KR20150063660A - Photoactive methionine mimetics introduced Protein G mutants - Google Patents

Photoactive methionine mimetics introduced Protein G mutants Download PDF

Info

Publication number
KR20150063660A
KR20150063660A KR1020130148287A KR20130148287A KR20150063660A KR 20150063660 A KR20150063660 A KR 20150063660A KR 1020130148287 A KR1020130148287 A KR 1020130148287A KR 20130148287 A KR20130148287 A KR 20130148287A KR 20150063660 A KR20150063660 A KR 20150063660A
Authority
KR
South Korea
Prior art keywords
protein
binding site
antibody
antibody binding
substituted
Prior art date
Application number
KR1020130148287A
Other languages
Korean (ko)
Other versions
KR101598581B1 (en
Inventor
이명규
정봉현
이가비
문정희
Original Assignee
한국생명공학연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국생명공학연구원 filed Critical 한국생명공학연구원
Priority to KR1020130148287A priority Critical patent/KR101598581B1/en
Priority to PCT/KR2014/004803 priority patent/WO2014193176A1/en
Priority to US14/894,756 priority patent/US9914757B2/en
Publication of KR20150063660A publication Critical patent/KR20150063660A/en
Application granted granted Critical
Publication of KR101598581B1 publication Critical patent/KR101598581B1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4703—Inhibitors; Suppressors

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention relates to protein G mutants with photoactive methionine (pM) mimetics introduced thereto. The protein G mutants are prepared by introducing, into Escherichia coli, the sequence of the third antibody coupled region (PG-C3) of protein G (PG-C3) in which the 32, 35 and 40 positions of PG-C3 are substituted with Met residues and the 37-position are substituted with Arg residues, and plasmids which encode methyonyl tRNA synthase (MRS) mutants. The protein G mutants with pM mimetics introduced thereinto form covalent bonding with antibodies when irradiated with UV rays, so that the protein pM introduced G mutants can be employed usefully in preparing high sensitive biochips and biosensors.

Description

광활성 메티오닌 모사체 도입 단백질 G 변이체{Photoactive methionine mimetics introduced Protein G mutants}Photoactive methionine mimetics introduced protein G mutants {Photoactive methionine mimetics introduced Protein G mutants}

본 발명은 광활성 메티오닌(methionine) 모사체인 광메티오닌(photomethionine, pM) 도입 단백질 G 변이체 및 이의 제조 방법에 관한 것이다.
The present invention relates to a photomethionine (pM) introduced protein G mutant as a photoactive methionine mimetic and a method for producing the same.

항체는 항원에 매우 특이적으로 결합하기 때문에 질병의 진단 및 치료에 관련된 의학적 연구와 생물학적인 물질을 분석하는데 광범위하게 사용되어왔다 (Curr. Opin. Biotechnol. 12 (2001) 65-69, Curr. Opin. Chem. Biol. 5(2001) 40-45).　 최근에는 면역학적 측정법의 일환으로 항체를 고체지지물질에 고정화하고 전류, 저항, 질량의 변화 및 광학적인 특징 등을 측정하는 면역센서가 개발되었다 (affinity biosensors. vol. 7: Techniques and protocols). 그 중 광학적인 특징을 이용한 표면 플라즈몬 공명에 기초를 둔 면역센서가 상업화되었는데, 표면 플라즈몬 공명에 기초를 둔 바이오센서는 정성적인 정보(두 분자들이 특이적으로 결합을 하는지)와 정량적인 정보(반응 속도(Kinetics)와 평형상수(equilibrium constants))를 제공할 뿐만 아니라 표지 없이 실시간으로 감지할 수 있어, 항원과 항체 결합을 측정하는데 특히 유용하다(J. Mol. Recognit. 1999, 12, 390-408).
Antibodies have been used extensively in medical research and in the analysis of biological materials related to the diagnosis and treatment of diseases since they bind very specifically to antigens (Curr. Opin. Biotechnol. 12 (2001) 65-69, Curr. Opin Chem. Biol. 5 (2001) 40-45). In recent years, immunosensors have been developed that immobilize antibodies on a solid support material and measure changes in current, resistance, mass, and optical characteristics (affinity biosensors. Vol. 7: Techniques and protocols). Among them, immune sensors based on surface plasmon resonance using optical features have been commercialized. Biosensors based on surface plasmon resonance have been used for both qualitative information (whether two molecules specifically bind) and quantitative information Kinetics and equilibrium constants as well as being detectable in real time without labeling and are particularly useful for measuring antigen and antibody binding (J. Mol. Recognit. 1999, 12, 390-408 ).

면역센서에서는 고체지지물질에 항체를 선택적이고 안정적으로 고정화시키는 것이 매우 중요하다.　 항체를 고정화하는 기술에는, 크게 화학적 고정화방법과 물리적인 고정화방법의 두 가지가 있다.　 물리적인 방법(Trends Anal. Chem.2000 19, 530-540)은 재현성이 적고 단백질을 변성시키기 때문에 거의 사용되지 않고 있으며 화학적인 방법(Langumur, 1997, 13, 6485-6490)이 단백질을 공유결합으로 잘 결합시켜 재현성이 좋고 적용범위가 넓어 많이 사용되고 있다. 그러나 화학적인 방법으로 항체를 고정화시킬 때, 항체가 비대칭 거대분자이기 때문에 항체가 방향성을 잃거나 항원을 결합하는 활성을 잃게 되는 경우가 있다(Analyst, 1996, 121(3): 29R-32R).In immunosensors, it is very important to selectively and stably immobilize antibodies on solid support materials. There are two major techniques for immobilizing antibodies, a chemical immobilization method and a physical immobilization method. Physical methods (Trends Anal. Chem. 2000, 19, 530-540) are rarely used because they are less reproducible and denature proteins, and chemical methods (Langumur, 1997, 13, 6485-6490) They are well used because they are well reproducible and have a wide range of applications. However, when the antibody is immobilized by a chemical method, the antibody may lose its directionality or lose the activity of binding an antigen because the antibody is an asymmetric macromolecule (Analyst, 1996, 121 (3): 29R-32R).

항체의 항원결합능력을 더 좋게 하기 위해 항체를 고체지지물질에 결합시키기 전에 지지체를 사용하는 경우가 있으며, 이 지지체로 단백질 G를 사용하는 기술이 공지되어 있다.
In order to improve the antigen binding ability of the antibody, a support is used before bonding the antibody to the solid support material, and a technique of using the protein G as the support is known.

단백질 G(Protein G)는 대부분의 포유동물 면역글로블린 G(IgG) Fc 부위와 강한 결합을 하는 단백질로서, 항체칩 제조시 항체의 배향성을 높인 고감도 칩 제작에 매우 유용하다. 또한, 단백질 G를 나노입자 등에 결합시키고 항체를 결합시켜, 표적지향적 전달체 제조에 활용 가능하다. 그러나, 단백질 G와 항체의 결합은 가역적이기 때문에 혈액 시료를 사용하는 경우 혈액 내 항체로 대체될 수 있어 (Saleemuddin, Adv Biochem Eng Biotechnol, 64, 203-26, 1999), 이들 간에 공유 결합 형성이 중요하다. 이들 분자 간의 공유 결합은 화학적으로 유도할 수 있으나, 이들 분자들에 비특이적인 수식을 유발시키는 단점이 있다.
Protein G is a protein that binds strongly to most mammalian immunoglobulin G (IgG) Fc sites and is very useful for the production of highly sensitive chips with enhanced antibody orientation in the production of antibody chips. In addition, protein G can be bound to nanoparticles or the like and bound to an antibody, which can be utilized in the production of a target-oriented carrier. However, since the binding of the protein G to the antibody is reversible, it can be replaced with an antibody in the blood when a blood sample is used (Saleemuddin, Adv Biochem Eng Biotechnol, 64, 203-26, 1999) Do. Covalent bonds between these molecules can be chemically induced, but they have the disadvantage of causing nonspecific formulas in these molecules.

이에, 본 발명자들은 항체에 특이적으로 결합하는 단백질 G 변이체를 개발하기 위해 노력한 결과, 단백질 G의 세 번째 항체결합 부위(immunogloblin G binding region C3, PG-C3)의 32, 35 및 40 .번째 위치를 Met 잔기로, 37 번째 위치를 Arg 잔기로 치환한 PG-C3 플라스미드 및 메티오닐 tRNA 합성 효소(methyonyl tRNA synthase) 변이체인 MRS5m을 코딩하는 플라스미드를 대장균 내로 도입한 후 정제하여 광활성 모사체 도입 단백질 G 변이체를 획득하고, 상기 단백질 G 변이체 및 항체에 UV를 조사하여 특이적인 공유 결합을 형성하는 것을 확인함으로써, 상기 광활성 메티오닌 모사체 도입 단백질 G 변이체를 고감도 바이오칩(biochip) 및 바이오센서(biosensor) 제조에 유용하게 사용할 수 있음을 확인함으로써 본 발명을 완성하였다.
As a result of efforts to develop a protein G variant that specifically binds to an antibody, the present inventors have found that the 32nd, 35th and 40th positions of the third antibody binding site (immunoglobulin G binding region C3, PG-C3) As a Met residue, a PG-C3 plasmid in which the 37th position was substituted with Arg residue, and MRS5m as a methionyl tRNA synthase mutant were introduced into E. coli and purified to obtain a photoactive transgenic protein G The present inventors confirmed that the mutant protein G mutant and the antibody were irradiated with UV to form a specific covalent bond, whereby the photoactive methionine-introduced protein G mutant was used for the production of a high-sensitivity biochip and a biosensor And thus the present invention has been completed.

본 발명의 목적은 단백질 G(protein G)의 첫 번째 항체 결합 부위(immunogloblin G binding region C1, PG-C1), 두 번째 항체 결합 부위(immunogloblin G binding region C2, PG-C2) 및 세 번째 항체 결합 부위(immunogloblin G binding region C3, PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체를 제공하기 위한 것이다.It is an object of the present invention to provide an immunoglobulin G binding region C1 (PG-C1), a second antibody binding region (immunoglobulin G binding region C2, PG-C2) and a third antibody binding site (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position, and aspartic acid (Asn) at the 40th position of the amino acid sequence selected from the group consisting of the immunoglobulin G binding region (Asp) are respectively substituted with methionine (Met) and asparagine (Asn) at the 37th position is substituted with arginine (Arg).

본 발명의 또 다른 목적은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된, 광활성을 갖는 광메티오닌(photomethionine, pM) 도입 단백질 G 변이체를 제공하기 위한 것이다.It is a further object of the present invention to provide a method for the detection of any one of the proteins selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site Glutamine (Gln) at the 32nd position from the N-terminal of the amino acid sequence, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are each substituted with methionine (Met), and asparagine ) Is an amino acid sequence substituted with arginine (Arg), to thereby provide photomethionine (pM) introduced protein G mutant having photoactivity.

본 발명의 또 다른 목적은 상기 단백질 G 변이체의 제조 방법을 제공하기 위한 것이다.
It is still another object of the present invention to provide a method for producing the protein G mutant.

본 발명의 목적을 달성하기 위하여, 본 발명은 단백질 G(protein G)의 첫 번째 항체 결합 부위(immunogloblin G binding region C1, PG-C1), 두 번째 항체 결합 부위(immunogloblin G binding region C2, PG-C2) 및 세 번째 항체 결합 부위(immunogloblin G binding region C3, PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체를 제공하는 것이다.In order to accomplish the object of the present invention, the present invention provides an immunoglobulin G binding region C2 (PG-C1), a first antibody binding region C1 (PG-C1), a second antibody binding region (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position, and the asparagine (Asn) at the 35th position from the N-terminus of any one amino acid sequence selected from the group consisting of: And the aspartic acid (Asp) at the 40th position are respectively substituted with methionine (Met), and the asparagine (Asn) at the 37th position is substituted with arginine (Arg).

또한, 본 발명은 상기 단백질 G 변이체를 암호화하는 폴리뉴클레오티드를 제공하는 것이다.The present invention also provides a polynucleotide encoding said protein G mutant.

또한 본 발명은 상기 폴리뉴클레오티드를 포함하는 발현벡터를 제공하는 것이다.The present invention also provides an expression vector comprising the polynucleotide.

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된, 광활성을 갖는 광메티오닌(photomethionine, pM) 도입 단백질 G 변이체를 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted by methionine (Met) and asparagine (Photomethionine, pM) introduced protein G variant consisting of an amino acid sequence substituted with arginine (Arg).

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열에서, N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)을 각각 메티오닌(Met)으로 치환시키고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환시키는 단계를 포함하는 단백질 G 변이체의 제조 방법을 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted with methionine (Met), and asparagine ) With arginine (Arg).

또한, 본 발명은 In addition,

1) 광메티오닌 도입을 위한 메티오닐 tRNT 합성효소(methionyl tRNA synthase, MRS) 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터 및 상기 단백질 G 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터를 각각 제조하는 단계;1) preparing an expression vector comprising a polynucleotide encoding a methionyl tRNA synthase (MRS) variant for introducing phot methionine and an expression vector comprising a polynucleotide encoding the protein G mutant, respectively ;

2) 상기 단계 1)의 발현 벡터를 동시에 숙주세포에 도입하여 형질전환체를 제조하는 단계; 및2) introducing the expression vector of step 1) simultaneously into a host cell to prepare a transformant; And

3) 상기 단계 2)의 형질전환체를 배양하여 pM이 표지된 단백질 G 변이체를 발현시키는 단계를 포함하는, pM 도입 단백질 G 변이체의 제조 방법을 제공한다.3) culturing the transformant of step 2) to express pM-labeled protein G mutant.

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체, 및 항체 또는 이의 단편이 결합된 융합 단백질을 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted by methionine (Met) and asparagine A protein G mutant consisting of an amino acid sequence substituted with arginine (Arg), and a fusion protein in which an antibody or fragment thereof is bound.

또한, 본 발명은 상기 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 바이오 칩을 제공한다.The present invention also provides a biochip comprising the antibody or fragment thereof bound to the protein G mutant.

또한, 본 발명은 상기 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 바이오 센서를 제공한다.The present invention also provides a biosensor comprising an antibody or fragment thereof bound to the protein G mutant.

아울러, 본 발명은 상기 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 항체 표지 정맥주사용 나노입자 전달체를 제공한다.
In addition, the present invention provides an antibody-labeled intravenous nanoparticle carrier comprising an antibody or fragment thereof bound to the protein G mutant.

본 발명의 광활성 광메티오닌(phohmethionine, pM) 도입 단백질 G 변이체는 고배향성 뿐만 아니라 UV를 조사에 의해 항체와 특이적으로 고효율 공유 결합을 형성하므로, 혈액 시료 분석용 항체칩, 고감도 바이오칩(biochip) 및 바이오센서(biosensor) 개발에 유용하게 사용될 수 있다.
Since the protein G variant of the present invention incorporates not only high orientation but also high specificity covalent bond specifically to the antibody by UV irradiation, the antibody chip for analyzing a blood sample, the high sensitivity biochip and the high sensitivity biochip It can be used for the development of biosensors.

도 1은 pET-28at 플라스미드(plasmid) 구조를 모식화한 도이다.
도 2는 제작한 pET-PG 및 pET-2xPG 플라스미드 구조를 모식화한 도이다.
도 3은 제작한 pET-2xPG 변이체 플라스미드 구조를 모식화한 도이다:
●: 변이 후 발현되는 아미노산 및 위치들 표시;
▲ : 종료 코돈 표시; 및
★: 도입된 시스테인(cysteine) 위치 표시.
도 4는 제작한 pET-PG 변이체 플라스미드 구조를 모식화한 도이다:
●: 변이 후 발현되는 아미노산 및 위치들 표시;
▲ : 종료 코돈 표시; 및
★: 도입된 시스테인 위치 표시.
도 5는 정상 MRS(MRSwt) 또는 MRS5m 도입에 의한 pM 표지 단백질 G의 발현량을 나타낸 도이다:
1: MRSwt 및 6H-2xPG2m 공동 발현, LB, 아라비노오스(arabinose) MRSwt 유도(induction) 전;
2: MRSwt 및 6H-2xPG2m 공동 발현, MRSwt 및 6H-2xPG2m 공동 발현. LB, 아라비노오스 MRSwt 유도 후;
3: MRSwt 및 6H-2xPG2m 공동 발현, M9BV+1/2 CSM-Met 결핍(starvation);
4: MRSwt 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ Met 포함된 CSM-Met;
5: MRSwt 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ pM 포함된 CSM-Met;
6: MRS5m 및 6H-2xPG2m 공동 발현, M9BV+1/2 CSM-Met 결핍;
7: MRS5m 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ Met 포함된 CSM-Met;
8: MRS5m 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ pM 포함된 CSM-Met;
9: MRS5m 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ 0 mg/㎖ pM 포함된 CSM-Met;
10: MRS5m 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ 0.05 mg/㎖ pM 포함된 CSM-Met;
11: MRS5m 및 6H-2xPG2m 공동 발현, M9BV로 용해한 IPTG 유도+ 0.1 mg/㎖ pM 포함된 CSM-Met;.
도 6은 6H-2xPG2m의 정제 양상을 나타낸 도이다:
1 및 6: 초음파 분쇄(sonication) 후 침점물(pricipitate);
2 및 7: 초음파 분쇄 후 상층액(supernatant);
3 및 8: Ni-NTA 아가로오스(agarose)에 결합하지 않는 분획(fraction);
4 및 9: 10 mM 이미다졸(imidazole) 용출; 및
5 및 10; 150 mM 이미다졸 용출.
도 7은 6H-2xPG3m 정제 양상을 나타낸 도이다:
1 및 5: 초음파 분쇄 후 상층액(supernatant);
2 및 6: Ni-NTA 아가로오스(agarose)에 결합하지 않는 분획(fraction);
3 및 7: 60 mM 이미다졸(imidazole) 용출; 및
4 및 8; 150 mM 이미다졸 용출.
도 8은 자외선 특이 pM 표지 6H-2xPG4m와 IgG 또는 Fc간의 광활성 공유결합 형성을 나타낸 도이다.
도 9는 자외선 특이 pM 표지 6H-PG4m과 IgG 또는 Fc 간의 광활성 공유 결합 형성을 나타낸 도이다.
도 10은 2-머캅토에탄올(2-mercaptoethanol, 2ME) 존재 유무에 따른 자외선 특이 pM 표지 6H-PG4m 또는 6H-PG4m과 IgG 또는 Fc 간의 광활성 공유 결합 양상을 나타낸 도이다.
도 11은 IgG와 단백질 G의 공유결합에 의한 혈액내 항체의 치환 억제능을 나타낸 도이다.
도 12는 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)의 3차 구조를 나타낸 도이다:
녹색: PG-C1과 비교하여 약간의 기능적 차이를 갖는 아미노산 변이;
빨간색: 기능적 차이가 비교적 큰 아미노산 변이;
파란색: 본 발명에서 치환한 아미노산들(Q32, N35, N37 및 D40)로 3차 구조에서 보전이 매우 잘 되어 있음;
노란색-분홍색: PG-C2;
하늘색-흰색: PG-C3, 치환부위는 분홍색 및 흰색으로 표시; 및
녹색: 항체 Fc 부위.FIG. 1 is a schematic diagram of a pET-28at plasmid structure.
Fig. 2 is a schematic diagram of the pET-PG and pET-2xPG plasmid constructs.
FIG. 3 is a schematic diagram of the plasmid structure of the produced pET-2xPG mutant:
●: marking amino acids and positions expressed after mutation;
▲: End codon indication; And
★: Indication of cysteine position introduced.
FIG. 4 is a diagram schematically showing the pET-PG mutant plasmid structure produced:
●: marking amino acids and positions expressed after mutation;
▲: End codon indication; And
★: Indication of cysteine position introduced.
Figure 5 shows the expression levels of pM labeled protein G by introduction of normal MRS (MRSwt) or MRS5m:
1: Co-expression of MRSwt and 6H-2xPG2m, LB, before arabinose MRSwt induction;
2: co-expression of MRSwt and 6H-2xPG2m, co-expression of MRSwt and 6H-2xPG2m. LB, arabinose After MRSwt induction;
3: co-expression of MRSwt and 6H-2xPG2m, M9BV + 1/2 CSM-Met starvation;
4: co-expression of MRSwt and 6H-2xPG2m, IPTG induction + Met containing CSM-Met dissolved with M9BV;
5: co-expression of MRSwt and 6H-2xPG2m, IPTG induced by M9BV + pM CSM-Met;
6: MRS5m and 6H-2xPG2m coexpression, M9BV + 1/2 CSM-Met deficiency;
7: MRS5m and 6H-2xPG2m coexpression, IPTG induction with M9BV + Met CSM-Met included;
8: MRS5m and 6H-2xPG2m coexpression, IPTG induced by M9BV + pM CSM-Met;
9: co-expression of MRS5m and 6H-2xPG2m, CSM-Met with IPTG induction + 0 mg / ml pM dissolved with M9BV;
10: MRS5m and 6H-2xPG2m coexpression, CSM-Met with IPTG induction + 0.05 mg / ml pM dissolved with M9BV;
11: MRS5m and 6H-2xPG2m coexpression, CSM-Met with IPTG induction + 0.1 mg / ml pM dissolved with M9BV;
6 shows a purification scheme of 6H-2xPG2m:
1 and 6: pricipitate after ultrasonic sonication;
2 and 7: supernatant after sonication;
3 and 8: a fraction that does not bind to Ni-NTA agarose;
4 and 9: elution of 10 mM imidazole; And
5 and 10; 150 mM imidazole elution.
Figure 7 shows a 6H-2xPG3m purification phase:
1 and 5: supernatant after sonication;
2 and 6: a fraction that does not bind to Ni-NTA agarose;
3 and 7: 60 mM imidazole elution; And
4 and 8; 150 mM imidazole elution.
Fig. 8 shows photoactive covalent bonding between an ultraviolet-specific pM label 6H-2xPG4m and IgG or Fc.
Fig. 9 shows photoactive covalent bonding between an ultraviolet-specific pM label 6H-PG4m and IgG or Fc.
10 is a graph showing the photoactive covalent bonding between an ultraviolet specific pM-labeled 6H-PG4m or 6H-PG4m and IgG or Fc depending on the presence or absence of 2-mercaptoethanol (2ME).
Fig. 11 is a graph showing the ability of the IgG and protein G to inhibit the substitution of antibodies in blood by covalent bonding. Fig.
12 shows a tertiary structure of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3)
Green: amino acid variation with slight functional differences compared to PG-C1;
Red: relatively large amino acid variations in functional differences;
Blue: Amino acids (Q32, N35, N37 and D40) substituted in the present invention are very well conserved in the tertiary structure;
Yellow-pink: PG-C2;
Light blue-white: PG-C3, substitution sites pink and white; And
Green: Antibody Fc region.

이하, 본 발명을 상세히 설명한다.
Hereinafter, the present invention will be described in detail.

본 발명은 단백질 G(protein G)의 첫 번째 항체 결합 부위(immunogloblin G binding region C1, PG-C1), 두 번째 항체 결합 부위(immunogloblin G binding region C2, PG-C2) 및 세 번째 항체 결합 부위(immunogloblin G binding region C3, PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체를 제공한다.The present invention relates to a method for screening a protein G for the first antibody binding site (immunoglobulin G binding region C1, PG-C1), a second antibody binding site (immunoglobulin G binding region C2, PG-C2) glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position of the amino acid sequence selected from the group consisting of immunoglobulin G binding region C3 and PG- ) Is substituted with methionine (Met), and asparagine (Asn) at position 37 is substituted with arginine (Arg).

상기 단백질 G의 첫 번째 항체 결합 부위는 서열번호 1의 아미노산 서열로 구성되는 것이 바람직하나 이에 한정되지 않는다.The first antibody binding site of the protein G preferably comprises the amino acid sequence of SEQ ID NO: 1, but is not limited thereto.

상기 단백질 G의 두 번째 항체 결합 부위는 서열번호 2의 아미노산 서열로 구성되는 것이 바람직하나 이에 한정되지 않는다.The second antibody binding site of the protein G is preferably composed of the amino acid sequence of SEQ ID NO: 2, but is not limited thereto.

상기 단백질 G의 세 번째 항체 결합 부위는 서열번호 3의 아미노산 서열로 구성되는 것이 바람직하나 이에 한정되지 않는다.The third antibody binding site of the protein G is preferably composed of the amino acid sequence of SEQ ID NO: 3, but is not limited thereto.

상기 단백질 G의 첫 번째 항체 결합 부위, 두 번째 항체 결합 부위 또는 세 번째 항체 결합 부위는 1 개 또는 2 개 포함되는 것이 바람직하나 이에 한정되지 않는다.The first antibody binding site, the second antibody binding site, or the third antibody binding site of the protein G may include one or two, but is not limited thereto.

상기 단백질 G의 치환된 항체 결합 부위는 도 12와 같이 단백질 G의 첫 번째 항체 결합 부위(서열번호 1: TYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE), 두 번째 항체 결합 부위(서열번호 2: TYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE) 및 세 번째 항체 결합 부위(서열번호 3: TYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE) 간 아미노산 서열 및 3차 구조가 서로 보존되어 있다(Olsson et al., Eur J Biochem, 168, 319-24, 1987).The protein-substituted antibody binding of the G region is the first antibody binding site of protein G as shown in Figure 12 (SEQ ID NO: 1: TYKLILNGKTLKGETTTEAVDAATAEKVFK Q YA N D N GV D GEWTYDDATKTFTVTE), the second antibody binding site (SEQ ID NO: 2: TYKLVINGKTLKGETTTEAVDAATAEKVFK Q YA N D N GV D GEWTYDDATKTFTVTE) and the third antibody binding site (SEQ ID NO: 3:. TYKLVINGKTLKGETTTKAVDAETAEKAFK Q YA N D N GV amino acid sequence and tertiary structure between D GVWTYDDATKTFTVTE) that are preserved with each other (Olsson et al, Eur J Biochem , 168, 319-24, 1987).

또한, 본 발명은 상기 단백질 G 변이체를 암호화하는 폴리뉴클레오티드를 제공한다.The present invention also provides a polynucleotide encoding said protein G mutant.

또한, 본 발명은 상기 단백질 G 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현벡터를 제공한다.The present invention also provides an expression vector comprising a polynucleotide encoding said protein G mutant.

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된, 광활성을 갖는 광메티오닌(photomethionine, pM) 도입 단백질 G 변이체를 제공한다.
The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted by methionine (Met) and asparagine (Photomethionine, pM) introduced protein G variant consisting of an amino acid sequence substituted with arginine (Arg).

본 발명의 구체적인 실시예에서, 본 발명자들은 먼저 서열 내부에는 메티오닌(methionine, Met) 잔기가 없는 단백질 G의 세 번째 항체결합 부위 (PG-C3, 서열번호 3, Olsson et al., Eur J Biochem, 168, 319-24, 1987)에 330-370 nm 자외선 조사에 의하여 공유결합 형성을 유도하는 Met 모사체인 광활성 메티오닌(photomethionine, pM; L-2-amino-5,5-azi-hexanoic acid)을 도입하기 위하여, 6x히스티딘(6xH)이 태그된 pET-28at 벡터(대한민국 특허출원 10-2013-0061895)에 1개 또는 2개 단백질 G 모티프(motif)를 포함한 벡터를 제조하였다(도 1 및 도 2 참조).In a specific embodiment of the present invention, the inventors first identified a third antibody binding site (PG-C3, SEQ ID NO: 3, Olsson et al., Eur J Biochem, L-2-amino-5,5-azi-hexanoic acid (pM), which is a Met mimic that induces covalent bond formation by 330-370 nm ultraviolet irradiation , A vector containing one or two protein G motifs was prepared in a pET-28at vector (Korean patent application 10-2013-0061895) tagged with 6x histidine (6xH) (see FIGS. 1 and 2 ).

또한, 본 발명자들은 Met 잔기가 도입된 PG-C3 변이체를 코딩하는 유전자를 제조하기 위하여, 2개 PG-C3 모티프가 포함되고 모티프 N-말단으로부터 32 번째 위치의 글루타민(Gln32)이 Met으로 치환된 pET-2xPG1m, 2개 PG-C3 모티프가 포함되고 40 번째 위치의 아스파르트산(Asp40) 및 Gln32가 Met으로 치환된 pET-2xPG2m, 2개 PG-C3 모티프가 포함되고 37 번째 위치의 아스파라긴(Asn37)이 아르기닌(Arg)으로 치환되고 Asp40 및 Gln32가 Met으로 치환된 pET-2xPG3m, 및 2개 PG-C3 모티프가 포함되고 Asn37이 Arg으로 치환되고 35 번째 위치의 아스파라긴(Asn35), Asp40 및 Gln32가 Met으로 치환된 pET-2xPG4m 플라스미드와 1개 PG-C3 모티프가 포함되고 모티프 N-말단으로부터 Gln32가 Met로 치환된 pET-PG1m, 1개 PG-C3 모티프가 포함되고 Gln32 및 Asp40이 Met로 치환된 pET-PG2m, 1개 PG-C3 모티프가 포함되고 Asn37이 Arg으로 치환되고 Gln32 및 Asp40이 Met로 치환된 pET-PG3m, 및 1개 PG-C3 모티프가 포함되고 Asn37이 Arg으로 치환되고 Gln32, Asp40 및 Asn35가 Met로 치환된 pET-PG4m 플라스미드를 제조하였다(도 3 및 도 4 참조).Further, the present inventors have found that, in order to prepare a gene encoding a PG-C3 mutant into which a Met residue has been introduced, two PG-C3 motifs are included and glutamine (Gln32) at the 32nd position from the N-terminus of the motif is substituted with Met pET-2xPG1m, pET-2xPG2m with two PG-C3 motifs and aspartic acid (Asp40) at position 40 and pET-2xPG2m with Gln32 substituted with Met, asparagine at position 37 (Asn37) PET-2xPG3m in which Asp40 and Gln32 are substituted with Met, and two PG-C3 motifs, Asn37 is substituted with Arg, asparagine (Asn35) at position 35, Asp40 and Gln32 are substituted with Met And pET-PG1m in which Gln32 was substituted with Met from the N-terminus of the motif and pET-PG1m in which one PG-C3 motif was contained and Gln32 and Asp40 in Met were substituted with Met, and pET-2xPG4m plasmid -PG2m, one PG-C3 motif is included and Asn37 is replaced by Arg PET-PG3m in which Gln32 and Asp40 were substituted with Met and pET-PG4m plasmid in which Asn37 was substituted with Arg and Gln32, Asp40 and Asn35 were substituted with Met was prepared (Figs. 3 and 4) 4).

또한, 본 발명자들은 pM 표지 단백질 G 변이체의 발현을 위하여, 메티오닐 tRAN 합성효소 변이체(MRS5m, methionyl tRNA synthase; 대한민국 특허출원 10-2013-0061895) 유전자를 코딩하는 플라스미드와 상기 PG-C3 Met 변이체 유전자를 코딩하는 플라스미드를 동시에 Met 영양요구주(auxotroph) 대장균 (E. coli B834)에 형질전환시킨 다음, pM을 포함하는 최소 배지에서 단백질 G를 발현시켜 6xH 태그된 6H-2xPG1m, 6H-2xPG2m, 6H-2xPG3m1, 6H-2xPG3m2 및 6H-2xPG4m, 및 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2 및 6H-PG4m을 획득하였다. 상기 pM 표지 6H-PG 변이체가 MRS5m에 의해 발현이 증가함을 확인하였다(도 5 참조). The present inventors have also found that a plasmid encoding a methionyl tRAN synthase mutant (MRS5m, methionyl tRNA synthase; Korean Patent Application No. 10-2013-0061895) and a PG-C3 Met variant gene ( E. coli B834), and then expressing the protein G in a minimal medium containing pM to express 6H-tagged 6H-2xPG1m, 6H-2xPG2m, 6H 6H-PG3m1, 6H-PG3m2 and 6H-PG4m, 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2 and 6H-PG4m. The expression of the pM-labeled 6H-PG mutant was increased by MRS5m (see FIG. 5).

또한, 본 발명자들은 상기 발현된 단백질 G 변이체들은 6xH기가 결합되어 있으므로 Ni-NTA 아가로우즈 크로마토그라피로 부분정제하여 발현 여부를 확인한 결과, 단계 농도구배(step gradient)시 대부분의 6H-2xPG2m은 150 mM 이미다졸(imidazole)에서 용출됨을 확인하였으며, 따라서, 다른 변이체들도 같은 조건으로 부분 정제하였다. 상기 부분정제한 변이체들의 발현 양상을 SDS-PAGE로 확인한 결과, 단량체뿐만 아니라, 이량체, 삼량체 및 사량체 등의 올리고머를 형성함을 확인하였다(도 6 및 도 7 참조). 또한, 이량체를 적출하여 LC/MS/MS 질량분석한 결과, 이량체 위치의 밴드도 PG-C3 서열을 포함하는 유도체이며 pM 표지율이 50% 이상임을 확인하였다.The present inventors confirmed that the expressed protein G mutants were partially purified by Ni-NTA agarose chromatography because 6xH groups were bound thereto. As a result, most of the 6H-2xPG2m in the step gradient was 150 mM imidazole. Therefore, the other mutants were partially purified under the same conditions. As a result of confirming the expression pattern of the partially purified mutants by SDS-PAGE, oligomers such as dimers, trimers and tetramers were formed as well as monomers (see FIGS. 6 and 7). Further, the dimer was extracted and subjected to LC / MS / MS mass spectrometry. As a result, it was confirmed that the band at the position of the dimer was a derivative containing a PG-C3 sequence and the pM labeling rate was 50% or more.

또한, 본 발명자들은 상기 정제한 pM 표지 단백질 G 변이체와 인간 항체 IgG간의 공유결합을 확인하기 위하여, SDS-PAGE 분석 및 공유결합 형성능 분석을 수행한 결과, UV 조사시 pM 도입 단백질 G, 및 IgG 중쇄(heavy chain) 및 Fc 부위와 공유결합이 효과적으로 유도되고, 이때 Met으로 치환된 잔기 수가 많을수록 공유 결합 형성률도 함께 증가함을 확인하였다(도 8 내지 도 10 참조)In addition, the present inventors performed SDS-PAGE analysis and covalent binding ability analysis to confirm the covalent bond between the purified pM labeled protein G variant and human antibody IgG. As a result, it was found that pM-introduced protein G and IgG heavy chain the heavy chain and the Fc site were effectively induced, and the covalent bond formation rate was also increased as the number of the residues substituted with Met was increased (see FIGS. 8 to 10)

또한, 본 발명자들은 상기 정제한 pM 표지 단백질 G 변이체의 공유결합에 의한 혈액내 항체의 치환 억제능을 확인하기 위하여, UV 조사하여 바이오틴화된 IgG(bIgG) 중쇄(bH)와 공유결합시킨 6H-PG4m에 혈청을 처리한 후 SDS-PAGE, 코마시(Coomassie) 염색 및 웨스턴 블럿팅(western blotting)을 수행한 결과, 상기 결합체가 혈청 처리에 의하여 영향을 거의 받지 않음을 확인하였다(도 11a 및 도 11b 참조). In order to confirm the ability of the purified pM-labeled protein G variant to inhibit the substitution of the antibody by covalent bonding of the purified pM-labeled protein G variant, 6H-PG4m (bHg) conjugated with biotinylated IgG SDS-PAGE, Coomassie dyeing, and western blotting were performed. As a result, it was confirmed that the conjugate was hardly affected by the serum treatment (FIGS. 11A and 11B Reference).

따라서, 본 발명의 광활성 광메티오닌(phohmethionine, pM) 도입 단백질 G 변이체는 고배향성 뿐만 아니라 UV 조사에 의해 항체와 특이적으로 고효율 공유 결합을 형성하므로, 혈액 시료 분석용 항체칩, 고감도 바이오칩(biochip) 및 바이오센서(biosensor) 개발에 유용하게 사용될 수 있다.
Therefore, the phos- phorhimethionine (pM) introduced protein G variant of the present invention forms a high-efficiency covalent bond specifically to an antibody by not only high orientation but also UV irradiation, so that an antibody chip for blood sample analysis, a biochip with high sensitivity, And biosensors. ≪ Desc / Clms Page number 2 >

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열에서, N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)을 각각 메티오닌(Met)으로 치환시키고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환시키는 단계를 포함하는 단백질 G 변이체의 제조 방법을 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted with methionine (Met), and asparagine ) With arginine (Arg).

본 발명의 광활성 메티오닌 도입 단백질 G 변이체는 고배향성 뿐만 아니라 UV 조사에 의해 항체와 특이적으로 고효율 공유 결합을 형성하므로, 상기 단백질G 변이체의 제조 방법은 혈액 시료 분석용 항체칩, 고감도 바이오칩 및 바이오센서 개발에 유용하게 사용될 수 있다.
The photoactive methionine-introduced protein G mutant of the present invention forms a highly efficient covalent bond specifically to the antibody not only by high orientation but also by UV irradiation. Therefore, the method for producing the protein G mutant includes an antibody chip for blood sample analysis, a high- It can be useful for development.

또한, 본 발명은 In addition,

1) 광메티오닌 도입을 위한 메티오닐 tRNT 합성효소(methionyl tRNA synthase, MRS) 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터 및 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터를 각각 제조하는 단계;1) an expression vector containing a polynucleotide encoding a methionyl tRNA synthase (MRS) variant for introducing phot methionine and a first antibody binding site (PG-C1) of the protein G, a second antibody binding site (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position, and the 40th amino acid sequence selected from the group consisting of the Which comprises a polynucleotide encoding a protein G mutant in which the aspartic acid (Asp) at the position is substituted with methionine (Met) and the asparagine (Asn) at the 37th position is substituted with arginine (Arg) Respectively;

2) 상기 단계 1)의 발현 벡터를 동시에 숙주세포에 도입하여 형질전환체를 제조하는 단계; 및2) introducing the expression vector of step 1) simultaneously into a host cell to prepare a transformant; And

3) 상기 단계 2)의 형질전환체를 배양하여 pM이 표지된 단백질 G 변이체를 발현시키는 단계를 포함하는, pM 도입 단백질 G 변이체의 제조 방법을 제공한다.3) culturing the transformant of step 2) to express pM-labeled protein G mutant.

상기 단계 1)의 MRS 변이체는 선행특허(대한민국 특허출원 10-2013-0061895)에 기재된 MRS 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터인 것이 바람직하나, 이에 한정되지 않는다. The MRS variant of step 1) above is preferably an expression vector comprising a polynucleotide encoding the MRS variant described in the prior patent (Korean Patent Application No. 10-2013-0061895), but is not limited thereto.

상기 단계 1)의 벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오 파지 벡터 및 바이러스 벡터인 것이 바람직하고, 플라스미드 벡터를 사용하는 것이 보다 바람직하나, 이에 한정되지 않는다.Preferably, the vector of step 1) is a plasmid vector, a cosmid vector, a bacteriophage vector, and a viral vector, more preferably, but not limited to, a plasmid vector.

상기 단계 2)의 숙주세포는 대장균(E. coli), 원핵 생물, 효모 또는 진핵 세포인 것이 바람직하고, 대장균을 사용하는 것이 보다 바람직하나, 이에 한정되지 않는다.The host cell of step 2) is preferably E. coli , prokaryote, yeast or eukaryotic cell, more preferably E. coli , but is not limited thereto.

본 발명의 단백질 G 변이체를 암호화하는 폴리뉴클레오티드는 코돈의 축퇴성으로 인하여 또는 상기 항체를 발현시키고자 하는 생물에서 선호되는 코돈을 고려하여, 코딩영역으로부터 발현되는 항체의 아미노산 서열을 변화시키지 않는 범위 내에서 코딩영역에 다양한 변형이 이루어질 수 있고, 코딩영역을 제외한 부분에서도 유전자의 발현에 영향을 미치지 않는 범위 내에서 다양한 변형 또는 수식이 이루어질 수 있으며, 그러한 변형 유전자 역시 본 발명의 범위에 포함됨을 당업자는 잘 이해할 수 있을 것이다. 즉, 본 발명의 폴리뉴클레오티드는 이와 동등한 활성을 갖는 단백질을 코딩하는 한, 하나 이상의 핵산 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있으며, 이들 또한 본 발명의 범위에 포함된다. 이러한 폴리뉴클레오티드의 서열은 단쇄 또는 이중쇄일 수 있으며, DNA 분자 또는 RNA(mRNA)분자일 수 있다.The polynucleotide encoding the protein G mutant of the present invention can be obtained by codon degenerating or in consideration of the codon preference in the organism to which the antibody is to be expressed in a range that does not change the amino acid sequence of the antibody expressed from the coding region It will be understood by those skilled in the art that various modifications and changes may be made to the coding region within the scope of the invention without departing from the scope of the invention, It will be well understood. That is, as long as the polynucleotide of the present invention encodes a protein having equivalent activity, one or more nucleotide bases may be mutated by substitution, deletion, insertion, or a combination thereof, and these are also included in the scope of the present invention. The sequence of such polynucleotides may be short or double-stranded, and may be a DNA molecule or RNA (mRNA) molecule.

상기 발현 벡터의 제작 시에는, 상기 단백질 G 변이체를 생산하고자 하는 숙주세포의 종류에 따라 프로모터(promoter), 종결자(terminator), 인핸서(inhancer) 등과 같은 발현조절 서열, 막 표적화 또는 분비를 위한 서열 등을 적절히 선택하고 목적에 따라 다양하게 조합할 수 있다.In preparing the expression vector, an expression regulatory sequence such as a promoter, a terminator, an inhancer, and the like, a sequence for membrane targeting or secretion may be used depending on the type of the host cell for which the protein G variant is to be produced And the like can be appropriately selected and various combinations can be made according to the purpose.

본 발명의 발현벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오 파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 적합한 발현벡터는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 폴리아데닐화 시그널 및 인핸서 같은 발현 조절 엘리먼트 외에도 막 표적화 또는 분비를 위한 시그널 서열 또는 리더 서열을 포함하며 목적에 따라 다양하게 제조될 수 있다. 발현벡터의 프로모터는 구성적 또는 유도성일 수 있다. 상기 시그널 서열에는 숙주가 에쉐리키아속(Escherichia sp.)균인 경우에는 PhoA 시그널 서열, OmpA 시그널 서열 등이, 숙주가 바실러스속(Bacillus sp.)균인 경우에는 α-아밀라아제 시그널 서열, 서브틸리신 시그널 서열 등이, 숙주가 효모(yeast)인 경우에는 MFα 시그널 서열, SUC2 시그널 서열 등이, 숙주가 동물세포인 경우에는 인슐린 시그널 서열, α-인터페론 시그널 서열, 항체 분자 시그널 서열 등을 이용할 수 있으나, 이에 제한되지 않는다. 또한 발현벡터는 벡터를 함유하는 숙주 세포를 선택하기 위한 선택 마커를 포함할 수 있고, 복제 가능한 발현벡터인 경우 복제 기원을 포함한다.The expression vector of the present invention includes, but is not limited to, a plasmid vector, a cosmid vector, a bacteriophage vector, and a viral vector. Suitable expression vectors include signal sequences or leader sequences for membrane targeting or secretion in addition to expression control elements such as promoter, operator, initiation codon, termination codon, polyadenylation signal and enhancer, and can be prepared variously according to the purpose. The promoter of the expression vector may be constitutive or inducible. The signal sequence includes a PhoA signal sequence, an OmpA signal sequence and the like when the host is Escherichia sp., A? -Amylase signal sequence when the host is Bacillus sp., A subtilisin signal, An interferon signal sequence, an antibody molecule signal sequence, and the like can be used in the case where the host is an animal cell. However, in the case where the host is an animal cell, an MFI signal sequence, an alpha-interferon signal sequence, But is not limited thereto. The expression vector may also comprise a selection marker for selecting a host cell containing the vector and, if replicable expression vector, a replication origin.

본 발명에 따른 상기 발현벡터를 적절한 숙주 세포, 예를 들어, 대장균 또는 효모 세포 등에 형질전환시킨 후, 형질전환된 숙주세포를 배양함으로써 본 발명에 따른 MRS 변이체를 대량 생산할 수 있다. 상기 숙주세포는 대장균(E. coli) 또는 바실러스 서브틸러스(Bacillus subtilis)와 같은 원핵 생물일 수 있다. 또한, 사카로마이세스 세르비시아(Saccharomyces cerevisiae)와 같은 효모, 곤충 세포, 식물 세포, 동물 세포로부터 유래한 진핵 세포일 수 있다. 더욱 바람직하게는, 상기 동물 세포는 자가 또는 동종 이계 동물 세포일 수 있다. 숙주세포의 종류에 따른 적절한 배양 방법 및 배지 조건 등은 당해 분야의 통상의 기술자에게 알려진 공지 기술로부터 당업자가 용이하게 선택할 수 있다. 상기 숙주세포로의 발현벡터 도입 방법은 당업자에게 공지된 어느 방법을 사용해도 무방하다.
The MRS variant according to the present invention can be mass produced by transforming the expression vector according to the present invention into an appropriate host cell such as Escherichia coli or yeast cells and then culturing the transformed host cell. The host cell may be a prokaryote such as E. coli or Bacillus subtilis . It may also be eukaryotic cells derived from yeast, insect cells, plant cells, animal cells such as Saccharomyces cerevisiae . More preferably, the animal cells may be autologous or allogeneic animal cells. Appropriate culture methods and medium conditions depending on the type of host cell can be easily selected by those skilled in the art from known techniques known to those skilled in the art. Any method known to those skilled in the art may be used for introducing the expression vector into the host cell.

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체, 및 항체 또는 이의 단편이 결합된 융합 단백질을 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted by methionine (Met) and asparagine A protein G mutant consisting of an amino acid sequence substituted with arginine (Arg), and a fusion protein in which an antibody or fragment thereof is bound.

상기 단편은 항체의 Fc 부위인 것이 바람직하나, 이에 한정되지 않는다.The fragment is preferably but not limited to the Fc region of the antibody.

본 발명의 광활성 메티오닌 도입 단백질 G 변이체는 고배향성 뿐만 아니라 UV 조사에 의해 항체와 특이적으로 고효율 공유 결합을 형성하므로, 상기 단백질 G 변이체 및 항체 또는 이의 단편이 결합된 융합 단백질은 고감도 바이오칩 및 바이오센서 개발에 유용하게 사용될 수 있다.
Since the photoactivatable methionine-introduced protein G mutant of the present invention forms a high-efficiency covalent bond specifically to the antibody not only by high orientation but also by UV irradiation, the fusion protein in which the protein G mutant and the antibody or fragment thereof are bound is highly sensitive biochip and biosensor It can be useful for development.

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 바이오칩을 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted by methionine (Met) and asparagine An antibody bound to a protein G mutant consisting of an amino acid sequence substituted with arginine (Arg), or a fragment thereof.

또한, 본 발명은 상기 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 바이오 센서를 제공한다.The present invention also provides a biosensor comprising an antibody or fragment thereof bound to the protein G mutant.

본 발명의 광활성 메티오닌 도입 단백질 G 변이체는 고배향성 뿐만 아니라 UV 조사에 의해 항체와 특이적으로 고효율 공유 결합을 형성하므로, 고감도 바이오칩 및 바이오센서 개발에 유용하게 사용될 수 있다.
The photoactive methionine-introduced protein G mutant of the present invention forms a highly efficient covalent bond specifically to an antibody by UV irradiation as well as high orientation, and thus can be usefully used for the development of high sensitivity biochips and biosensors.

또한, 본 발명은 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 항체 표지 정맥주사용 나노입자 전달체를 제공한다.The present invention also relates to a method for detecting a protein having an amino acid sequence selected from the group consisting of a first antibody binding site (PG-C1), a second antibody binding site (PG-C2) and a third antibody binding site (PG-C3) Glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted by methionine (Met) and asparagine The present invention provides an antibody-labeled intravenous nanoparticle carrier comprising an antibody bound to a protein G mutant consisting of an amino acid sequence substituted with arginine (Arg) or a fragment thereof.

본 발명의 광활성 메티오닌 도입 단백질 G 변이체는 고배향성 뿐만 아니라 UV 조사에 의해 항체와 특이적으로 고효율 공유 결합을 형성하므로, 항체를 나노입자에 고정시켜 표적지향적 주사용 나노입자 운반체 제조에 유용하게 사용될 수 있다.
The photoactive methionine-introduced protein G mutant of the present invention forms a highly efficient covalent bond specifically to an antibody not only by high orientation but also by UV irradiation, so that the antibody can be immobilized on the nanoparticles and thus can be useful for manufacturing a target-oriented nanoparticle carrier have.

이하, 본 발명을 실시예에 의해 상세히 설명한다.Hereinafter, the present invention will be described in detail with reference to examples.

단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 의해 한정되는 것은 아니다.
However, the following examples are illustrative of the present invention, and the contents of the present invention are not limited by the following examples.

<< 실시예Example 1> 메티오닌( 1 > methionine ( MethionineMethionine ) 도입을 위한 단백질 G() Protein for introduction G ( proteinprotein G) 벡터 제조 G) Vector manufacture

메티오닌(methionine, Met) 도입을 위한 단백질 G(protein G) 벡터를 획득하기 위하여, NdeI과 BamHI 사이에 3개 메티오닌 잔기가 제거된 pET-28at 벡터(대한민국 특허출원 10-2013-0061895)에 1개 또는 2개 단백질 G 모티프(motif)를 포함한 벡터를 제조하였다.In order to obtain a protein G (protein G) vector for introduction of methionine (Met), one pET-28at vector (Korean patent application 10-2013-0061895) in which three methionine residues were removed between NdeI and BamHI Or a vector containing two protein G motifs was prepared.

구체적으로, pET-2XFcBP(Jung et al., Anal Chem, 81, 936-42, 2009)를 주형으로 하기 [표 1]의 프라이머를 이용하여 중합효소연쇄반응(polymerase chain reaction: PCR)을 수행하여 1개 또는 2개 단백질 G의 세 번째 항체결합 부위(immunogloblin G-binding region C3: PG-C3, Olsson et al., Eur J Biochem, 168, 319-24, 1987, 서열번호 3)가 들어 있는 PCR 산물을 얻었다. 그 다음, 상기 PCR 산물을 제한효소 BamHI 및 XhoI으로 절단하여 pET-28at 벡터(도 1)의 BamHI/XhoI 부위(site)로 클로닝(cloning)하고, 상기 1개 또는 2개 PG-C3을 포함한 플라스미드를 각각 pET-PG 및 pET-2xPG라 명명하였다(도 2).Specifically, polymerase chain reaction (PCR) was performed using the primers shown in Table 1 with pET-2XFcBP (Jung et al., Anal Chem, 81, 936-42, 2009) (PCR) containing a third antibody binding site (immunoglobulin G-binding region C3: PG-C3, Olsson et al., Eur J Biochem, 168, 319-24, 1987, SEQ ID NO: 3) The product was obtained. Then, the PCR product was digested with restriction enzymes BamHI and XhoI and cloned into the BamHI / XhoI site of the pET-28at vector (FIG. 1), and a plasmid containing one or two PG- Were named pET-PG and pET-2xPG, respectively (Fig. 2).

프라이머primer 서열order PG-Bam-F 정방향 프라이머PG-Bam-F forward primer 5'-ATAGGATCCTGCTGCGGCGGGACAACTTACAAACTTGTTATT-3'(서열번호 4)5'-ATAGGATCCTGCTGCGGCGGGACAACTTACAAACTTGTTATT-3 '(SEQ ID NO: 4) PG-Xho-R 역방향 프라이머PG-Xho-R reverse primer 5'-GCGCCTCGAGTTATTCAGTTACCGTAAAGGTC-3'(서열번호 5)5'-GCGCCTCGAGTTATTCAGTTACCGTAAAGGTC-3 '(SEQ ID NO: 5)

<< 실시예Example 2> 메티오닌 치환 단백질 G 플라스미드 제조 2> Preparation of methionine-substituted protein G plasmid

단백질 G와 항체 결합 구조(Sauer-Eriksson et al., Structure, 3, 265-78, 1995)를 바탕으로 32, 35, 40 위치에 도입하기 위하여, 상기 <실시예 1>에 기재된 방법으로 획득한 2개 PG-C3 모티프가 포함된 pET-2xPG 플라스미 및 1개 PG-C3 모티프가 포함된 pET-PG 플라스미드 내 PG-C3를 메티오닌(Met)으로 치환하여 변이 단백질 G 플라스미드를 제조하였다.Was obtained by the method described in Example 1 above for introduction at positions 32, 35 and 40 based on protein G and antibody binding structure (Sauer-Eriksson et al., Structure, 3, 265-78, A mutant protein G plasmid was prepared by substituting methionine (Met) for PG-C3 in a pET-PG plasmid containing two pET-2xPG plasmids containing one PG-C3 motif and one PG-C3 motif.

구체적으로, 메티오닌을 도입을 위하여 치환시킨 아미노산 잔기 번호들은 PG-C3 모티프를 기준으로 하였으며, Met으로 치환시키는 잔기들은 단백질 G와 항체 간의 3차 결합 구조를 바탕으로 선정하였다. 그 다음, 변이체 제조를 위하여 도 3의 모식도와 같이 하기 [표 2]의 프라이머 세트를 이용하여 PCR을 수행하였다. 먼저, 32 번째 글루타민(Glutamine, Gln32)를 Met으로 치환하기 위하여 상기 <실시예 1>에 기재된 방법으로 획득한 pET-2xPG를 주형으로 하기 [표 2]의 프라이머 세트 중 ET-Xba-F/PG-Q32M-R 및 PG-Q32M-F/Ins-Cla-R를 사용하여 PCR을 수행하고 각 PCR 산물을 획득하였다. 상기 획득한 PCR 산물을 혼합하고, 이를 주형으로 하기 [표 2]의 프라이머 세트 중 ET-Xba-F/Ins-Cla-R를 사용하여 PCR DNA를 획득한 후, BamHI 및 ClaI으로 절단 및 정제하여 insert 1 DNA를 획득하였다. 그 다음, pET-2xPG를 주형으로 하기 [표 2]의 프라이머 세트 중 Ins-Cla-F/PG-Q32M-R 및 PG-Q32M-F/ET-R를 사용하여 상기와 같이 PCR을 수행하여 각 PCR 산물을 획득하였다. 상기 획득한 PCR 산믈을 혼합하고, 이를 주형으로 하기 [표 2]의 프라이머 세트 중 Ins-ClaI-F/ET-R를 사용하여 PCR DNA를 획득한 후, ClaI 및 XhoI으로 절단 및 정제하여 insert 2 DNA를 얻었다. 그 후, 상기 insert 1 DNA 및 inser 2 DNA를 혼합하여 pET-28at의 BamHI/XhoI 부위 내로 클로닝하여 pET-2xPG1m 플라스미드를 획득하였다. 그 다음, 상기 pET-2xPG1m 플라스미드를 주형으로 상기와 같은 방법으로 PCR을 수행하여 PG-C3 모티프의 40 번째 아스파르트산(aspartic acid, Asp40) 및 Gln32가 Met으로 치환된 pET-2xPG2m을 제조하였다. 또한, 상기 pET-2xPG2m 플라스미드를 주형으로 상기와 같은 방법으로 PCR을 수행하여 37 번 아스파라긴(asparagine, Asn37)을 아르기닌(arginine, Arg)으로 치환되고, Asp40 및 Gln32가 Met으로 치환된 pET-2xPG3m을 제조하였다. 그 다음, 상기 pET-2xPG3m 플라스미드를 주형으로 상기와 같은 방법으로 PCR을 수행하여 35 번 아스파라긴(Asn35), Asp40 및 Gln32가 Met으로 치환되고, Asn37이 Arg으로 치환된 pET-2xPG4m을 제조하였다(도 3).Specifically, the amino acid residue numbers substituted for introduction of methionine were based on the PG-C3 motif, and the residues to be substituted with Met were selected based on the tertiary bonding structure between the protein G and the antibody. Then, for the production of mutants, PCR was carried out using the primer set of [Table 2] as shown in the schematic diagram of FIG. First, the pET-2xPG obtained by the method described in Example 1 above was used as a template to replace the 32th glutamine (Glutamine, Gln32) with Met. ET-Xba-F / PG PCR was performed using -Q32M-R and PG-Q32M-F / Ins-Cla-R and each PCR product was obtained. The obtained PCR products were mixed and PCR DNA was obtained using the ET-Xba-F / Ins-Cla-R among the primer sets of Table 2 as a template, followed by cleavage and purification with BamHI and ClaI insert 1 DNA was obtained. Then PCR was carried out as described above using Ins-Cla-F / PG-Q32M-R and PG-Q32M-F / ET-R in the primer set of [Table 2] using pET-2xPG as a template. PCR products were obtained. The PCR products thus obtained were mixed and PCR DNA was obtained using Ins-ClaI-F / ET-R from the primer set of Table 2 as a template, followed by cutting and purification with ClaI and XhoI to obtain insert 2 DNA was obtained. The insert 1 DNA and inser 2 DNA were then mixed and cloned into the BamHI / XhoI site of pET-28at to obtain the pET-2xPG1m plasmid. Then, PCR was performed using the above pET-2xPG1m plasmid as a template to produce pET-2xPG2m in which the 40th aspartic acid (Asp40) and Gln32 of the PG-C3 motif were substituted with Met. PCR was carried out using the pET-2xPG2m plasmid as the template in the same manner as described above. PET-2xPG3m in which asparagine (Asn37) was substituted with arginine (Arg) and Asp40 and Gln32 were substituted with Met . Then, pET-2xPG4m in which 35 asparagine (Asn35), Asp40 and Gln32 were substituted with Met and Asn37 was substituted with Arg was prepared by PCR using the pET-2xPG3m plasmid as a template in the same manner as described above 3).

프라이머 세트Primer set 서열(5'→3')The sequence (5 '- &gt; 3') PG-Bam-FPG-Bam-F ATAGGATCC TGCTGCGGCGGGACAACTTACAAACTTGTTATT(서열번호 6)ATA GGATCC TGCTGCGGCGGG ACAACTTACAAACTTGTTATT (SEQ ID NO: 6) PG-XhoI-RPG-XhoI-R GCGCCTCGAG TTATTCAGTTACCGTAAAGGTC(서열번호 7)GCGC CTCGAG TTA TTCAGTTACCGTAAAGGTC (SEQ ID NO: 7) PG-Q32M-FPG-Q32M-F AAAGCCTTCAAAATGTACGCTAACGAGAACGG(서열번호 8)AAAGCCTTCAAA ATG TACGCTAACGAGAACGG (SEQ ID NO: 8) PG-Q32M-RPG-Q32M-R GTTAGCGTACATTTTGAAGGCTTTTTCTGCAGTTTCTGC(서열번호 9)GTTAGCGTA CAT TTTGAAGGCTTTTTCTGCAGTTTCTGC (SEQ ID NO: 9) PG-D40M-FPG-D40M-F GACAACGGTGTTATGGGTGTTTGGACTTATGATG(서열번호 10)GACAACGGTGTT ATG GGTGTTTGGACTTATGATG (SEQ ID NO: 10) PG-D40M-RPG-D40M-R CCAAACACCCATAACACCGTTGTCGTTAGCG(서열번호 11)CCAAACACC CAT AACACCGTTGTCGTTAGCG (SEQ ID NO: 11) PG-N37R-FPG-N37R-F GCTAACGACCGCGGTGTTATGGGTGTTTGG(서열번호 12)GCTAACGAC CGC GGTGTTATGGGTGTTTGG (SEQ ID NO: 12) PG-N37-RPG-N37-R CATAACACCGCGGTCGTTAGCGTACATTTT(서열번호 13)CATAACACC GCG GTCGTTAGCGTACATTTT (SEQ ID NO: 13) PG-35,37-FPG-35,37-F GCTATGGACCGCGGTGTTATGGGTGTTTGG(서열번호 14)GCT ATG GAC CGC GGTGTTATGGGTGTTTGG (SEQ ID NO: 14) PG-35,37-RPG-35,37-R CATAACACCGCGGTCCATAGCGTACATTTTGAAGGC(서열번호 15)CATAACACC GCG GTC CAT AGCGTACATTTTGAAGGC (SEQ ID NO: 15) Ins-Cla-FIns-Cla-F GAAGTGATCGATGCGTCTGAATTA(서열번호 16)GAAGTG ATCGAT GCGTCTGAATTA (SEQ ID NO: 16) Ins-Cla-RIns-Cla-R TAATTCAGACGCATCGATCACTTC(서열번호 17)TAATTCAGACGC ATCGAT CACTTC (SEQ ID NO: 17) ET-Xba-FET-Xba-F TTCCCCTCTAGAAATAATTTTGTTTAAC(서열번호 18)TTCCCC TCTAGA AATAATTTTGTTTAAC (SEQ ID NO: 18) ET-RET-R TTATGCTAGTTATTGCTCAGCGGTGGCAG(서열번호 19)TTATGCTAGTTATTGCTCAGCGGTGGCAG (SEQ ID NO: 19)

또한, Protein G 모티프가 1개 있는 변이체를 제조하기 위하여, 도 4의 모식도와 같이 상기에 기재된 방법으로 획득한 pET-2xPG1m, pET-2xPG2m, pET-2xPG3m 및 pET-2xPG4m 변이 플라스미드를 주형으로 상기 [표 2]의 프라이머 세트 중 ET-Xba-F/PG-XhoI-R로 PCR을 수행하여 1 개 PG 모티프가 들어 있는 PCR DNA를 획득하였다. 상기 획득한 PCR DNA를 정제 후 BamHI 및 XhoI을 이용하여 절단하고 pET-28at의 BamHI/XhoI 부위로 클론닝하였다. 각각의 PG 변이 플라스미드들은 pET-PG1m, pET-PG2m, pET-PG3m 및 pET-PG4m이라 명명하였다(도 4).
In order to prepare a mutant having one Protein G motif, pET-2xPG1m, pET-2xPG3m, and pET-2xPG4m mutant plasmids obtained by the above-described method as shown in the schematic diagram of Fig. PCR was performed with ET-Xba-F / PG-XhoI-R in the primer set of Table 2 to obtain PCR DNA containing one PG motif. The obtained PCR DNA was purified and then cleaved with BamHI and XhoI and cloned into the BamHI / XhoI site of pET-28at. Each of the PG mutant plasmids was named pET-PG1m, pET-PG2m, pET-PG3m, and pET-PG4m (FIG.

<< 실시예Example 3>  3> MRSMRS 변이체에In variants 의한  by 광메티오닌Light methionine (( photomethioninephotomethionine ) 표지 단백질 G 발현벡터 및 형질전환체의 제작) Marker Protein G Expression Vector and Transformant Preparation

광메티오닌(photomethionine, pM) 표지 단백질 G 변이체 발현을 위하여, 본 발명자들이 발명한 메티오닐 tRNA 합성효소(methionyl tRNA synthase) 변이체인 MRS5m을 코딩하는 pBAD-MRS5m 플라스미드(대한민국 특허출원 10-2013-0061895)와 상기 <실시예 2>에 기재된 방법으로 획득한 각각의 PG-C3 변이체들을 코딩하는 플라스미드를 Met 영양요구주(auxotroph) 대장균 E. coli B834로 형질전환하였다. 그 다음, 상기 MRS5m 및 PG-C3 변이체 플라스미드들을 모두 포함하는 형질전환 E.coli 콜로니들을 100 ㎍/㎖ 엠피실린(ampicillin) 및 50 ㎍/㎖ 카나마이신(kanamycin)이 함유된 LB 고체배지에서 선별하고, 이를 LB 액체배지에 현탁하여 24 시간 배양하였다. 그 다음, 상기 양액을 1/10 내지 1/20 부피로 희석하여 엠피실린 및 카나마이신이 함유된 LB 액체배지에서 1 내지 2 시간 배양한 다음, 0.02% L-아라비노스(L-arabinose)를 2 시간 동안 37℃에서 처리하여 MRS5m을 발현시켰다. 그 다음, 상기 MRS5m 발현 대장균을 M9B 용액(48 mM Na2HPO4, 22 mM KH2PO4, 9 mM NaCl 및 19 mM NH4Cl)로 2번 세척하고, M9BV+1/2 CMS-MET 용액[M9B+0.4% 글루코오스(glucose), 2 mM MgSO4, 0.1 mM CaCl2, 0.05 mM MnCl2, 0.1 M FeCl3, 1 mg/㎖ 티아민(thiamine), 0.2 mg/㎖ 니코틴아마이드(nicotinamide), 0.2 mg/㎖ 엽산(folic acid), 0.2 mg/㎖ 염화콜린(choline chloride) 및 0.02 mg/㎖ 리보플라빈(riboflavine)+375 μg/㎖ CSM-MET(methionine을 제외한 19개 아미노산 혼합물)]에 1/2 내지 1/3로 희석시켰다. 그 다음, 상기 대장균을 37℃에서 1 내지 2시간 또는 18 ℃에서 3시간 더 배양하여 Met을 결핍시킨 다음, 375 ㎍/㎖ CSM-MET를 50 ㎍/㎖ 메티오닌 또는 50-100 ㎍/㎖ pM이 되게 가하고, 1 mM IPTG(Isopropyl β-D-1-thiogalactopyranoside)로 18 ℃에서 16 내지 20 시간 단백질 발현을 유도하였다. 각 발현된 단백질들은 2개의 PG-C3 모티프를 갖고 있는 경우에는 6H-2xPG1m, 6H-2xPG2m, 6H-2xPG3m1, 6H-2xPG3m2 및 6H-2xPG4m으로, 1개의 PG-C3 모티프를 갖고 있는 경우에는 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2 및 6H-PG4m으로 명명하였다.For the expression of the photomethionine (pM) marker protein G variant, the pBAD-MRS5m plasmid (Korean Patent Application No. 10-2013-0061895) encoding MRS5m, a methionyl tRNA synthase mutant invented by the present inventors, And the plasmids encoding each of the PG-C3 variants obtained by the method described in Example 2 above were transformed with the Met auxotroph E. coli B834. Subsequently, the transformed E. coli colonies including both the MRS5m and PG-C3 mutant plasmids were selected on LB solid medium containing 100 / / ml ampicillin and 50 / / ml kanamycin, This was suspended in LB liquid medium and cultured for 24 hours. Then, the nutrient solution was diluted to 1/10 to 1/20 volume, and cultured in LB liquid medium containing ampicillin and kanamycin for 1 to 2 hours. Then, 0.02% L-arabinose was added for 2 hours Lt; RTI ID = 0.0 &gt; 37 C &lt; / RTI &gt; Then, the MRS5m expressing E. coli M9B solution (48 mM Na 2 HPO 4, 22 mM KH 2 PO 4, 9 mM NaCl and 19 mM NH 4 Cl) to the washing and, M9BV + 1/2 CMS- MET solution 2 [M9B + 0.4% glucose (glucose), 2 mM MgSO 4 , 0.1 mM CaCl 2, 0.05 mM MnCl 2, 0.1 M FeCl 3, 1 mg / ㎖ thiamin (thiamine), 0.2 mg / ㎖ nicotinamide (nicotinamide), 0.2 mg / ml folic acid, 0.2 mg / ml choline chloride and 0.02 mg / ml riboflavine +375 μg / ml CSM-MET (a mixture of 19 amino acids except methionine) To 1/3. The E. coli was further cultured at 37 ° C for 1 to 2 hours or at 18 ° C for 3 hours to deplete Met and then 375 μg / ml CSM-MET was added to 50 μg / ml methionine or 50-100 μg / ml pM And induced protein expression at 18 ° C for 16-20 hours with 1 mM IPTG (Isopropyl β-D-1-thiogalactopyranoside). 6H-2xPG3m, 6H-2xPG3m1, 6H-2xPG3m2, and 6H-2xPG4m when each PG-C3 motif has two PG-C3 motifs and 6H- PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2 and 6H-PG4m.

그 결과, 도 5에 나타낸 바와 같이, MRS5m에 의해 광메티오닌(pM) 표지 6H-2xPG2m의 발현의 증가하고, 정상 MRS(MRSwt)에 의해서는 pM 단독 처리시 단백질 발현이 매우 낮지만, MRS5m에 의해서는 pM 단독 처리시에도 Met 처리시와 유사하게 단백질의 발현이 현저하게 증가됨을 확인하였다(도 5). 또한 pM 처리농도를 100 ㎍/㎖로 두 배 늘렸을 때, 유의적으로 단백질 발현량도 같이 증가하며, 다른 Met 변이체들도 6H-2xPG2m과 유사하게 MRS5m에 의한 pM 표지 단백질의 발현이 증가되는 양상을 나타냄을 확인하였다.
As a result, as shown in Fig. 5, the expression of the light methionine (pM) label 6H-2xPG2m was increased by the MRS5m, and the expression of the protein was very low in the pM alone treatment by the normal MRS (MRSwt) Showed that protein expression was significantly increased similarly to the Met treatment even when pM alone treatment (Fig. 5). In addition, when the concentration of pM treatment was doubled to 100 ㎍ / ㎖, the amount of protein expression was also significantly increased, and the expression of pM-labeled protein by MRS5m was increased similarly to 6H-2xPG2m in other Met variants Respectively.

<< 실시예Example 4> 단백질 G  4> Protein G 변이체Mutant 부분 분리 정제 및 질량분석  Partial separation purification and mass spectrometry

상기 <실시예 3>에 기재된 방법으로 발현된 단백질 G 변이체들은 모두 용해된 형태로 발현되었으며, 이들 단백질의 아미노말단에 6xH기가 결합되 있어 Ni-NTA-agarose(Qiagen, 미국) 크로마토그라피로 부분 정제하였다.The protein G variants expressed by the method described in the above Example 3 were all expressed in a dissolved form and the 6xH group was bound to the amino terminal of these proteins and the partial purification with Ni-NTA-agarose (Qiagen, USA) Respectively.

구체적으로, 상기 <실시예 3>에 기재된 방법으로 6H-2xPG1m, 6H-2xPG2m, 6H-2xPG3m1, 6H-2xPG3m2 및 6H-2xPG4m, 및 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2 및 6H-PG4m가 발현된 형질전환 E. coli를 원침시킨 다음, 100 ㎖ 배양액당 세포파괴용 완충액(20 mM Tris-HCl, 500 mM NaCL, 2 mM 2-머갑토에탄올(mercaptoethanol), 1 mM PMSF 및 5% 글리세롤(glycerol)) 1 내지 2 ㎖에 분산시키고 초음파 파쇄를 하였다. 상기 파쇄액은 15,000 rpm에서 10 내지 20 분간 원침시킨 다음, 상층액을 모아 Ni-NTA-agarose 크로마토그라피로 부분 분리정제하였다. 상기 정제한 상층액은 SDS-PAGE를 수행하여 6H-2xPG1m, 6H-2xPG2m, 6H-2xPG3m1, 6H-2xPG3m2 및 6H-2xPG4m, 및 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2 및 6H-PG4m 단백질 G 변이체의 발현 여부를 확인하였다.6H-2xPG3m, 6H-2xPG3m1, 6H-2xPG3m2 and 6H-2xPG4m, and 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H-PG3m2, and 6H-2xPG1m were synthesized by the method described in Example 3, 6H-PG4m-expressing transformed E. coli was inoculated and the cell destruction buffer (20 mM Tris-HCl, 500 mM NaCl, 2 mM 2-mercaptoethanol, 1 mM PMSF, 5% glycerol) and subjected to ultrasonic disruption. The above-mentioned disruption solution was decanted at 15,000 rpm for 10 to 20 minutes, and the supernatant was collected and partially purified by Ni-NTA-agarose chromatography. The purified supernatant was subjected to SDS-PAGE to obtain 6H-2xPG1m, 6H-2xPG2m, 6H-2xPG3m1, 6H-2xPG3m2 and 6H-2xPG4m and 6H-PG1m, 6H-PG2m, 6H-PG3m1, 6H- -PG4m protein G < / RTI >

그 결과, 도 6 및 도 7에 나타낸 바와 같이, 단계 농도구배(step gradient)시 대부분의 6H-2xPG2m는 150 mM 이미다졸(imidazole)에서 용출됨을 확인하였으며, 따라서, 다른 변이체들도 같은 조건으로 부분 정제하였다. 흥미롭게도 정제된 Met 또는 pM 표지 6H-2xPG2m은 단량체(monomer) 뿐만 아니라 이보다 양은 적지만 이량체(dimer), 삼량체(trimer) 및 사량체(tetramer) 등 다량체(oligomer)를 형성함을 확인하였다(도 6). 상기 결과는 본래 아미노산에 비해 소수성인 Met 도입으로 SDS 존재하에서, 그리고 가열하는 조건에 따라 안정한 형태인 올리고머 형성이 유도되는 것으로 여겨진다. 그러나, PG-C3의 이량체 및 다량체 형성은 궁극적으로 항체가 고배향성을 갖도록 포획하는 데에는 악영향을 줄 수 있다. Asn37은 항체의 Fab의 CH1 부위에 결합에 있어서 중요하나, Fc 부위 결합에는 영향을 주지 않으므로, 이를 타이로신(tyrosin, Tyr)으로 치환하여 Fab 결합을 최소화할 수 있다고 보고되고 있다(Jung et al., Anal Chem, 81, 936-42, 2009). 한편, 6xH-2xPG2m의 Asn37을 Tyr으로 치환하여도 다량체 형성을 감소시키지는 못하였으나, Asn37을 Arg으로 치환한 6H-2xPG3m의 경우 올리고머 형성이 감소됨을 확인하였다(도 7).As a result, as shown in FIG. 6 and FIG. 7, it was confirmed that most of the 6H-2xPG2m eluted from the 150 mM imidazole at the step gradient, and therefore, Lt; / RTI &gt; Interestingly, the purified Met or pM-labeled 6H-2xPG2m was confirmed to form oligomers such as dimers, trimers and tetramers, as well as monomers, (Fig. 6). The results are believed to lead to the formation of oligomers that are stable in the presence of SDS with the introduction of the hydrophobic MetS compared to amino acids and under heating conditions. However, the formation of dimers and oligomers of PG-C3 may adversely affect the capture of antibodies with high orientation. Asn37 is important for binding to the CH1 site of the Fab of an antibody but does not affect Fc site binding and it has been reported that Fab binding can be minimized by substituting it with tyrosine (Tyr) (Jung et al. Anal Chem, 81, 936-42, 2009). On the other hand, substitution of Asn37 of 6xH-2xPG2m with Tyr did not reduce the formation of oligomers, but it was confirmed that oligomer formation was reduced in 6H-2xPG3m in which Asn37 was substituted with Arg (Fig. 7).

또한, 상기 SDS 상의 단량체 및 이량체 부분을 적출하여, 타이로신 효소분해 후 추출한 절단 펩타이드들에 대해 LC/MS/MS mass 분석을 수행한 결과, 모두 PG-C3 서열을 함유하는 것을 확인함으로써, 이량체 위치의 밴드도 단백질 G 유도체임을 확인하였다. 또한, 질량 분석에 의한 pM 표지율은 18℃에서 Met 을 결핍시키는 경우에 50-70%로 가장 높게 나타남을 확인하였다.
Further, LC / MS / MS mass analysis of the digested peptides extracted after the digestion of the monomer and dimer portions on the above SDS and confirming that all of the digested peptides contained the PG-C3 sequence, Position was also found to be a protein G derivative. In addition, the pM labeling rate by mass analysis was found to be the highest at 50-70% when Met was deficient at 18 ° C.

<< 실시예Example 5>  5> 단밸질Protein G  G 변이체에In variants 의한 인간  Human by 항체(immunogloblin G, IgG)간의Between the antibodies (immunoglobulin G, IgG) 공유 결합 확인 Verify covalent association

pM 표지 단백질 G 변이체와 인간 항체간의 공유결합을 확인하기 위하여, SDS-PAGE 분석 및 공유결합 형성능 분석을 수행하였다.SDS-PAGE analysis and covalent binding ability analysis were performed to confirm the covalent bond between the pM labeled protein G mutant and the human antibody.

구체적으로, 상기 <실시예 4>에 기재된 방법으로 정제한 6H-2xPG4m 단백질 G 변이체 및 항-EGFR 인간단일클론항체(Erbitux, Merck, USA) 또는 Fc 분획(abcam, 미국)을 혼합하여 아이스에서 365 nm UV를 30 분간 조사한 후, SDS-PAGE를 수행하여 공유결합 유무를 관찰하였다(도 8).Specifically, a 6H-2xPG4m protein G mutant purified by the method described in Example 4 and an anti-EGFR human monoclonal antibody (Erbitux, Merck, USA) or an Fc fraction (abcam, USA) nm UV for 30 minutes, and then subjected to SDS-PAGE to observe covalent binding (FIG. 8).

또한, 상기 <실시예 4>에 기재된 방법으로 정제한 6H-PG3m 또는 6H-PG4m 단백질 G 변이체, 및 항-EGFR 인간단일클론항체 또는 Fc 분획을 혼합하여 아이스에서 365 nm UV를 30 분간 조사한 후, SDS-PAGE를 수행하여 공유결합 유무를 관찰하고, Image J 프로그램으로 밴드들의 밀도를 측정하였으며, IgG 중쇄 공유결합률 및 Fc 공유결합률을 계산하였다(도 9):Further, the 6H-PG3m or 6H-PG4m protein G mutant purified by the method described in Example 4 above and the anti-EGFR human monoclonal antibody or Fc fraction were mixed and irradiated with 365 nm UV in ice for 30 minutes, SDS-PAGE was performed to observe the presence of covalent bonds, and the density of bands was measured by Image J program, and the IgG heavy chain covalent bond and Fc covalent bond were calculated (FIG. 9)

IgG 중쇄 공유결합률(%)=[H-PG 밀도/(H-PG 밀도+H 밀도)×100]; 및IgG heavy chain covalent bonding ratio (%) = [H-PG density / (H-PG density + H density) x 100]; And

Fc 공유결합률=[Fc-PG 밀도/(Fc-PG 밀도+Fc 밀도)×100].Fc covalent bonding ratio = [Fc-PG density / (Fc-PG density + Fc density) x 100].

또한, 2-머캅토에탄올(2-mercaptoethanol)의 존재 유무에 따라 상기와 같이 6H-PG3m 또는 6H-PG4m 단백질 G 변이체, 및 Fc 분획 간의 공유결합 유무를 관찰하고, 공유결합률을 계산하였다(도 10).In addition, the presence or absence of covalent bond between the 6H-PG3m or 6H-PG4m protein G variant and the Fc fraction was observed according to the presence or absence of 2-mercaptoethanol, and the covalent bonding ratio was calculated ).

그 결과, 도 8에 나타낸 바와 같이, PG-C3 변이체와 IgG간의 공유결합은 pM 표지 PG-C3 변이체와 IgG 또는 Fc 혼합액에 UV 조사시에만 형성되었으며, 1 개의 단백질 G 분자에 2 개의 IgG 중쇄(heavy chain, H) 또는 Fc 부위가 단백질 G 농도 의존적으로 결합함을 확인함으로써, 단백질 G 변이체는 IgG 중쇄에 특이성을 나타냄을 확인하였다(도 8). 또한, pM 표지 PG-C3과 IgG 또는 Fc 간의 공유 결합 형성은 Met 치환 수에 비례하여 6H-2xPG1m에 비해 6H-2xPG2m이 공유 결합을 더 잘 형성하였으며, 37번 Arg을 도입한 6H-2xPG3m은 6H-2xPG2m에 비해 유사한 공유 결합능을 나타내었다. 6H-2xPG3m의 35번 위치에 Met를 더 도입한 6H-2xPG4m은 6H-2xPG3m에 비해 가장 높은 공유 결합 형성능을 나타내었다. 6H-2xPG3m 및 6H-2xPG4m등 2개 PG-C3 부위을 갖는 경우에는 1 분자당 2 분자의 IgG 중쇄 및 Fc 부위와도 공유 결합을 하는 것을 확인하였다. As a result, as shown in FIG. 8, the covalent bond between the PG-C3 mutant and the IgG was formed only upon UV irradiation in the pM labeled PG-C3 mutant and the IgG or Fc mixed solution, and two IgG heavy chains heavy chain, H) or the Fc region was bound to the protein G concentration-dependently, it was confirmed that the protein G variant had specificity for the IgG heavy chain (FIG. 8). In addition, the covalent bond between pM-labeled PG-C3 and IgG or Fc was more covalently bonded to 6H-2xPG2m than 6H-2xPG1m in proportion to the Met substitution number, while 6H-2xPG3m with Arg at 37 was 6H -2xPG2m. &Lt; / RTI &gt; 6H-2xPG3m, in which Met was further introduced at position 35 of 6H-2xPG3m, exhibited the highest covalent bond forming ability as compared to 6H-2xPG3m. 6H-2xPG3m, and 6H-2xPG4m, it was confirmed that the two covalent bonds with two molecules of IgG heavy chain and Fc region per molecule.

또한, 도 9에 나타낸 바와 같이, 1개 PG-C3 부위을 갖는 6H-PG3m 및 6H-PG4m는 1 분자 항체 중쇄와 결합하는 것으로 나타났으며, 자외선 조사에 의한 공유 결합 형성능을 분석한 결과도 예상대로 3 개 Met을 갖는 6H-PG4m이 2개 Met를 갖는 6H-PG3m에 비해 높게 나타남을 확인하였다. 2-머갑토에탄올(2-mercaptoethanol) 존재시 pM 표지 6H-PG3m은 41.5±1.8%, 6H-PG4m은 53.0±1.0% 공유결합률로 중쇄와 공유 결합을 형성함을 확인하였다. 또한 pM 표지 6H-PG3m 및 6H-PG4m는 인간 Fc 분획과의 공유 결합을 형성하였으며, 공유결합률은 각각 35.8±1.7% 및 52.1±1.0 %로 IgG의 중쇄에 대한 결합률과 유사하게 나타남을 확인하였다(도 9). Further, as shown in Fig. 9, 6H-PG3m and 6H-PG4m having one PG-C3 region were found to bind to the single-molecule antibody heavy chain, and the results of analysis of covalent bond formation ability by ultraviolet irradiation were also as expected 6H-PG4m with 3 Mets was higher than 6H-PG3m with 2 Mets. In the presence of 2-mercaptoethanol, it was confirmed that the pM-labeled 6H-PG3m formed a covalent bond with the heavy chain at 41.5 ± 1.8% and the 6H-PG4m at 53.0 ± 1.0% covalent bond. In addition, the pM-labeled 6H-PG3m and 6H-PG4m formed covalent bonds with the human Fc fraction, and the covalent bonding rates were 35.8 ± 1.7% and 52.1 ± 1.0%, respectively, similar to the binding rate to the heavy chain of IgG 9).

또한, IgG 1 분자에는 2 분자 단백질 G 결합 부위를 갖고 있으므로, 이중 2-머갑토에탄올(2ME)존재하의 SDS-PAGE에서 50% 단백질 G와 IgG 공유결합 형성 확률은 이론적으로 1개 이상의 Protein G가 IgG와 공유결합 확률이 75%이며, 35%일 경우에는 58%이다. 도 10에 나타낸 바와 같이, 6H-PG3m의 경우 35.2%(+2ME) 및 57.4 %(-2ME), 6H-PG4m의 경우 48.2%(+2ME) 및 68.5%(-2ME)의 결합률을 나타냄을 확인하였으며, 따라서 상기 결과는 이론적 계산치에 근접함을 확인하였다(도 10).
In addition, since the IgG 1 molecule has a bimolecular protein G binding site, the probability of forming 50% protein G and IgG covalent bonds in SDS-PAGE in the presence of 2-mercaptoethanol (2ME) The probability of covalent binding to IgG is 75%, and for 35% it is 58%. As shown in Fig. 10, it was confirmed that the binding rate of 35.2% (+ 2ME) and 57.4% (-2ME) for 6H-PG3m and 48.2% (+ 2ME) and 68.5% (-2ME) for 6H- , Confirming that the result is close to the theoretical calculation (FIG. 10).

<< 실시예Example 6>  6> IgGIgG 및 단백질 G의 공유결합에 의한  And by covalent bonding of protein G 혈액내In the blood 항체의 치환  Substitution of antibody 억제능Inhibition 확인 Confirm

단백질 G는 다양한 항체칩 제조에 매우 유용하나 혈액 시료처리시 가역적으로 혈액내 IgG로 치환되는 단점이 있으며, 이들 간의 공유결합은 이를 억제할 수 있다. 따라서, IgG 및 단백질 G의 공유결합에 의한 혈액내 항체의 치환 억제능을 분석하기 위하여, SDS-PAGE, 코마시(Coomassie) 염색 및 웨스턴 블럿팅(western blotting)을 수행하였다.Protein G is very useful for the preparation of various antibody chips, but it has the disadvantage that it is reversibly substituted with IgG in the blood during the treatment of blood samples, and the covalent bond between them can inhibit it. Thus, SDS-PAGE, Coomassie staining and western blotting were performed to analyze the ability of IgG and protein G to inhibit the substitution of antibodies in blood by covalent bonding.

구체적으로, PBS에 평형시킨 5 mg 인간 IgG(Erbitux)에 500 ㎍의 바이오틴(biotin)-NHS(N-hydroxysuccinimide)를 1 시간 동안 결합시킨 다음, 투석시켜 바이오틴화된 IgG(bIgG)를 제조하였다. 그 다음, 상기 제조한 bIgG 20 ㎍와 10 ㎍의 Met 또는 pM 표지된 6H-PG4m을 혼합하고 상기 <실시예 5>와 같이 UV 조사 후 SDS-PAGE를 수행하였다. Specifically, 500 μg of biotin-NHS (N-hydroxysuccinimide) was bound to 5 mg of human IgG (Erbitux) equilibrated with PBS for 1 hour and dialyzed to prepare biotinylated IgG (bIgG). Next, 20 μg of the bIgG prepared above and 10 μg of Met or pM-labeled 6H-PG4m were mixed and subjected to SDS-PAGE after UV irradiation as in Example 5 above.

그 결과, 제조한 바이오틴화된 IgG 및 pM 표지 6H-PG4m이 자외선 조사 후 공유 결합을 형성함을 확인하였다.As a result, it was confirmed that the biotinylated IgG and the pM label 6H-PG4m thus prepared formed a covalent bond after irradiation with ultraviolet light.

또한, bIgG 20 ㎍와 10 ㎍의 Met 또는 pM 표지된 6H-PG4m을 30 mM 이미다졸(imidazole) 존재하에서 10 ㎕의 Ni-NTA-아가로오스 비드(agarose bead, Quiagen, Germany)에 결합시킨 다음, 상기 비드를 세척완충액(20 mM Tris-HCl, 300 mM NaCl 및 30 mM imidazole, pH 7.5)으로 두 번, TBS(20 mM Tris, 150 mM NaCl 및 0.05% Tween 20, pH 7.5)로 두 번 세척한 다음, 인간 혈장(Sigma-Aldrich, USA) 및 2% 알부민(albumin) 용액을 150 ㎕씩 2시간 동안 두 번 처리하였다. 그 후, 상기 비드를 다시 세척완충액 및 TBS로 3 번씩 씻어준 다음, 30 ㎕의 용출완충액(20 mM Tris-HCl, 300 mM NaCl 및 150 mM imidazole, pH 7.5)으로 용출하였다. 용출된 bIgG는 SDS-PAGE 겔에 전기영동하여 분리하고, 코마시에 브릴리언트 블루 R-250(Coomassie brilliant blue R-250) 염색(도 11a) 또는 니트로셀루로오스 막(nitrocellulse membrane)에 이동시키고 스트렙타비딘-퍼옥시데이즈(streptavidin-peroxidase)를 이용하여 시각화하였다(도 11b).In addition, 20 b of bIgG and 10 의 of Met or pM labeled 6H-PG4m were bound to 10 의 of Ni-NTA-agarose beads (agarose bead, Quiagen, Germany) in the presence of 30 mM imidazole , The beads were washed twice with TBS (20 mM Tris, 150 mM NaCl and 0.05% Tween 20, pH 7.5) twice with wash buffer (20 mM Tris-HCl, 300 mM NaCl and 30 mM imidazole, pH 7.5) (Sigma-Aldrich, USA) and 2% albumin solution were treated with 150 μl twice for 2 hours. The beads were then rinsed with wash buffer and TBS three times and then eluted with 30 의 of elution buffer (20 mM Tris-HCl, 300 mM NaCl and 150 mM imidazole, pH 7.5). The eluted bIgG was separated by electrophoresis on an SDS-PAGE gel, transferred to a Coomassie brilliant blue R-250 staining (Fig. 11a) or a nitrocellulose membrane, And visualized using streptavidin-peroxidase (Fig. 11 (b)).

그 결과, 도 11에 나타낸 바와 같이, 코마시 염색에 의하여 전체 단백질 양상을 분석한 결과 IgG의 경쇄(light chain)(bL) 밴드, 및 pM 표지 및 자외선 조사군에서는 혈장 처리에 의한 변화가 미미하였으나 다른 군들에서는 변화가 대부분이 사라졌으며, bIgG의 중쇄(bH) 및 6H-PG4m 결합체(bH-PG)도 혈청 처리에 의하여 거의 감소되지 않음을 확인하였다(도 11a). 또한, 웨스턴블럿팅에 의하여 분석한 양상도 비록 bH 및 bH-PG 밴드들의 신호는 미약하지만, 이와 유사하게 pM 표지 및 자외선 조사군에서는 bL, bH 및 bH-PG 밴드들이 혈청처리에 의하여 영향을 거의 받지 않지만, 나머지 군에서는 혈청 처리에 의하여 단백질 G에 결합된 bIgG가 80%이상 해리되는 양상을 나타냄을 확인하였다(도 11b). 따라서, 상기 결과를 통해 IgG-단백질 G 변이 공유결합체는 혈액시료 분석용 항체칩 등의 개발에 유용하게 사용할 수 있음을 확인하였으며, 이와 더불어 항체 표지 정맥주사용 표적지향적 나노입자 전달체 제조시에도 유용하게 사용될 수 있음을 확인하였다.As a result, as shown in FIG. 11, analysis of the whole protein pattern by coma staining revealed that the light chain (bL) band of IgG and the change by plasma treatment in the pM marker and ultraviolet irradiation group were small Most of the changes were disappeared in the other groups, and it was confirmed that the heavy chain (bH) and 6H-PG4m conjugate (bH-PG) of bIgG were hardly reduced by the serum treatment (FIG. In addition, bH, bH and bH-PG bands in the pM-labeled and UV-irradiated groups were similar to those in the bH and bH-PG bands, In the other groups, bIgG bound to protein G was more than 80% dissociated by serum treatment (Fig. 11 (b)). Therefore, it was confirmed that the covalent conjugate of IgG-protein G variant can be usefully used for the development of antibody chips for blood sample analysis, and it is also useful in the production of target-oriented nanoparticle carriers using antibody-labeled beer Can be used.

<110> Korea Research Institute of Bioscience and Biotechnology <120> Photoactive methionine mimetics introduced Protein G mutants <130> 13p-10-75 <160> 19 <170> KopatentIn 2.0 <210> 1 <211> 55 <212> PRT <213> immunogloblin G binding region C1 <400> 1 Thr Tyr Lys Leu Ile Leu Asn Gly Lys Thr Leu Lys Gly Glu Thr Thr 1 5 10 15 Thr Glu Ala Val Asp Ala Ala Thr Ala Glu Lys Val Phe Lys Gln Tyr 20 25 30 Ala Asn Asp Asn Gly Val Asp Gly Glu Trp Thr Tyr Asp Asp Ala Thr 35 40 45 Lys Thr Phe Thr Val Thr Glu 50 55 <210> 2 <211> 55 <212> PRT <213> immunogloblin G binding region C2 <400> 2 Thr Tyr Lys Leu Val Ile Asn Gly Lys Thr Leu Lys Gly Glu Thr Thr 1 5 10 15 Thr Glu Ala Val Asp Ala Ala Thr Ala Glu Lys Val Phe Lys Gln Tyr 20 25 30 Ala Asn Asp Asn Gly Val Asp Gly Glu Trp Thr Tyr Asp Asp Ala Thr 35 40 45 Lys Thr Phe Thr Val Thr Glu 50 55 <210> 3 <211> 55 <212> PRT <213> immunogloblin G binding region C3 <400> 3 Thr Tyr Lys Leu Val Ile Asn Gly Lys Thr Leu Lys Gly Glu Thr Thr 1 5 10 15 Thr Lys Ala Val Asp Ala Glu Thr Ala Glu Lys Ala Phe Lys Gln Tyr 20 25 30 Ala Asn Asp Asn Gly Val Asp Gly Val Trp Thr Tyr Asp Asp Ala Thr 35 40 45 Lys Thr Phe Thr Val Thr Glu 50 55 <210> 4 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> PG-Bam-F forward primer <400> 4 ataggatcct gctgcggcgg gacaacttac aaacttgtta tt 42 <210> 5 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> PG-Xho-R reverse primer <400> 5 gcgcctcgag ttattcagtt accgtaaagg tc 32 <210> 6 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> PG-Bam-F <400> 6 ataggatcct gctgcggcgg gacaacttac aaacttgtta tt 42 <210> 7 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> PG-XhoI-R <400> 7 gcgcctcgag ttattcagtt accgtaaagg tc 32 <210> 8 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> PG-Q32M-F <400> 8 aaagccttca aaatgtacgc taacgagaac gg 32 <210> 9 <211> 39 <212> DNA <213> Artificial Sequence <220> <223> PG-Q32M-R <400> 9 gttagcgtac attttgaagg ctttttctgc agtttctgc 39 <210> 10 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> PG-D40M-F <400> 10 gacaacggtg ttatgggtgt ttggacttat gatg 34 <210> 11 <211> 31 <212> DNA <213> Artificial Sequence <220> <223> PG-D40M-R <400> 11 ccaaacaccc ataacaccgt tgtcgttagc g 31 <210> 12 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> PG-N37R-F <400> 12 gctaacgacc gcggtgttat gggtgtttgg 30 <210> 13 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> PG-N37-R <400> 13 cataacaccg cggtcgttag cgtacatttt 30 <210> 14 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> PG-35,37-F <400> 14 gctatggacc gcggtgttat gggtgtttgg 30 <210> 15 <211> 36 <212> DNA <213> Artificial Sequence <220> <223> PG-35,37-R <400> 15 cataacaccg cggtccatag cgtacatttt gaaggc 36 <210> 16 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> Ins-Cla-F <400> 16 gaagtgatcg atgcgtctga atta 24 <210> 17 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> Ins-Cla-R <400> 17 taattcagac gcatcgatca cttc 24 <210> 18 <211> 28 <212> DNA <213> Artificial Sequence <220> <223> ET-Xba-F <400> 18 ttcccctcta gaaataattt tgtttaac 28 <210> 19 <211> 29 <212> DNA <213> Artificial Sequence <220> <223> ET-R <400> 19 ttatgctagt tattgctcag cggtggcag 29 <110> Korea Research Institute of Bioscience and Biotechnology <120> Photoactive methionine mimetics introduced Protein G mutants <130> 13p-10-75 <160> 19 <170> Kopatentin 2.0 <210> 1 <211> 55 <212> PRT <213> immunogloblin G binding region C1 <400> 1 Thr Tyr Lys Leu Ile Leu Asn Gly Lys Thr Leu Lys Gly Glu Thr Thr   1 5 10 15 Thr Glu Ala Val Asp Ala Ala Thr Ala Glu Lys Val Phe Lys Gln Tyr              20 25 30 Ala Asn Asp Asn Gly Val Asp Gly Glu Trp Thr Tyr Asp Asp Ala Thr          35 40 45 Lys Thr Phe Thr Val Thr Glu      50 55 <210> 2 <211> 55 <212> PRT <213> immunogloblin G binding region C2 <400> 2 Thr Tyr Lys Leu Val Ile Asn Gly Lys Thr Leu Lys Gly Glu Thr Thr   1 5 10 15 Thr Glu Ala Val Asp Ala Ala Thr Ala Glu Lys Val Phe Lys Gln Tyr              20 25 30 Ala Asn Asp Asn Gly Val Asp Gly Glu Trp Thr Tyr Asp Asp Ala Thr          35 40 45 Lys Thr Phe Thr Val Thr Glu      50 55 <210> 3 <211> 55 <212> PRT <213> immunogloblin G binding region C3 <400> 3 Thr Tyr Lys Leu Val Ile Asn Gly Lys Thr Leu Lys Gly Glu Thr Thr   1 5 10 15 Thr Lys Ala Val Asp Ala Glu Thr Ala Glu Lys Ala Phe Lys Gln Tyr              20 25 30 Ala Asn Asp Asn Gly Val Asp Gly Val Trp Thr Tyr Asp Asp Ala Thr          35 40 45 Lys Thr Phe Thr Val Thr Glu      50 55 <210> 4 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> PG-Bam-F forward primer <400> 4 ataggatcct gctgcggcgg gacaacttac aaacttgtta tt 42 <210> 5 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> PG-Xho-R reverse primer <400> 5 gcgcctcgag ttattcagtt accgtaaagg tc 32 <210> 6 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> PG-Bam-F <400> 6 ataggatcct gctgcggcgg gacaacttac aaacttgtta tt 42 <210> 7 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> PG-XhoI-R <400> 7 gcgcctcgag ttattcagtt accgtaaagg tc 32 <210> 8 <211> 32 <212> DNA <213> Artificial Sequence <220> <223> PG-Q32M-F <400> 8 aaagccttca aaatgtacgc taacgagaac gg 32 <210> 9 <211> 39 <212> DNA <213> Artificial Sequence <220> <223> PG-Q32M-R <400> 9 gttagcgtac attttgaagg ctttttctgc agtttctgc 39 <210> 10 <211> 34 <212> DNA <213> Artificial Sequence <220> <223> PG-D40M-F <400> 10 gacaacggtg ttatgggtgt ttggacttat gatg 34 <210> 11 <211> 31 <212> DNA <213> Artificial Sequence <220> <223> PG-D40M-R <400> 11 ccaaacaccc ataacaccgt tgtcgttagc g 31 <210> 12 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> PG-N37R-F <400> 12 gctaacgacc gcggtgttat gggtgtttgg 30 <210> 13 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> PG-N37-R <400> 13 cataacaccg cggtcgttag cgtacatttt 30 <210> 14 <211> 30 <212> DNA <213> Artificial Sequence <220> <223> PG-35,37-F <400> 14 gctatggacc gcggtgttat gggtgtttgg 30 <210> 15 <211> 36 <212> DNA <213> Artificial Sequence <220> <223> PG-35,37-R <400> 15 cataacaccg cggtccatag cgtacatttt gaaggc 36 <210> 16 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> Ins-Cla-F <400> 16 gaagtgatcg atgcgtctga atta 24 <210> 17 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> Ins-Cla-R <400> 17 taattcagac gcatcgatca cttc 24 <210> 18 <211> 28 <212> DNA <213> Artificial Sequence <220> <223> ET-Xba-F <400> 18 ttcccctcta gaaataattt tgtttaac 28 <210> 19 <211> 29 <212> DNA <213> Artificial Sequence <220> <223> ET-R <400> 19 ttatgctagt tattgctcag cggtggcag 29

Claims (17)

단백질 G(protein G)의 첫 번째 항체 결합 부위(immunogloblin G binding region C1, PG-C1), 두 번째 항체 결합 부위(immunogloblin G binding region C2, PG-C2) 및 세 번째 항체 결합 부위(immunogloblin G binding region C3, PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된 단백질 G 변이체.
The first antibody binding site of the protein G (immunoglobulin G binding region C1, PG-C1), the second antibody binding site (immunoglobulin G binding region C2, PG-C2) and the third antibody binding site glutamine (Gln) at the 32nd position from the N-terminus, asparagine (Asn) at the 35th position, and aspartic acid (Asp) at the 40th position from the N-terminus of any one amino acid sequence selected from the group consisting of SEQ ID NO: A protein G mutant which is substituted with methionine (Met) and whose asparagine at position 37 (Asn) is substituted with arginine (Arg).
제 1항에 있어서, 상기 단백질 G의 첫 번째 항체 결합 부위(PG-C1)는 서열번호 1의 아미노산 서열로 구성되는 것을 특징으로 하는 단백질 G 변이체.
The protein G variant according to claim 1, wherein the first antibody binding site (PG-C1) of the protein G is composed of the amino acid sequence of SEQ ID NO: 1.
제 1항에 있어서, 상기 단백질 G의 두 번째 항체 결합 부위(PG-C2)는 서열번호 2의 아미노산 서열로 구성되는 것을 특징으로 하는 단백질 G 변이체.
2. The protein G mutant according to claim 1, wherein the second antibody binding site (PG-C2) of the protein G is composed of the amino acid sequence of SEQ ID NO: 2.
제 1항에 있어서, 상기 단백질 G의 세 번째 항체 결합 부위(PG-C3)는 서열번호 3의 아미노산 서열로 구성되는 것을 특징으로 하는 단백질 G 변이체.

The protein G variant according to claim 1, wherein the third antibody binding site (PG-C3) of the protein G is composed of the amino acid sequence of SEQ ID NO: 3.

제 1항에 있어서, 상기 단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 또는 세 번째 항체 결합 부위(PG-C3)는 1 개 또는 2 개 포함되는 것을 특징으로 하는 단백질 G 변이체.

The method according to claim 1, wherein one or two of the first antibody binding site (PG-C1), the second antibody binding site (PG-C2) or the third antibody binding site (PG-C3) &Lt; / RTI &gt; protein G mutant.

제 1항의 단백질 G 변이체를 암호화하는 폴리뉴클레오티드.
A polynucleotide encoding the protein G variant of claim 1.
제 6항의 폴리뉴클레오티드를 포함하는 발현벡터.
An expression vector comprising the polynucleotide of claim 6.
단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열 N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)이 각각 메티오닌(Met)으로 치환되고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환된 아미노산 서열로 구성된, 광활성을 갖는 광메티오닌(photomethionine, pM) 도입 단백질 G 변이체.
Terminal amino acid sequence selected from the group consisting of the first antibody binding site (PG-C1), the second antibody binding site (PG-C2) and the third antibody binding site (PG-C3) (Asn) at the 37th position are substituted with methionine (Met), and the asparagine (Asn) at the 35th position and the aspartic acid (Asp) A photomethionine (pM) -transfected protein G variant consisting of a substituted amino acid sequence.
단백질 G의 첫 번째 항체 결합 부위(PG-C1), 두 번째 항체 결합 부위(PG-C2) 및 세 번째 항체 결합 부위(PG-C3)로 구성된 군으로부터 선택된 어느 하나의 아미노산 서열에서, N-말단으로부터 32 번째 위치의 글루타민(Gln), 35 번째 위치의 아스파라긴(Asn) 및 40 번째 위치의 아스파르트산(Asp)을 각각 메티오닌(Met)으로 치환시키고, 37 번째 위치의 아스파라긴(Asn)이 아르기닌(Arg)으로 치환시키는 단계를 포함하는 단백질 G 변이체의 제조 방법.
In either amino acid sequence selected from the group consisting of the first antibody binding site (PG-C1), the second antibody binding site (PG-C2) and the third antibody binding site (PG-C3) (Asn) at the 35th position and aspartic acid (Asp) at the 40th position are respectively substituted with methionine (Met), and asparagine (Asn) at the 37th position is substituted with arginine (Arg) ). &Lt; / RTI &gt;
1) 광메티오닌 도입을 위한 메티오닐 tRNT 합성효소(methionyl tRNA synthase, MRS) 변이체를 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터 및 제 7항의 발현 벡터를 각각 제조하는 단계;
2) 상기 단계 1)의 발현 벡터를 동시에 숙주세포에 도입하여 형질전환체를 제조하는 단계; 및
3) 상기 단계 2)의 형질전환체를 배양하여 pM이 표지된 단백질 G 변이체를 발현시키는 단계를 포함하는, pM 도입 단백질 G 변이체의 제조 방법.
1) preparing an expression vector comprising a polynucleotide encoding a methionyl tRNA synthase (MRS) variant for photomethionine introduction and the expression vector of claim 7, respectively;
2) introducing the expression vector of step 1) simultaneously into a host cell to prepare a transformant; And
3) culturing the transformant of step 2) to express pM-labeled protein G mutant.
제 10항에 있어서, 상기 단계 1)의 벡터는 플라스미드 벡터인 것을 특징으로 하는 pM 도입 단백질 G 변이체의 제조 방법.
[Claim 11] The method according to claim 10, wherein the vector of step 1) is a plasmid vector.
제 10항에 있어서, 상기 단계 2)의 숙주세포는 대장균(E. coli), 원핵 생물, 효모 또는 진핵 세포를 포함하는 것을 특징으로 하는 pM 도입 단백질 G 변이체의 제조 방법.
[Claim 11] The method according to claim 10, wherein the host cell of step 2) comprises E. coli , prokaryotes, yeast or eukaryotic cells.
제 1항의 단백질 G 변이체, 및 항체 또는 이의 단편이 결합된 융합 단백질.
A fusion protein comprising the protein G variant of claim 1, and an antibody or fragment thereof.
제 13항에 있어서, 상기 단편은 항체의 Fc 부위인 것을 특징으로 하는 융합 단백질.
14. The fusion protein of claim 13, wherein the fragment is an Fc region of an antibody.
제 1항의 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 바이오 칩.
A biochip comprising an antibody or fragment thereof bound to the protein G variant of claim 1.
제 1항의 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 바이오 센서.
A biosensor comprising an antibody or fragment thereof bound to the protein G variant of claim 1.
제 1항의 단백질 G 변이체에 결합된 항체 또는 이의 단편을 포함하는 항체 표지 정맥주사용 나노입자 전달체.
An antibody-labeled intravenous nanoparticle carrier comprising an antibody or fragment thereof conjugated to the protein G variant of claim 1.
KR1020130148287A 2013-05-30 2013-12-02 Photoactive methionine mimetics introduced Protein G mutants KR101598581B1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
KR1020130148287A KR101598581B1 (en) 2013-12-02 2013-12-02 Photoactive methionine mimetics introduced Protein G mutants
PCT/KR2014/004803 WO2014193176A1 (en) 2013-05-30 2014-05-29 Methionyl trna synthetase for biosynthesis of photomethionine-labeled protein and method for preparing photoactive protein g variant using same
US14/894,756 US9914757B2 (en) 2013-05-30 2014-05-29 Methionyl tRNA synthetase for biosynthesis of photomethionine-labeled protein and method for preparing photoactive protein G variant using same

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020130148287A KR101598581B1 (en) 2013-12-02 2013-12-02 Photoactive methionine mimetics introduced Protein G mutants

Publications (2)

Publication Number Publication Date
KR20150063660A true KR20150063660A (en) 2015-06-10
KR101598581B1 KR101598581B1 (en) 2016-02-29

Family

ID=53505387

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020130148287A KR101598581B1 (en) 2013-05-30 2013-12-02 Photoactive methionine mimetics introduced Protein G mutants

Country Status (1)

Country Link
KR (1) KR101598581B1 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20080000507A (en) * 2006-06-27 2008-01-02 한국생명공학연구원 Cysteine-tagged staphylococcal protein g variant

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20080000507A (en) * 2006-06-27 2008-01-02 한국생명공학연구원 Cysteine-tagged staphylococcal protein g variant

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Nature Methods, 2005.03.23., 2권, 4호, 261-267면. *
Proc Natl Acad Sci U S A. 2009 Sep 8,106(36):15285-90. *
한국생산제조시스템학회, 추계학술대회 논문집, 49면(2013) *

Also Published As

Publication number Publication date
KR101598581B1 (en) 2016-02-29

Similar Documents

Publication Publication Date Title
KR101657736B1 (en) Modified biotin-conjugated protein
JP4377242B2 (en) Protein tag comprising a biotinylated domain, method for increasing solubility and method for determining folding state
WO2021185360A1 (en) Novel truncated sortase variants
WO2008156249A1 (en) Protein g-oligonucleotide conjugate
Wu et al. Secretory production and purification of functional full-length streptavidin from Bacillus subtilis
US5888775A (en) Peptide synthesis and purification by fusion to penI protein or precipitation effective portion thereof
KR101247374B1 (en) Novel peptides with specific binding to Fc domain of IgG and their preparation methods
JP5865002B2 (en) Recombinant plasmid vector and protein production method using the same
KR20110052663A (en) Modified biotin-binding protein
KR101598581B1 (en) Photoactive methionine mimetics introduced Protein G mutants
US9914757B2 (en) Methionyl tRNA synthetase for biosynthesis of photomethionine-labeled protein and method for preparing photoactive protein G variant using same
CN108300725B (en) Soluble single-chain antibody superantigen fusion gene and protein, and preparation and application thereof
KR102420704B1 (en) Method for increasing stability of target protein immobilized in silica nanoparticle by salt treatment
EP1981978B1 (en) Affinity polypeptide for purification of recombinant proteins
CN113087807B (en) Shiga toxin B subunit recombinant protein-based probe for detecting carbohydrate antigen and preparation method thereof
JP6163194B2 (en) Modified biotin-binding protein
CN114404567B (en) Use of frizzled protein 7 for enhancing intestinal barrier protection
JP5645155B2 (en) Molecular weight marker and method for producing molecular weight marker
JPWO2004031243A1 (en) Protein polymer and method for producing the same
WO2024178215A2 (en) Chimeric biosensor for the detection 2&#39;3&#39;-cyclic gmp-amp (cgamp) and methods of use thereof
KR101694965B1 (en) Peptide tag with improved affinity toward 2B8 antibody and use thereof
WO2002095013A2 (en) Engineered bira for in vitro biotinylation
KR101695274B1 (en) Protein g-linker conjugation using a linker
KR20120049206A (en) Gfp-specific single domain antibody
JP2018102313A (en) Artificial forisome body with seo-f fusion proteins, plant or yeast cells comprising vectors which code for these proteins, as well as vectors coding for seo-f fusion proteins

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant
FPAY Annual fee payment

Payment date: 20190104

Year of fee payment: 4

FPAY Annual fee payment

Payment date: 20200107

Year of fee payment: 5