovir, A pharmaceutical composition for preventing or treating liver disease.
A hexamer consisting of six core proteins derived from hepatitis B virus.
11. The hexamer of claim 10, wherein the core protein has 149 amino acid residues from the full length or N terminus.
12. The hexamer according to claim 11, wherein the total length has the sequence of SEQ ID NO: 1, and the 149 amino acid residues have the sequence of 1 to 149 of SEQ ID NO:
[Claim 11] The method according to claim 10, wherein each core protein has 149 residues and comprises a groove formed of amino acid residues 21-35, 101-120, and 136-140 on the basis of the sequence of SEQ ID NO: 1 , Hexamer.
11. A method of screening a capsid assembly inhibitor of HBV using a hexamer according to claim 10, said method comprising measuring the binding force between said candidate compound and said groove structure formed in said hexamer.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020140042227A KR101578602B1 (en) | 2014-04-09 | 2014-04-09 | Pharmaceutical composition comprising compound having inhibitory activity against capsid assembly of Hepatitis B Virus for treating or preventing liver disease due to HBV infection |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020140042227A KR101578602B1 (en) | 2014-04-09 | 2014-04-09 | Pharmaceutical composition comprising compound having inhibitory activity against capsid assembly of Hepatitis B Virus for treating or preventing liver disease due to HBV infection |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20150117317A true KR20150117317A (en) | 2015-10-20 |
KR101578602B1 KR101578602B1 (en) | 2015-12-18 |
Family
ID=54399686
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020140042227A KR101578602B1 (en) | 2014-04-09 | 2014-04-09 | Pharmaceutical composition comprising compound having inhibitory activity against capsid assembly of Hepatitis B Virus for treating or preventing liver disease due to HBV infection |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR101578602B1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20200022753A (en) * | 2018-08-23 | 2020-03-04 | 광주과학기술원 | Use of ciclopirox to inhibit HBV core assembly |
-
2014
- 2014-04-09 KR KR1020140042227A patent/KR101578602B1/en active IP Right Grant
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20200022753A (en) * | 2018-08-23 | 2020-03-04 | 광주과학기술원 | Use of ciclopirox to inhibit HBV core assembly |
Also Published As
Publication number | Publication date |
---|---|
KR101578602B1 (en) | 2015-12-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
García-Serradilla et al. | Drug repurposing for new, efficient, broad spectrum antivirals | |
Guo et al. | Matrine is a novel inhibitor of the TMEM16A chloride channel with antilung adenocarcinoma effects | |
Wang et al. | In vitro inhibition of HBV replication by a novel compound, GLS4, and its efficacy against adefovir-dipivoxil-resistant HBV mutations | |
Rehman et al. | Therapeutic potential of Taraxacum officinale against HCV NS5B polymerase: In-vitro and In silico study | |
Pandeya et al. | Natural RNA dependent RNA polymerase inhibitors: Molecular docking studies of some biologically active alkaloids of Argemone mexicana | |
Jia et al. | Design, synthesis and primary biological evaluation of the novel 2-pyridone derivatives as potent non-nucleoside HBV inhibitors | |
Zhu et al. | Effects of Shenfu injection and its main components on the contraction of isolated rat thoracic aortic rings | |
Elfiky et al. | IDX-184 is a superior HCV direct-acting antiviral drug: a QSAR study | |
Lee et al. | Identification of a resveratrol tetramer as a potent inhibitor of hepatitis C virus helicase | |
Yang et al. | In vitro inhibition effects of hepatitis B virus by dandelion and taraxasterol | |
Behrendt et al. | Pentagalloylglucose, a highly bioavailable polyphenolic compound present in Cortex moutan, efficiently blocks hepatitis C virus entry | |
Li et al. | YiQiFuMai powder injection attenuates ischemia/reperfusion-induced myocardial apoptosis through AMPK activation | |
Shang et al. | In vitro and in vivo evaluation of the main protease inhibitor FB2001 against SARS-CoV-2 | |
AU2017271990B2 (en) | Methods for treating Hepatitis B virus infections using NS5A, NS5B or NS3 inhibitors | |
Zhang et al. | Current medicinal chemistry strategies in the discovery of novel HIV-1 ribonuclease H inhibitors | |
KR101578602B1 (en) | Pharmaceutical composition comprising compound having inhibitory activity against capsid assembly of Hepatitis B Virus for treating or preventing liver disease due to HBV infection | |
Shakya | Natural phytochemicals: Potential anti-HCV targets in silico approach | |
Mathayan et al. | Inhibition studies of HBV DNA polymerase using seed extracts of Pongamia pinnata | |
Hozáková et al. | Targeting the virus capsid as a tool to fight RNA viruses | |
Hayakawa et al. | Development of novel hepatitis B virus capsid inhibitor using in silico screening | |
CN109481427A (en) | Application of the compound FC-99 in preparation prevention or treatment acute hepatic failure drug | |
Selvaraj et al. | Identification of (2 R, 3 R)-2-(3, 4-dihydroxyphenyl) chroman-3-yl-3, 4, 5-trihydroxy benzoate as multiple inhibitors of SARS-CoV-2 targets; a systematic molecular modelling approach | |
Yang et al. | Anti-hepatitis B virus activity of α-DDB-FNCG, a novel nucleoside-biphenyldicarboxylate compound in vitro and in vivo | |
Wu et al. | Plx8394, a raf inhibitor, inhibits enterovirus 71 replication by blocking raf/mek/erk signaling | |
US20210052566A1 (en) | Methods for treating hepatitis b virus (hbv) infection |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant | ||
FPAY | Annual fee payment |
Payment date: 20181203 Year of fee payment: 4 |
|
FPAY | Annual fee payment |
Payment date: 20191203 Year of fee payment: 5 |