KR20140022699A - Composition for prevention or treatment of inflammation comprising telomerase peptide - Google Patents

Composition for prevention or treatment of inflammation comprising telomerase peptide Download PDF

Info

Publication number
KR20140022699A
KR20140022699A KR1020120089167A KR20120089167A KR20140022699A KR 20140022699 A KR20140022699 A KR 20140022699A KR 1020120089167 A KR1020120089167 A KR 1020120089167A KR 20120089167 A KR20120089167 A KR 20120089167A KR 20140022699 A KR20140022699 A KR 20140022699A
Authority
KR
South Korea
Prior art keywords
peptide
telomerase
arg
leu
prt
Prior art date
Application number
KR1020120089167A
Other languages
Korean (ko)
Inventor
김상재
김범준
이규용
고성호
김경희
Original Assignee
김상재
주식회사 카엘젬백스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 김상재, 주식회사 카엘젬백스 filed Critical 김상재
Priority to KR1020120089167A priority Critical patent/KR20140022699A/en
Priority to US14/400,322 priority patent/US20150125438A1/en
Priority to CN201380038045.1A priority patent/CN104470947B/en
Priority to ES18187426T priority patent/ES2871899T3/en
Priority to EP21162575.1A priority patent/EP3896078A1/en
Priority to PCT/EP2013/055326 priority patent/WO2014012683A1/en
Priority to ES13709221T priority patent/ES2693321T3/en
Priority to EP13709221.9A priority patent/EP2875042B1/en
Priority to KR1020207019525A priority patent/KR102302392B1/en
Priority to JP2015521997A priority patent/JP6352911B2/en
Priority to EP18187426.4A priority patent/EP3428182B1/en
Priority to KR1020147034319A priority patent/KR20150031413A/en
Priority to CN201910110866.0A priority patent/CN109777791B/en
Priority to CN202311502816.XA priority patent/CN117551631A/en
Priority to TW109115548A priority patent/TWI779287B/en
Priority to TW111118818A priority patent/TWI836435B/en
Priority to TW102115615A priority patent/TWI658141B/en
Priority to TW106121753A priority patent/TWI647311B/en
Priority to TW108101145A priority patent/TWI700290B/en
Publication of KR20140022699A publication Critical patent/KR20140022699A/en
Priority to US15/479,746 priority patent/US20170275603A1/en
Priority to JP2017077422A priority patent/JP6514259B2/en
Priority to US15/664,806 priority patent/US20170327802A1/en
Priority to JP2019075635A priority patent/JP6788062B2/en
Priority to US16/746,018 priority patent/US20200140832A1/en
Priority to US16/818,001 priority patent/US11098294B2/en
Priority to JP2020181780A priority patent/JP7128246B2/en
Priority to US17/389,671 priority patent/US11905536B2/en
Priority to JP2022130519A priority patent/JP7440581B2/en
Priority to US18/411,838 priority patent/US20240158768A1/en
Priority to JP2024021407A priority patent/JP2024056904A/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A23L33/18—Peptides; Protein hydrolysates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4703—Inhibitors; Suppressors
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0069—Oxidoreductases (1.) acting on single donors with incorporation of molecular oxygen, i.e. oxygenases (1.13)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
    • C12N9/0083—Miscellaneous (1.14.99)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y113/00—Oxidoreductases acting on single donors with incorporation of molecular oxygen (oxygenases) (1.13)
    • C12Y113/11—Oxidoreductases acting on single donors with incorporation of molecular oxygen (oxygenases) (1.13) with incorporation of two atoms of oxygen (1.13.11)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y114/00—Oxidoreductases acting on paired donors, with incorporation or reduction of molecular oxygen (1.14)
    • C12Y114/99—Miscellaneous (1.14.99)
    • C12Y114/99001—Prostaglandin-endoperoxide synthase (1.14.99.1), i.e. cyclooxygenase
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Veterinary Medicine (AREA)
  • Biotechnology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Mycology (AREA)
  • Polymers & Plastics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Epidemiology (AREA)
  • Nutrition Science (AREA)
  • Food Science & Technology (AREA)
  • Birds (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

Disclosed is a pharmaceutical composition for preventing and treating inflammatory diseases containing more than one peptide selected from the group consisting of peptides denoted by sequence number 1-28. The peptide is derived from telomerase. The composition contains 0.1 ug/mg-1 mg/mg of peptide.

Description

텔로머라제 펩티드를 포함하는 염증 예방 또는 억제용 조성물{Composition for prevention or treatment of inflammation comprising telomerase peptide}Composition for prevention or treatment of inflammation comprising telomerase peptide

본 발명은 염증 예방 또는 억제 활성을 가지는 텔로머라제 펩티드를 포함하는 조성물에 관한 것이다.
The present invention relates to a composition comprising a telomerase peptide having anti-inflammatory or inhibitory activity.

염증은 외부의 물리적 자극, 각종 알레르기 유발 물질 접촉을 예로 들 수 있는 화학적 자극 또는 박테리아, 곰팡이 또는 바이러스와 같은 미생물의 침입 등에 의해 생체 조직이 손상되는 것을 막기 위한 생체의 방어 반응 중 하나이다.Inflammation is one of the defense responses of living organisms to prevent damage to biological tissues by external physical stimuli, chemical stimuli such as contact with various allergens or invasion of microorganisms such as bacteria, fungi or viruses.

염증 신호는 사이클로옥시게나제(COX) 경로 또는 리폭시게나제(LOX) 경로를 통하여 만들어지며, 프로스타글란딘, 류코트리엔, 트롬복산 등을 생성한다. 염증 신호가 전달되면 생체 내에서는 여러 가지 변화가 일어나는데, 그 중 하나로 염증이 필요한 부위의 혈관을 확장시켜 혈액 공급이 왕성하게 일어나도록 하여, 호중구 등 염증 반응에 필요한 혈액 세포가 집중 공급되는 현상을 들 수 있다. 그러나 이러한 생체의 방어 반응이 비정상적으로 과도하게 일어나면 여러 염증성 질환들이 발병하게 되므로, 이를 방지하고자 염증 신호 경로의 효소(예를 들어 COX-1, COX-2, 5-LOX, 12-LOX 등)를 억제하여 염증 신호 경로를 차단함으로써, 과도한 염증 반응을 억제할 수 있는 약물들이 개발되고 있다. Inflammatory signals are produced via the cyclooxygenase (COX) pathway or the lipoxygenase (LOX) pathway, producing prostaglandins, leukotrienes, thromboxanes and the like. When the inflammation signal is transmitted, various changes occur in the living body, and one of them is the expansion of blood vessels in the area requiring inflammation so that the blood supply is vigorous and the concentration of blood cells necessary for the inflammatory response such as neutrophils is concentrated. Can be. However, if the defense reaction of the living body is abnormally excessive, various inflammatory diseases develop, and thus, enzymes of the inflammatory signaling pathway (eg, COX-1, COX-2, 5-LOX, 12-LOX, etc.) Drugs are being developed that can inhibit excessive inflammatory responses by inhibiting and blocking the inflammatory signaling pathway.

현재 비스테로이드성 항염증제(NSAID)와 스테로이드성 항염증제(SAID)를 비롯한 다양한 기전의 염증 억제용 약물들이 개발되어 있으나, 이들은 적지 않은 부작용을 나타낼 뿐만 아니라, 염증 반응을 근본적으로 억제하는 것이 아니기에, 좀 더 효과적이고 안전하며 경제성이 높은 약물에 대한 요구가 여전히 존재한다.
Currently, various mechanisms for inhibiting inflammation have been developed, including nonsteroidal anti-inflammatory drugs (NSAIDs) and steroidal anti-inflammatory drugs (SAIDs), but they have not only a few side effects, but they do not fundamentally inhibit the inflammatory response. There is still a need for effective, safe and economical drugs.

본 발명은 펩티드를 포함하여 뛰어난 염증성 질환 예방 또는 치료 효과를 가지는 약학 조성물을 제공하고자 한다.
The present invention is to provide a pharmaceutical composition comprising a peptide having an excellent inflammatory disease prevention or treatment effect.

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 염증성 질환 예방 또는 치료용 약학 조성물을 제공한다.
One aspect of the present invention provides a pharmaceutical composition for preventing or treating an inflammatory disease comprising as an active ingredient at least one peptide selected from the group consisting of the peptides set forth in SEQ ID NOs: 1 to 28.

서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드는 우수한 염증 예방 또는 억제 효과를 가진다. 이에, 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 조성물은 염증성 질환을 예방 또는 치료함에 있어 뛰어난 효과를 발휘할 수 있으므로, 다양한 염증성 질환의 예방 및 치료에 널리 이용될 수 있다.At least one peptide selected from the group consisting of the peptides set forth in SEQ ID NOs: 1 to 28 has an excellent inflammation preventing or inhibiting effect. Thus, a composition comprising at least one peptide selected from the group consisting of the peptides of SEQ ID NOs: 1 to 28 as an active ingredient can exert an excellent effect in preventing or treating an inflammatory disease, and thus is widely used for the prevention and treatment of various inflammatory diseases. Can be used.

HMGB1(High-mobility group box 1) 단백질은 주로 흉선, 림프절, 고환, 태아의 간 등에 높은 농도로 존재하며, 간 세포와 뇌 세포를 제외한 대부분의 세포에서는 세포핵에 존재한다.The high-mobility group box 1 (HMGB1) protein is present in high concentrations in the thymus, lymph nodes, testes, and fetal liver, and is present in the nucleus of most cells except liver and brain cells.

HMGB1 단백질은 외부 자극에 의해 핵 내에 존재하는 HMGB1 단백질이 아세틸화(aceylation)되어 세포질로 이동하다가, 이후 세포 외부로 분비됨으로써 염증 유발 사이토카인(cytokine)의 역할을 한다고 알려져 있다. 이와 같이 염증이 있는 경우 HMGB1 단백질이 세포 외부로 분비되므로, 염증성 질환인 처그-스트라우스 증후군, 류머티스 관절염 및 쇼그렌증후군 환자의 혈청은 정상인보다 매우 많은 양의 HMGB1 단백질을 가진다. 따라서 염증이 유발되는 어떤 자극이 주어지더라도, 세포핵 내의 HMGB1 단백질 양이 많다면 이는 HMGB1 단백질이 세포 외부로 분비되지 않고 있음을 의미하므로, 염증이 억제되고 있다고 볼 수 있을 것이다. HMGB1 protein is known to act as an inflammatory cytokine (cytokine) by acetylating the HMGB1 protein present in the nucleus by external stimulation (aceylation) to the cytoplasm, and then secreted outside the cell. Since the HMGB1 protein is secreted out of the cells when inflamed, the serum of patients with inflammatory diseases such as Chug-Strauss syndrome, rheumatoid arthritis and Sjogren's syndrome has a much higher amount of HMGB1 protein than normal people. Therefore, given any stimulus that causes inflammation, if the amount of HMGB1 protein in the cell nucleus is high, which means that the HMGB1 protein is not secreted to the outside of the cell, it can be seen that inflammation is suppressed.

텔로미어(telomere)는 염색체의 말단에 반복적으로 존재하는 유전 물질로서, 해당 염색체의 손상이나 다른 염색체와의 결합을 방지한다고 알려져 있다. 세포가 분열할 때마다 텔로미어의 길이는 조금씩 짧아지는데, 일정한 횟수 이상의 세포 분열이 있게 되면 텔로미어는 매우 짧아지고, 그 세포는 분열을 멈추고 죽게 된다. 반면 텔로미어를 길게 하면 세포의 수명이 연장된다고 알려져 있으며, 그 예로 암세포에서는 텔로머라제(telomerase)라는 효소가 분비되어 텔로미어가 짧아지는 것을 막기 때문에, 암세포가 죽지 않고 계속 증식할 수 있다고 알려져 있다. 텔로머라제는 약 1,100 내지 1,300 여개의 아미노산을 포함한다고 알려진 바 있다. 본 발명자는 텔로머라제에 포함된 수 많은 펩티드 중 일부가 우수한 염증 예방 또는 억제 효과가 있음을 발견하고, 본 발명을 완성하게 되었다.
Telomere is a genetic material that is repeatedly present at the end of a chromosome, and is known to prevent damage to the chromosome or its binding to other chromosomes. As the cell divides, the length of the telomere is getting shorter. When there is more than a certain number of cell divisions, the telomere becomes very short, and the cell stops dividing and dies. On the other hand, it is known that lengthening the telomeres prolongs the life of the cells. For example, it is known that the cancer cells secrete an enzyme called telomerase and prevent the shortening of the telomeres. Telomerase has been known to contain about 1,100 to 1,300 amino acids. The present inventors have found that some of the many peptides contained in telomerase have excellent anti-inflammatory or inhibitory effects, and have completed the present invention.

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 염증성 질환 예방 또는 치료용 약학 조성물을 제공한다. 본 발명의 다른 일측면에서, 서열 번호 1 내지 28에 기재된 펩티드 중 하나 이상은 텔로머라제에서 유래한 펩티드를 포함한다. 서열 번호 1 내지 28에 기재된 펩티드는 아래 표 1과 같다. 아래 표 1의 "이름"은 각 펩티드들을 구별하기 위해 명명한 것이다. 본 발명의 다른 일측면에서, 서열 번호 1 내지 28에 기재된 펩티드 중 하나 이상은 텔로머라제에 포함된 펩티드 중 해당 위치의 펩티드를 선별해 합성한 "합성 펩티드"를 포함한다.One aspect of the present invention provides a pharmaceutical composition for preventing or treating an inflammatory disease comprising as an active ingredient at least one peptide selected from the group consisting of the peptides set forth in SEQ ID NOs: 1 to 28. In another aspect of the invention, at least one of the peptides set forth in SEQ ID NOs: 1 to 28 comprises a peptide derived from telomerase. The peptides set forth in SEQ ID NOs: 1 to 28 are shown in Table 1 below. "Name" in Table 1 below is named to distinguish each peptide. In another aspect of the present invention, at least one of the peptides set forth in SEQ ID NOs: 1 to 28 includes a "synthetic peptide" synthesized by selecting and synthesizing a peptide at a corresponding position among peptides contained in telomerase.

서열 번호SEQ ID NO: 이름name 텔로머라제 상 위치Telomerase statue location 서열order 1One 펩티드 4Peptide 4 674-683674-683 GLLGASVLGLGLLGASVLGL 22 펩티드 6Peptide 6 613-621613-621 RPALLTSRLRPALLTSRL 33 펩티드 8Peptide 8 691-705691-705 RTFVLRVRAQDPPPERTFVLRVRAQDPPPE 44 펩티드 10Peptide 10 651-665651-665 AERLTSRVKALFSVLAERLTSRVKALFSVL 55 펩티드 11Peptide 11 667-675667-675 YERARRPGLYERARRPGL 66 펩티드 12Peptide 12 675-683675-683 LLGASVLGLLLGASVLGL 77 펩티드 13Peptide 13 680-689680-689 VLGLDDIHRAVLGLDDIHRA 88 펩티드 14Peptide 14 677-686677-686 GASVLGLDDIGASVLGLDDI 99 펩티드 15Peptide 15 660-669660-669 ALFSVLNYERALFSVLNYER 1010 펩티드 16Peptide 16 663-672663-672 SVLNYERARRSVLNYERARR 1111 펩티드 17Peptide 17 679-688679-688 SVLGLDDIHRSVLGLDDIHR 1212 펩티드 20Peptide 20 667-676667-676 YERARRPGLLYERARRPGLL 1313 펩티드 22Peptide 22 668-676668-676 ERARRPGLLERARRPGLL 1414 펩티드 23Peptide 23 680-688680-688 VLGLDDIHRVLGLDDIHR 1515 펩티드 25Peptide 25 664-672664-672 VLNYERARRVLNYERARR 1616 펩티드 26Peptide 26 670-678670-678 ARRPGLLGAARRPGLLGA 1717 펩티드 27Peptide 27 673-681673-681 PGLLGASVLPGLLGASVL 1818 펩티드 28Peptide 28 671-679671-679 RRPGLLGASRRPGLLGAS 1919 펩티드 32Peptide 32 668-675668-675 ERARRPGLERARRPGL 2020 펩티드 33Peptide 33 670-677670-677 ARRPGLLGARRPGLLG 2121 펩티드 37Peptide 37 563-577563-577 VTETTFQKNRLFFYRVTETTFQKNRLFFYR 2222 펩티드 40Peptide 40 603-617603-617 EAEVRQHREARPALLEAEVRQHREARPALL 2323 펩티드 41Peptide 41 613-627613-627 RPALLTSRLRFIPKPRPALLTSRLRFIPKP 2424 펩티드 45Peptide 45 683-697683-697 LDDIHRAWRTFVLRVLDDIHRAWRTFVLRV 2525 펩티드 46Peptide 46 693-707693-707 FVLRVRAQDPPPELYFVLRVRAQDPPPELY 2626 펩티드 47Peptide 47 721-735721-735 PQDRLTEVIASIIKPPQDRLTEVIASIIKP 2727 펩티드 48Peptide 48 578-592578-592 KSVWSKLQSIGIRQHKSVWSKLQSIGIRQH 2828 펩티드 49Peptide 49 593-608593-608 LKRVQLRELSEAEVRQLKRVQLRELSEAEVRQ

본 발명의 일측면에 따른 서열 번호 1 내지 28에 기재된 펩티드 중 하나 이상을 세포에 처리하면, 세포핵 내 HMGB1 단백질 양이 증가한다. 이는 서열 번호 1 내지 28에 기재된 펩티드 중 하나 이상이 우수한 염증 예방 또는 억제 효과를 가짐을 의미한다. 또한 본 발명의 일측면에 따른 서열 번호 1 내지 28에 기재된 펩티드 중 하나 이상은 세포 내 독성이 낮아 생체 내 안정성이 높다는 장점을 가진다.
Treatment of cells with one or more of the peptides set forth in SEQ ID NOS: 1-28 according to one aspect of the present invention increases the amount of HMGB1 protein in the cell nucleus. This means that at least one of the peptides set forth in SEQ ID NOs: 1 to 28 has an excellent inflammation prevention or inhibitory effect. In addition, at least one of the peptides set forth in SEQ ID NOS: 1 to 28 according to one aspect of the present invention has the advantage of low intracellular toxicity and high in vivo stability.

본 명세서에서, "염증성 질환"은 염증을 주 원인으로 하는 질환 또는 질환에 의해 염증이 발생하는 질환 등 염증과 관련된 질환을 모두 포함하는 광범위한 개념이다. 구체적으로, 염증성 질환은 (1) 전신 또는 국소 염증 질환(예를 들어, 알레르기; 면역 복합체 질환; 고초열; 과민성 쇼크; 내독소 쇼크; 악액질(cachexia); 이상 고열; 육아종증; 또는 유육종증); (2) 위장관계 질환(예를 들어, 충수염; 위궤양; 십이지장 궤양; 복막염; 췌장염; 궤양성, 급성 또는 허혈성 대장염; 담관염; 담낭염; 지방 변증; 간염; 크론병; 또는 휘플씨병); (3) 피부 관련 질환(예를 들어, 건선; 화상; 햇볕 화상; 피부염; 담마진성 사마귀 또는 팽진); (4) 심혈관계 질환(예를 들어, 혈관염; 맥관염; 심내막염; 동맥염; 죽상 동맥경화증; 혈전 정맥염; 심막염; 울혈성 심부전; 심근염; 심근 허혈증; 결절성 동맥 주위염; 재발성 협착증; 버거씨병; 또는 류머티즘열); (5) 호흡기계 질환(예를 들어, 천식; 후두개염; 기관지염; 폐기종(emphysema); 비염; 낭포성 섬유증; 간질성 폐렴; 만성폐쇄성 질환(COPD); 성인 호흡 장애 증후군; 진폐증; 폐포염; 세기관지염; 인두염; 늑막염; 또는 부비강염); (6) 뼈, 관절, 근육 및 결합 조직 관련 질환(예를 들어, 호산성 육아종; 관절염; 관절통; 골수염; 피부근염; 근막염; 패젯병; 통풍; 치주 질환; 류머티즘성 관절염; 중증 근무력증; 강직성 척추염; 또는 윤활막염); (7) 비뇨생식계 질환(예를 들어, 부고환염; 질염; 전립선염; 또는 요도염); (8) 중추 또는 말초 신경계 관련 질환(예를 들어, 알츠하이머병; 수막염; 뇌염; 다발성 경화증; 뇌경색; 뇌색전증; 길레인-바르 증후군(Guillain-Barre syndrome); 신경염; 신경통; 척수 외상; 마비; 또는 포도막염); (9) 바이러스(예를 들어, 인플루엔자; 호흡기 세포 융합 바이러스; HIV; B형 간염 바이러스; C형 간염 바이러스 또는 헤르페스 바이러스) 감염 질환(예를 들어, 뎅기열; 또는 패혈증(septicemia)), 진균 감염 질환(예를 들어, 칸디다증), 또는 박테리아, 기생충과 같은 기타 미생물 감염 질환(예를 들어, 산재성 균혈증; 말라리아; 사상충증; 또는 아메바증); (10) 기타 자가 면역성 질환(예를 들어, 갑상선염; 루푸스; 구드패스츄어 증후군; 동종 이식 거부 반응; 이식편 대 숙주병; 또는 당뇨병); 또는 (11) 암 또는 종양성 질환(예를 들어, 호지킨병)을 포함하나, 이에 제한되는 것은 아니다.
As used herein, the term "inflammatory disease" is a broad concept including all diseases related to inflammation, such as diseases mainly caused by inflammation or diseases caused by the disease. Specifically, inflammatory diseases include (1) systemic or local inflammatory diseases (eg, allergies; immune complex diseases; hyperthermia; irritable shock; endotoxin shock; cachexia; abnormal hyperthermia; granulomatosis; or sarcoidosis); (2) gastrointestinal diseases (eg, appendicitis; gastric ulcer; duodenal ulcer; peritonitis; pancreatitis; ulcerative, acute or ischemic colitis; cholangitis; cholecystitis; fatty ecstasy; hepatitis; Crohn's disease; or Whiff's disease); (3) skin-related diseases (eg, psoriasis; burns; sunburn; dermatitis; biliary warts or rashes); (4) cardiovascular diseases (eg, vasculitis; vasculitis; endocarditis; arteritis; atherosclerosis; thrombophlebitis; pericarditis; congestive heart failure; myocarditis; myocardial ischemia; nodular periarteritis; recurrent stenosis; Burger's disease; Or rheumatic fever); (5) respiratory disease (eg, asthma; laryngitis; bronchitis; emphysema; rhinitis; cystic fibrosis; interstitial pneumonia; chronic obstructive disease (COPD); adult respiratory disorder syndrome; pneumoconiosis; alveolitis; Bronchiolitis; pharyngitis; pleurisy; or sinusitis); (6) diseases related to bones, joints, muscles and connective tissue (e.g. eosinophilic granulomas; arthritis; arthralgia; osteomyelitis; dermatitis; fasciitis; pagetosis; gout; periodontal disease; rheumatoid arthritis; myasthenia gravis; ankylosing spondylitis) Or synovial inflammation); (7) urogenital diseases (eg, epididymitis; vaginitis; prostatitis; or urethritis); (8) central or peripheral nervous system related diseases (e.g., Alzheimer's disease; meningitis; encephalitis; multiple sclerosis; cerebral infarction; cerebral embolism; Guillain-Barre syndrome; neuritis; neuralgia; spinal cord trauma; paralysis; or Uveitis); (9) virus (eg, influenza; respiratory cell fusion virus; HIV; hepatitis B virus; hepatitis C virus or herpes virus) infectious disease (eg, dengue; or septicemia), fungal infection disease (Eg, candidiasis), or other microbial infectious diseases such as bacteria, parasites (eg, diffuse bacteremia; malaria; filamentousworm; or amebasis); (10) other autoimmune diseases (eg, thyroiditis; lupus; Goodpasture syndrome; allograft rejection; graft versus host disease; or diabetes); Or (11) cancer or neoplastic disease (eg, Hodgkin's disease).

본 발명의 일측면에 따른 조성물은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 0.1 ㎍/㎎ 내지 1 ㎎/㎎, 구체적으로 1 ㎍/㎎ 내지 0.5 ㎎/㎎, 더 구체적으로 10 ㎍/㎎ 내지 0.1 ㎎/㎎의 함량으로 포함할 수 있다. 상기 범위로 포함하는 경우 본 발명의 의도한 효과를 나타내기에 적절할 뿐만 아니라, 조성물의 안정성 및 안전성을 모두 만족할 수 있으며, 비용 대비 효과의 측면에서도 상기 범위로 포함하는 것이 적절할 수 있다.The composition according to one aspect of the invention comprises 0.1 μg / mg to 1 mg / mg, specifically 1 μg / mg to 0.5 mg / mg, more specifically one or more peptides selected from the group consisting of the peptides set forth in SEQ ID NOs: 1-28. In an amount of 10 μg / mg to 0.1 mg / mg may be included. When it is included in the above range, it is not only suitable for exhibiting the intended effect of the present invention but also can satisfy both the stability and safety of the composition, and may be suitably included in the above range in terms of cost effectiveness.

본 발명의 일측면에 따른 조성물은 인간, 개, 닭, 돼지, 소, 양, 기니아피그 또는 원숭이를 포함하는 모든 동물에 적용될 수 있다.The composition according to one aspect of the present invention can be applied to all animals including humans, dogs, chickens, pigs, cattle, sheep, guinea pigs or monkeys.

본 발명의 일측면에 따른 약학 조성물은 경구, 직장, 경피, 정맥 내, 근육 내, 복강 내, 골수 내, 경막 내 또는 피하 등으로 투여될 수 있다.The pharmaceutical composition according to one aspect of the present invention can be administered orally, rectally, transdermally, intravenously, intramuscularly, intraperitoneally, intramuscularly, intradermally or subcutaneously.

경구 투여를 위한 제형은 정제, 환제, 연질 또는 경질 캅셀제, 과립제, 산제, 액제 또는 유탁제일 수 있으나, 이에 제한되는 것은 아니다. 비경구 투여를 위한 제형은 주사제, 점적제, 로션, 연고, 겔, 크림, 현탁제, 유제, 좌제, 패취 또는 분무제일 수 있으나, 이에 제한되는 것은 아니다.Formulations for oral administration may be, but are not limited to, tablets, pills, soft or hard capsules, granules, powders, solutions or emulsions. Formulations for parenteral administration may be, but are not limited to, injections, drops, lozenges, ointments, gels, creams, suspensions, emulsions, suppositories, patches or spraying agents.

본 발명의 일측면에 따른 약학 조성물은 필요에 따라 희석제, 부형제, 활택제, 결합제, 붕해제, 완충제, 분산제, 계면 활성제, 착색제, 향료 또는 감미제 등의 첨가제를 포함할 수 있다. 본 발명의 일측면에 따른 약학 조성물은 당업계의 통상적인 방법에 의해 제조될 수 있다.The pharmaceutical composition according to one aspect of the present invention may contain additives such as a diluent, an excipient, a lubricant, a binder, a disintegrant, a buffer, a dispersant, a surfactant, a colorant, a fragrance or a sweetener as necessary. The pharmaceutical composition according to one aspect of the present invention can be prepared by a conventional method in the art.

본 발명의 일측면에 따른 약학 조성물의 유효 성분은 투여 받을 대상의 연령, 성별, 체중, 병리 상태 및 그 심각도, 투여 경로 또는 처방자의 판단에 따라 달라질 것이다. 이러한 인자에 기초한 적용량 결정은 당업자의 수준 내에 있으며, 이의 1일 투여 용량은 예를 들어 0.1 ㎍/kg/일 내지 1 g/kg/일, 구체적으로는 1 ㎍/kg/일 내지 10 mg/kg/일, 더 구체적으로는 10 ㎍/kg/일 내지 1 mg/kg/일, 보다 더 구체적으로는 50 ㎍/kg/일 내지 100 ㎍/kg/일이 될 수 있으나, 이에 제한되는 것은 아니다. 본 발명의 일측면에 따른 약학 조성물은 1일 1회 내지 3회 투여될 수 있으나, 이에 제한되는 것은 아니다.
The effective ingredients of the pharmaceutical composition according to one aspect of the present invention will vary depending on the age, sex, weight, pathological condition and severity of the subject to be administered, route of administration, or judgment of the prescriber. Determination of the amount of application based on these factors is within the level of ordinary skill in the art and its daily dose is, for example, from 0.1 [mu] g / kg / day to 1 g / kg / day, Kg / day, more specifically, 10 μg / kg / day to 1 mg / kg / day, and more particularly 50 μg / kg / day to 100 μg / kg / day. The pharmaceutical composition according to one aspect of the present invention may be administered once to three times a day, but is not limited thereto.

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 염증 예방 또는 억제용 피부 외용제 조성물을 제공한다. 본 발명의 다른 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 염증 예방 또는 억제용 화장품 조성물을 제공한다.One aspect of the present invention provides a topical composition for preventing or inhibiting inflammation, comprising at least one peptide selected from the group consisting of the peptides of SEQ ID NOs: 1 to 28 as an active ingredient. Another aspect of the present invention provides a cosmetic composition for preventing or inhibiting inflammation comprising at least one peptide selected from the group consisting of the peptides of SEQ ID NOs: 1 to 28 as an active ingredient.

본 발명의 일측면에 따른 화장품 조성물은 국소 적용에 적합한 모든 제형으로 제공될 수 있다. 예를 들면, 용액, 수상에 유상을 분산시켜 얻은 에멀젼, 유상에 수상을 분산시켜 얻은 에멀젼, 현탁액, 고체, 겔, 분말, 페이스트, 포말(foam) 또는 에어로졸의 제형으로 제공될 수 있다. 이러한 제형은 당해 분야의 통상적인 방법에 따라 제조될 수 있다.Cosmetic compositions according to one aspect of the invention may be provided in any formulation suitable for topical application. For example, it may be provided as a solution, an emulsion obtained by dispersing an oil phase in an aqueous phase, an emulsion obtained by dispersing an oil phase in water, a suspension, a solid, a gel, a powder, a paste, a foam or an aerosol. Such formulations may be prepared according to conventional methods in the art.

본 발명의 일측면에 따른 화장품 조성물은 주 효과를 손상시키지 않는 범위 내에서, 바람직하게는 주 효과에 상승 효과를 줄 수 있는 다른 성분들을 포함할 수 있다. 또한 본 발명의 일측면에 따른 화장품 조성물은 보습제, 에몰리언트제, 계면 활성제, 자외선 흡수제, 방부제, 살균제, 산화 방지제, pH 조정제, 유기 또는 무기 안료, 향료, 냉감제 또는 제한(制汗)제를 더 포함할 수 있다. 상기 성분의 배합량은 본 발명의 목적 및 효과를 손상시키지 않는 범위 내에서 당업자가 용이하게 선정 가능하며, 그 배합량은 화장품 조성물 전체 중량을 기준으로 0.01 내지 5 중량%, 구체적으로 0.01 내지 3 중량%일 수 있다.
The cosmetic composition according to one aspect of the present invention may contain other ingredients, which may be synergistic to the main effect, preferably to the extent that the main effect is not impaired. In addition, the cosmetic composition according to one aspect of the present invention may further contain a moisturizing agent, an emollient agent, a surfactant, an ultraviolet absorber, an antiseptic, a bactericide, an antioxidant, a pH adjuster, an organic or inorganic pigment, a fragrance, . The compounding amount of the above components can be easily selected by those skilled in the art within the range not impairing the object and effect of the present invention, and the amount thereof is 0.01 to 5% by weight, specifically 0.01 to 3% by weight .

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 염증 예방 또는 억제용 식품 조성물을 제공한다.One aspect of the present invention provides a food composition for preventing or inhibiting inflammation comprising at least one peptide selected from the group consisting of the peptides of SEQ ID NOs: 1 to 28 as an active ingredient.

본 발명의 일측면에 따른 식품 조성물의 제형은 특별히 한정되지 않으나, 예를 들어, 정제, 과립제, 분말제, 액제, 고형 제제 등으로 제형화될 수 있다. 각 제형은 유효 성분 이외에 해당 분야에서 통상적으로 사용되는 성분들을 제형 또는 사용 목적에 따라 당업자가 어려움 없이 적의 선정하여 배합할 수 있으며, 다른 원료와 동시에 적용할 경우 상승 효과가 일어날 수 있다.The formulation of the food composition according to one aspect of the present invention is not particularly limited, but can be formulated into, for example, tablets, granules, powders, liquids, solid preparations and the like. Each formulation may be appropriately selected and formulated by those skilled in the art according to the formulation or purpose of use, in addition to the active ingredient, and may be synergistic when applied simultaneously with other raw materials.

상기 유효 성분의 투여량 결정은 당업자의 수준 내에 있으며, 이의 1일 투여 용량은 예를 들어 구체적으로는 1 ㎍/kg/일 내지 10 mg/kg/일, 더 구체적으로는 10 ㎍/kg/일 내지 1 mg/kg/일, 보다 더 구체적으로는 50 ㎍/kg/일 내지 100 ㎍/kg/일이 될 수 있으나, 이에 제한되지 않으며, 투여하고자 하는 대상의 연령, 건강 상태, 합병증 등 다양한 요인에 따라 달라질 수 있다.
Determination of the dosage of the active ingredient is within the level of ordinary skill in the art and its daily dose is, for example, 1 μg / kg / day to 10 mg / kg / day, more specifically 10 μg / kg / day Day to 100 mg / kg / day, but it is not limited thereto, and it may be various factors such as the age, health condition, and complication of the subject to be administered ≪ / RTI >

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드의 염증성 질환 예방 또는 치료 용도를 제공한다.One aspect of the invention provides the use of preventing or treating inflammatory diseases of one or more peptides selected from the group consisting of the peptides set forth in SEQ ID NOs: 1-28.

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드 또는 이를 포함하는 조성물을 대상에게 적용하는 것을 포함하는 대상의 염증성 질환 예방 또는 치료 방법을 제공한다.One aspect of the invention provides a method of preventing or treating an inflammatory disease in a subject comprising applying to the subject at least one peptide selected from the group consisting of the peptides set forth in SEQ ID NOs: 1 to 28 or a composition comprising the same.

본 발명의 일측면은 서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드 또는 이를 포함하는 조성물; 및 펩티드 또는 이를 포함하는 조성물의 투여량, 투여 경로, 투여 횟수 및 적응증 중 하나 이상을 개시한 지시서를 포함하는 염증성 질환 예방 또는 치료용 키트를 제공한다.One aspect of the present invention provides a composition comprising one or more peptides selected from the group consisting of the peptides set forth in SEQ ID NOS: 1 to 28 or the same; And instructions for disclosing one or more of the dosage, route of administration, frequency of administration, and indications of the peptide or composition comprising the same.

SEQUENCE LISTING <110> KAEL-GemVax Co., Ltd. <120> Composition for prevention or treatment of inflammation comprising telomerase peptide <130> 12P450 <160> 28 <170> PatentIn version 3.2 <210> 1 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 1 Gly Leu Leu Gly Ala Ser Val Leu Gly Leu 1 5 10 <210> 2 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 2 Arg Pro Ala Leu Leu Thr Ser Arg Leu 1 5 <210> 3 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 3 Arg Thr Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro Glu 1 5 10 15 <210> 4 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 4 Ala Glu Arg Leu Thr Ser Arg Val Lys Ala Leu Phe Ser Val Leu 1 5 10 15 <210> 5 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 5 Tyr Glu Arg Ala Arg Arg Pro Gly Leu 1 5 <210> 6 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 6 Leu Leu Gly Ala Ser Val Leu Gly Leu 1 5 <210> 7 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 7 Val Leu Gly Leu Asp Asp Ile His Arg Ala 1 5 10 <210> 8 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 8 Gly Ala Ser Val Leu Gly Leu Asp Asp Ile 1 5 10 <210> 9 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 9 Ala Leu Phe Ser Val Leu Asn Tyr Glu Arg 1 5 10 <210> 10 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 10 Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg 1 5 10 <210> 11 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 11 Ser Val Leu Gly Leu Asp Asp Ile His Arg 1 5 10 <210> 12 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 12 Tyr Glu Arg Ala Arg Arg Pro Gly Leu Leu 1 5 10 <210> 13 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 13 Glu Arg Ala Arg Arg Pro Gly Leu Leu 1 5 <210> 14 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 14 Val Leu Gly Leu Asp Asp Ile His Arg 1 5 <210> 15 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 15 Val Leu Asn Tyr Glu Arg Ala Arg Arg 1 5 <210> 16 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 16 Ala Arg Arg Pro Gly Leu Leu Gly Ala 1 5 <210> 17 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 17 Pro Gly Leu Leu Gly Ala Ser Val Leu 1 5 <210> 18 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 18 Arg Arg Pro Gly Leu Leu Gly Ala Ser 1 5 <210> 19 <211> 8 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 19 Glu Arg Ala Arg Arg Pro Gly Leu 1 5 <210> 20 <211> 8 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 20 Ala Arg Arg Pro Gly Leu Leu Gly 1 5 <210> 21 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 21 Val Thr Glu Thr Thr Phe Gln Lys Asn Arg Leu Phe Phe Tyr Arg 1 5 10 15 <210> 22 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 22 Glu Ala Glu Val Arg Gln His Arg Glu Ala Arg Pro Ala Leu Leu 1 5 10 15 <210> 23 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 23 Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile Pro Lys Pro 1 5 10 15 <210> 24 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 24 Leu Asp Asp Ile His Arg Ala Trp Arg Thr Phe Val Leu Arg Val 1 5 10 15 <210> 25 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 25 Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro Glu Leu Tyr 1 5 10 15 <210> 26 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 26 Pro Gln Asp Arg Leu Thr Glu Val Ile Ala Ser Ile Ile Lys Pro 1 5 10 15 <210> 27 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 27 Lys Ser Val Trp Ser Lys Leu Gln Ser Ile Gly Ile Arg Gln His 1 5 10 15 <210> 28 <211> 16 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 28 Leu Lys Arg Val Gln Leu Arg Glu Leu Ser Glu Ala Glu Val Arg Gln 1 5 10 15                          SEQUENCE LISTING <110> KAEL-GemVax Co., Ltd.   <120> Composition for prevention or treatment of inflammation        comprising telomerase peptide <130> 12P450 <160> 28 <170> PatentIn version 3.2 <210> 1 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 1 Gly Leu Leu Gly Ala Ser Val Leu Gly Leu 1 5 10 <210> 2 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 2 Arg Pro Ala Leu Leu Thr Ser Arg Leu 1 5 <210> 3 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 3 Arg Thr Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro Glu 1 5 10 15 <210> 4 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 4 Ala Glu Arg Leu Thr Ser Arg Val Lys Ala Leu Phe Ser Val Leu 1 5 10 15 <210> 5 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 5 Tyr Glu Arg Ala Arg Arg Pro Gly Leu 1 5 <210> 6 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 6 Leu Leu Gly Ala Ser Val Leu Gly Leu 1 5 <210> 7 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 7 Val Leu Gly Leu Asp Asp Ile His Arg Ala 1 5 10 <210> 8 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 8 Gly Ala Ser Val Leu Gly Leu Asp Asp Ile 1 5 10 <210> 9 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 9 Ala Leu Phe Ser Val Leu Asn Tyr Glu Arg 1 5 10 <210> 10 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 10 Ser Val Leu Asn Tyr Glu Arg Ala Arg Arg 1 5 10 <210> 11 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 11 Ser Val Leu Gly Leu Asp Asp Ile His Arg 1 5 10 <210> 12 <211> 10 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 12 Tyr Glu Arg Ala Arg Arg Pro Gly Leu Leu 1 5 10 <210> 13 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 13 Glu Arg Ala Arg Arg Pro Gly Leu Leu 1 5 <210> 14 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 14 Val Leu Gly Leu Asp Asp Ile His Arg 1 5 <210> 15 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 15 Val Leu Asn Tyr Glu Arg Ala Arg Arg 1 5 <210> 16 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 16 Ala Arg Arg Pro Gly Leu Leu Gly Ala 1 5 <210> 17 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 17 Pro Gly Leu Leu Gly Ala Ser Val Leu 1 5 <210> 18 <211> 9 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 18 Arg Arg Pro Gly Leu Leu Gly Ala Ser 1 5 <210> 19 <211> 8 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 19 Glu Arg Ala Arg Arg Pro Gly Leu 1 5 <210> 20 <211> 8 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 20 Ala Arg Arg Pro Gly Leu Leu Gly 1 5 <210> 21 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 21 Val Thr Glu Thr Thr Phe Gln Lys Asn Arg Leu Phe Phe Tyr Arg 1 5 10 15 <210> 22 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 22 Glu Ala Glu Val Arg Gln His Arg Glu Ala Arg Pro Ala Leu Leu 1 5 10 15 <210> 23 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 23 Arg Pro Ala Leu Leu Thr Ser Arg Leu Arg Phe Ile Pro Lys Pro 1 5 10 15 <210> 24 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 24 Leu Asp Asp Ile His Arg Ala Trp Arg Thr Phe Val Leu Arg Val 1 5 10 15 <210> 25 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 25 Phe Val Leu Arg Val Arg Ala Gln Asp Pro Pro Pro Glu Leu Tyr 1 5 10 15 <210> 26 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 26 Pro Gln Asp Arg Leu Thr Glu Val Ile Ala Ser Ile Ile Lys Pro 1 5 10 15 <210> 27 <211> 15 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 27 Lys Ser Val Trp Ser Lys Leu Gln Ser Ile Gly Ile Arg Gln His 1 5 10 15 <210> 28 <211> 16 <212> PRT <213> Artificial <220> <223> peptide derived from telomerase <400> 28 Leu Lys Arg Val Gln Leu Arg Glu Leu Ser Glu Ala Glu Val Arg Gln 1 5 10 15

Claims (3)

서열 번호 1 내지 28에 기재된 펩티드로 이루어진 군에서 선택된 하나 이상의 펩티드를 유효 성분으로 포함하는 염증성 질환 예방 또는 치료용 약학 조성물.
A pharmaceutical composition for preventing or treating inflammatory diseases comprising as an active ingredient at least one peptide selected from the group consisting of the peptides set forth in SEQ ID NOs: 1 to 28.
제 1 항에 있어서,
펩티드는 텔로머라제(telomerase)로부터 유래한 조성물.
The method of claim 1,
The peptide is a composition derived from telomerase.
제 1 항에 있어서,
조성물은 0.1 ㎍/㎎ 내지 1 ㎎/㎎ 함량의 펩티드를 포함하는 조성물.The method of claim 1,
The composition comprises a peptide in an amount of 0.1 μg / mg to 1 mg / mg.
KR1020120089167A 2012-07-20 2012-08-14 Composition for prevention or treatment of inflammation comprising telomerase peptide KR20140022699A (en)

Priority Applications (30)

Application Number Priority Date Filing Date Title
KR1020120089167A KR20140022699A (en) 2012-08-14 2012-08-14 Composition for prevention or treatment of inflammation comprising telomerase peptide
US14/400,322 US20150125438A1 (en) 2012-07-20 2013-03-05 Anti-Inflammatory Peptides and Composition Comprising the Same
CN201380038045.1A CN104470947B (en) 2012-07-20 2013-03-15 Anti-inflammatory peptide and composition comprising it
ES18187426T ES2871899T3 (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides and composition comprising them
EP21162575.1A EP3896078A1 (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides and composition comprising the same
PCT/EP2013/055326 WO2014012683A1 (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides and composition comprising the same
ES13709221T ES2693321T3 (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides and composition comprising the same
EP13709221.9A EP2875042B1 (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides and composition comprising the same
KR1020207019525A KR102302392B1 (en) 2012-07-20 2013-03-15 Anti-inflammatory Peptides and Composition comprising the same
JP2015521997A JP6352911B2 (en) 2012-07-20 2013-03-15 Peptide having anti-inflammatory activity and composition containing the same
EP18187426.4A EP3428182B1 (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides and composition comprising the same
KR1020147034319A KR20150031413A (en) 2012-07-20 2013-03-15 Anti-inflammatory Peptides and Composition comprising the same
CN201910110866.0A CN109777791B (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides, polynucleotides encoding same, and use thereof in preparing anti-inflammatory compositions and kits
CN202311502816.XA CN117551631A (en) 2012-07-20 2013-03-15 Anti-inflammatory peptides, polynucleotides encoding same, and use thereof in preparing anti-inflammatory compositions and kits
TW108101145A TWI700290B (en) 2012-07-20 2013-05-01 Anti-inflammatory peptides and composition comprising the same(1)
TW109115548A TWI779287B (en) 2012-07-20 2013-05-01 Anti-inflammatory peptides and composition comprising the same
TW111118818A TWI836435B (en) 2012-07-20 2013-05-01 Anti-inflammatory peptides and composition comprising the same
TW102115615A TWI658141B (en) 2012-07-20 2013-05-01 Anti-inflammatory peptides and composition comprising the same (1)
TW106121753A TWI647311B (en) 2012-07-20 2013-05-01 Anti-inflammatory peptide and its constituents (1)
US15/479,746 US20170275603A1 (en) 2012-07-20 2017-04-05 Anti-Inflammatory Peptides and Composition Comprising the Same
JP2017077422A JP6514259B2 (en) 2012-07-20 2017-04-10 Peptide having anti-inflammatory activity, and composition containing the same
US15/664,806 US20170327802A1 (en) 2012-07-20 2017-07-31 Anti-Inflammatory Peptides and Composition Comprising the Same
JP2019075635A JP6788062B2 (en) 2012-07-20 2019-04-11 Peptides with anti-inflammatory activity and compositions containing them
US16/746,018 US20200140832A1 (en) 2012-07-20 2020-01-17 Anti-inflammatory peptides and composition comprising the same
US16/818,001 US11098294B2 (en) 2012-07-20 2020-03-13 Anti-inflammatory peptides and composition comprising same
JP2020181780A JP7128246B2 (en) 2012-07-20 2020-10-29 Peptides with anti-inflammatory activity and compositions containing the same
US17/389,671 US11905536B2 (en) 2012-07-20 2021-07-30 Anti-inflammatory peptides and composition comprising the same
JP2022130519A JP7440581B2 (en) 2012-07-20 2022-08-18 Peptides with anti-inflammatory activity and compositions containing the same
US18/411,838 US20240158768A1 (en) 2012-07-20 2024-01-12 Anti-inflammatory peptides and composition comprising the same
JP2024021407A JP2024056904A (en) 2012-07-20 2024-02-15 Peptide having anti-inflammatory activity and composition containing same

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020120089167A KR20140022699A (en) 2012-08-14 2012-08-14 Composition for prevention or treatment of inflammation comprising telomerase peptide

Publications (1)

Publication Number Publication Date
KR20140022699A true KR20140022699A (en) 2014-02-25

Family

ID=50268566

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020120089167A KR20140022699A (en) 2012-07-20 2012-08-14 Composition for prevention or treatment of inflammation comprising telomerase peptide

Country Status (1)

Country Link
KR (1) KR20140022699A (en)

Similar Documents

Publication Publication Date Title
US11857607B2 (en) Anti-inflammatory peptides and composition comprising the same
JP6514259B2 (en) Peptide having anti-inflammatory activity, and composition containing the same
KR102038487B1 (en) Antimicrobial or antifungal composition comprising telomerase peptide
WO2004058791A3 (en) Substitution derivatives of n6-benzyladenosine, methods of their preparation, their use for preparation of drugs, cosmetic preparations and growth regulators, pharmaceutical preparations, cosmetic preparations and growth regulators containing these compounds
WO2004033418A3 (en) Sulfonylamino-acetic derivatives and their use as orexin receptor antagonists
DE69934308T2 (en) IL-6-ANTAGONIST PEPTIDE
ES2343586T3 (en) POLYPEPTIDES WITH ANTIMICROBIAL ACTIVITY AND POLINUCLEOTIDES THAT CODIFY THE SAME.
TW201206353A (en) Antimicrobial peptide variants and polynucleotides encoding same
JP2016525539A (en) Peptide for inhibiting osteoclast differentiation and use thereof
KR20160046639A (en) Composition for external application to the skin containing meso-2,3-butanediol as a preservative
CN106232810A (en) New treatment
WO2002024665A8 (en) Arylalkane-sulfonamides having endothelin-antagonist activity
KR20140022699A (en) Composition for prevention or treatment of inflammation comprising telomerase peptide
KR20160086864A (en) Peptide having anti-inflammatory activity and composition comprising same
KR20140022698A (en) Composition for prevention or treatment of inflammation comprising telomerase peptide
WO2006059304A3 (en) Novel lactame derivatives as renin inhibitors
EP3333180B1 (en) Anti-inflammatory peptides and composition comprising the same
US20140170108A1 (en) Compositions useful for the treatment of inflammatory disease or disorders
KR20190080814A (en) Recombinant fusion protein of BAF57 and uses thereof
MXPA02006250A (en) Butyne diol derivatives.
MY138502A (en) Novel alkansulfonamides as endothelin antagonists
CN112074529B (en) Peptides, compositions and methods for treating, preventing or ameliorating mood disorders
KR20220051081A (en) Composition for Antibacterial comprising peptide, Scolopendrasin-12 isolated from Scolopendra subspinipes mutilans
KR20220051077A (en) Composition for Antibacterial comprising peptide, Teleogryllusine-4 isolated from Teleogryllus emma
US20230192772A1 (en) Antimicrobial peptides and uses thereof