KR20100064161A - Immunogenic peptide specific for a north american type prrsv and use thereof - Google Patents

Immunogenic peptide specific for a north american type prrsv and use thereof Download PDF

Info

Publication number
KR20100064161A
KR20100064161A KR1020080122601A KR20080122601A KR20100064161A KR 20100064161 A KR20100064161 A KR 20100064161A KR 1020080122601 A KR1020080122601 A KR 1020080122601A KR 20080122601 A KR20080122601 A KR 20080122601A KR 20100064161 A KR20100064161 A KR 20100064161A
Authority
KR
South Korea
Prior art keywords
prrsv
pig
antibody
peptide
sample
Prior art date
Application number
KR1020080122601A
Other languages
Korean (ko)
Other versions
KR101101386B1 (en
Inventor
김태중
이재일
서자영
표효주
Original Assignee
전남대학교산학협력단
주식회사 바이오리쏘스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 전남대학교산학협력단, 주식회사 바이오리쏘스 filed Critical 전남대학교산학협력단
Priority to KR1020080122601A priority Critical patent/KR101101386B1/en
Publication of KR20100064161A publication Critical patent/KR20100064161A/en
Application granted granted Critical
Publication of KR101101386B1 publication Critical patent/KR101101386B1/en

Links

Images

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983Viruses
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/531Production of immunochemical test materials
    • G01N33/532Production of labelled immunochemicals
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/543Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
    • G01N33/54306Solid-phase reaction mechanisms
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/50Determining the risk of developing a disease

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Analytical Chemistry (AREA)
  • Cell Biology (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • General Physics & Mathematics (AREA)
  • Virology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

PURPOSE: An immunogenic peptide which is specific to North America type PRRSV(Porcine reproductive respiratory syndrome virus) is provided to effectively diagnose PRRSV infection. CONSTITUTION: A method for diagnosing infection of PRRSV(Porcine reproductive respiratory syndrome virus) in pig comprises: a step of contacting a sample containing PRRSV antibody to a peptide of sequence number 1; a step of contacting labeled anti-porcine antibody to the contacted resultant; and a step of measuring signal from the label. The sample is whole blood, serum, or plasma.

Description

북미형 PRRSV에 특이적인 면역원성 펩티드 및 그의 용도{Immunogenic peptide specific for a north American type PRRSV and use thereof}Immunogenic peptide specific for a north American type PRRSV and use etc}

본 발명은 PRRSV GP5 펩티드 항원을 이용하여 돼지생식기호흡기 증후군 바이러스 감염을 진단하는 방법에 관한 것이다. 항원성 당단백질 5 (glycoprotein 5: GP5) 중 면역원성이 높은 부위의 펩티드 항원을 이용하여 PRRSV 감염을 진단하는 방법에 관한 것이다. The present invention relates to a method for diagnosing porcine respiratory syndrome virus infection using the PRRSV GP5 peptide antigen. The present invention relates to a method for diagnosing PRRSV infection using a peptide antigen of a high immunogenic part in antigenic glycoprotein 5 (GP5).

돼지생식기호흡기증후군 바이러스 (Porcine reproductive respiratory syndrome virus: PRRSV)는 외피가 있는 단일가닥 양성 센스 RNA 바이러스로서, 니도비랄레스 (Nidovirales) 목, 아르테리비리다에 (Arteriviridae) 과, 아르테리바이러스 (Arterivirus) 속에 속한다. PRRSV는 최근 발생된 병원체로서, 모돈의 유산, 사산, 및 태아의 폐렴 및 형성 부전, 분만율 저하, 성장률 저하, 그 외 2차적인 세균 감염 및 모든 연령의 돼지에서 호흡기 질환을 유발하여, 국내 및 국외의 양돈 산업에 심각한 피해를 주고 있는 전염성 질병이다. 국내에서 1993년에 최초로 분리 및 보고된 PRRSV는 대식세포 내에서 선호적으로 증식한다. 그 발병 형태는 생식기형, 호흡기형, 및 혼합형으로서, 일차적으로 돼지에서 돼지로 전염되며, 분변, 요 (urine), 유 (milk)를 통해서 초유 항체가 수유되지 않은 새끼돼지에게 전염될 수 있고, 또한 주사바늘, 곤충 및 공기에 의한 전염될 수도 있다.Porcine reproductive respiratory syndrome virus (PRRSV) is an enveloped, single-strand-positive sense RNA virus, from the genus Nidovirales, Arteriviridae, and Arterivirus. Belong. PRRSV is a recently developed pathogen, which causes sows miscarriage, stillbirth, and pneumonia and dysplasia in fetuses, low birth rate, low growth rate, other secondary bacterial infections, and respiratory disease in pigs of all ages, both domestically and internationally. Is a contagious disease that has seriously affected pig industry. PRRSV, which was first isolated and reported in 1993 in Korea, preferentially proliferates in macrophages. Its onset forms are genital, respiratory, and mixed, primarily from pigs to pigs, and colostrum antibodies can be transmitted to pigs without lactation, through feces, urine, milk, It can also be transmitted by needles, insects and air.

PRRSV는 동시대에 지정학적 위치에 따라서 유전학적으로 매우 다양한 스트레인이 존재한다. 두 종류의 주요 유전자형은 유럽형 (genotype 1)과 북미형 (genotype 2)이 있으며, 이들은 게놈 수준 측면에 있어서 40%의 뉴클레오티드 상이성을 나타낸다. 우리나라에 주로 발생하고 있는 스트레인은 VR2332로 밝혀진 바 있다. 연구 결과에 따르면, 북미형 PRRSV가 한국 양돈가에 퍼진 이후 계속 진화하고 있어, 지정학적인 영향에 의해 PRRSV의 유전자의 변성이 발생한 것으로 예측되고 있다.PRRSV has a wide variety of genetically diverse strains, depending on the geopolitical location at the same time. The two main genotypes are European (genotype 1) and North American (genotype 2), which show 40% nucleotide differences in terms of genome level. The strain that occurs mainly in Korea has been found to be VR2332. According to the study, North American PRRSV has been evolving since it spread to Korean piglets, and it is predicted that genomic alteration of PRRSV gene is caused by geopolitical influence.

PRRSV의 전체 게놈 크기는 15kb이며, 하부게놈 mRNA가 서로 오버랩되어있는 9개의 해독틀 (open reading frame:ORF) (ORF 1a, 1b, 2a, 2b, 3-7)을 갖는다. ORF 1a와 1b는 복제 관련 비구조 단백질이고 ORF 2-7은 GP2a, GP2b, GP3, GP4, GP5, 막/매트릭스 (M) 단백질 및 뉴클레오캡시드 (N) 단백질로서 구조 단백질을 구성한다. 이 중 주요 구조 단백질은 N 단백질, M 단백질 및 일차 외피 (envelope) 당단백질인 GP5이다. 이 중 GP5 (ORF 5) 단백질은 감염시 숙주 내에서 중화 항체를 유도할 수 있는 것으로 알려진 가장 풍부하게 존재하는 단백질이다 (국내 특허공개번호 2008-0064813).The overall genome size of PRRSV is 15 kb and has 9 open reading frames (ORFs) (ORFs 1a, 1b, 2a, 2b, 3-7) with the lower genome mRNA overlapping each other. ORF 1a and 1b are replication related nonstructural proteins and ORF 2-7 constitute structural proteins as GP2a, GP2b, GP3, GP4, GP5, membrane / matrix (M) protein and nucleocapsid (N) protein. The major structural proteins are N protein, M protein and GP5, the primary envelope glycoprotein. Among them, GP5 (ORF 5) protein is the most abundant protein known to be able to induce neutralizing antibodies in the host during infection (Domestic Patent Publication No. 2008-0064813).

돼지는 PRRSV 감염 시 항체반응이 빠르게 일어나지만, 중화 항체의 합성은 속도가 느리며, 그 역가도 낮다. 이러한 점은 돼지 개체마다 다양하게 나타날 수 있으며, 감염된 돼지에서 항-GP5 중화 항체가 항-N 단백질 항체보다 훨씬 더 오래 지속된다. PRRSV 감염을 예방하기 위해 약독화된 백신 등이 개발되었으나, 그 효과가 다소 낮아, PRRSV의 감염은 성공적으로 제어되지 못하고 있다. 양돈장에서의 감염 예방 실패의 주요 원인은, 사용이 비교적 간편하면서 정확하고 민감한 PRRSV 감염 진단의 부족이다. Pigs have a rapid antibody response during PRRSV infection, but the synthesis of neutralizing antibodies is slow and their titers are low. This may vary from pig to pig, with anti-GP5 neutralizing antibodies lasting much longer than anti-N protein antibodies in infected pigs. Attenuated vaccines and the like have been developed to prevent PRRSV infection, but the effect is rather low, and PRRSV infection has not been successfully controlled. The main cause of infection prevention failure in pig farms is the lack of accurate and sensitive diagnosis of PRRSV infection, while being relatively simple to use.

현재 PRRSV 감염을 확인하기 위한 진단법으로는 종래의 바이러스 분리 동정 외에, 유전자 검출 방법인 역전사중합효소연쇄반응 (RT-PCR), 항체 검출 방법인 혈청 중화 분석시험 (SNA), 면역효소 단층법 (IPMA), 간접형광항체법 (IFA), 효소면역흡착법 (ELISA) 등이 있다. 이들 중, 가장 일반적으로 사용되는 것은 IFA로, IPMA와 더불어 매우 민감한 진단법으로 알려져 있다. 그러나 두 조직배양을 통해 항원을 준비해야 하고, 또한 배양된 바이러스를 정제하여 사용하여야 하므로 진단 준비가 용이하지 않다. 최근 개발된 진단 방법으로서, 국내 특허 출원 공개번호 제2008-0055792호는 PRRSV 바이러스를 인식하는 항체의 검출을 위한 진단 방법을 개시하고 있다. 또한 국제출원 WO 2006/091824호 및 국내 출원 공개번호 제2002-0015919 는 PRRSV에 기초한 단백질 또는 펩티드를 이용한 PRRSV에 대한 항체를 검출하는 방법을 개시하고 있으나, 민감도가 높고 효과적이면서 현장에서 신속하게 수행될 수 있는 PRRSV 감염의 진단 방법이 아직 요구되는 실정이다. Current diagnostic methods for identifying PRRSV infection include, in addition to conventional virus isolation, reverse transcription polymerase chain reaction (RT-PCR), a gene detection method, serum neutralization assay (SNA), and immunoenzyme tomography (IPMA). ), Indirect fluorescent antibody method (IFA) and enzyme immunosorbent method (ELISA). Of these, the most commonly used is IFA, which is known as a very sensitive diagnostic method along with IPMA. However, it is not easy to prepare the diagnosis because the antigen must be prepared through two tissue cultures, and the cultured virus must be purified and used. As a recently developed diagnostic method, Korean Patent Application Publication No. 2008-0055792 discloses a diagnostic method for detection of an antibody that recognizes a PRRSV virus. In addition, International Application WO 2006/091824 and Korean Patent Application Publication No. 2002-0015919 disclose a method for detecting an antibody against PRRSV using a protein or peptide based on PRRSV, but it is highly sensitive and effective and can be performed quickly in the field. There is still a need for a method of diagnosing possible PRRSV infection.

본 발명자들은 놀랍게도, PRRS 바이러스의 GP5 단백질 중에서 고항원성을 가지며 북미형 스트레인에 특이적인 중화부위를 선택하여, 이를 이용한 PRRSV의 감염 여부를 진단하는 방법을 발견하였으며, 이에 따라 돼지의 혈청과 같은 시료 내의 PRRSV GP5 단백질 항원에 대한 항체의 존재 여부를 결정함으로써 PRRSV의 감염 여 부를 보다 정확하게 진단하고자 하였다.The inventors have surprisingly found a method for diagnosing PRRSV infection by selecting a neutralizing region that is highly antigenic and specific to North American strains from the GP5 protein of the PRRS virus, and thus in a sample such as pig serum. By determining the presence of antibodies to the PRRSV GP5 protein antigen, we tried to diagnose PRRSV more accurately.

일 예시적 구체예는 돼지에서 PRRSV의 감염 여부를 효율적으로 진단하는 방법을 제공한다.One exemplary embodiment provides a method for efficiently diagnosing the infection of PRRSV in pigs.

다른 예시적 구체예는 시료 중의 PRRSV 항체의 존재를 효율적으로 검출하기 위한 키트를 제공한다.Another exemplary embodiment provides a kit for efficiently detecting the presence of PRRSV antibodies in a sample.

다른 예시적 구체예는 서열번호 1의 아미노산 서열을 갖는 분리된 펩티드를 제공한다.Another exemplary embodiment provides an isolated peptide having the amino acid sequence of SEQ ID NO: 1.

본 발명의 일 예시적 구체예는 고체 기판에 고정화된 서열번호 1의 펩티드에 항-돼지생식기호흡기 증후군 바이러스 (PRRSV) 항체를 포함하는 시료를 접촉시키는 단계; 상기 접촉 결과물에 검출가능한 표지로 표지된 항-돼지 항체를 접촉시키는 단계; 및 상기 표지로부터의 신호를 측정하는 단계를 포함하는, 돼지에서 PRRSV의 감염 여부를 진단하는 방법을 제공한다. One exemplary embodiment of the present invention comprises the steps of contacting a sample comprising an anti-Swine Respiratory Syndrome Virus (PRRSV) antibody to a peptide of SEQ ID NO: 1 immobilized on a solid substrate; Contacting the contact result with an anti-pig antibody labeled with a detectable label; And it provides a method for diagnosing the infection of PRRSV in pigs, comprising the step of measuring the signal from the label.

상기 방법은 고체 기판에 고정화된 서열번호 1의 펩티드에 항-돼지생식기호흡기 증후군 바이러스 (PRRSV) 항체를 포함하는 시료를 접촉시키는 단계를 포함한다. 상기 서열 번호 1의 펩티드는 PRRSV의 당단백질 5 (GP5)의 145-175번 아미노산 서열로 이루어진 군으로서, 북미형 PRRSV에 특이적인 면역원성 항원이다. 상기 서열 번호 1의 펩티드는 31 아미노산으로 구성된 것으로 북미형 PRRSV에 특이적인 면역원성 항원인 동시에, 그 길이가 짧기 때문에 시료 중의 북미형 PRRSV의 검출에 유용하게 사용될 수 있다. 따라서, 상기 PRRSV는 북미형 PRRSV인 것일 수 있다.The method comprises contacting a sample comprising an anti-Swine Respiratory Syndrome Virus (PRRSV) antibody to a peptide of SEQ ID NO: 1 immobilized on a solid substrate. The peptide of SEQ ID NO: 1 is a group consisting of amino acid sequences 145-175 of glycoprotein 5 (GP5) of PRRSV, and is an immunogenic antigen specific for North American type PRRSV. Since the peptide of SEQ ID NO: 1 is composed of 31 amino acids and is an immunogenic antigen specific for North American type PRRSV, and its length is short, it can be usefully used for detection of North American type PRRSV in a sample. Therefore, the PRRSV may be a North American type PRRSV.

상기 서열 번호 1의 펩티드는 유럽형 PRRSV와 북미형 PRRSV GP5 단백질의 항원성 및 친수성 영역을 분석하고, 서열이 서로 상이한 영역를 선택하는 단계를 포함하는 방법에 의하여 선발되었다. 항원성 및 친수성의 분석은 공지된 방법을 이용하여 수행될 수 있으며, 바람직하게는 항원성은 Hopp-Woods 법 (Hopp, T.P. and Woods, K.R. 1981, Proc. Natl. Acad. Sci., USA, 78, 3824-3828)에 따라 분석되고, 친수성은 Kyte-Doolittle법 (Kyte, J. and Doolittle, R. 1982,J. Mol. Bio. 157, 105-132)에 따라 분석될 수 있다. 상기 서열번호 1의 펩티드는 공지된 방법, 바람직하게는 펩티드 합성기를 이용하여 수행될 수 있다. The peptide of SEQ ID NO: 1 was selected by a method comprising analyzing the antigenic and hydrophilic regions of the European PRRSV and North American PRRSV GP5 proteins, and selecting regions having different sequences from each other. Analysis of antigenicity and hydrophilicity can be carried out using known methods, preferably antigenicity Hopp-Woods method (Hopp, TP and Woods, KR 1981, Proc. Natl. Acad. Sci., USA, 78, 3824-3828), and hydrophilicity can be analyzed according to the Kyte-Doolittle method (Kyte, J. and Doolittle, R. 1982, J. Mol. Bio. 157, 105-132). The peptide of SEQ ID NO: 1 may be carried out using a known method, preferably using a peptide synthesizer.

상기 고체 기판은 당업계에 알려진 임의의 기판일 수 있다. 예를 들면, 상기 기판은 실리콘, 유리, 또는 플라스틱으로 구성된 군으로부터 선택되는 것일 수 있다. 또한, 고체 기판은 임의의 모양, 예를 들면, 평판, 웰, 비드, 구형, 또는 다공성 물질의 형태일 수 있다. 또한, 상기 기판은 마이크로플레이트의 기판 또는 미세유동장치의 마이크로채널 또는 챔버의 내부면을 형성하는 것일 수 있다.The solid substrate can be any substrate known in the art. For example, the substrate may be selected from the group consisting of silicon, glass, or plastic. The solid substrate may also be in any shape, for example in the form of a plate, well, bead, spherical, or porous material. In addition, the substrate may be to form the inner surface of the microchannel substrate or the microchannel or chamber of the microfluidic device.

상기 접촉은 상기 시료, 예를 들면 액체 시료를 상기 펩티드가 고정화되어 있는 기판에 첨가함으로써 이루어질 수 있다. 상기 접촉이 이루어지는 액체 매질은 적절한 버퍼, 예를 들면, PBS와 같은 버퍼 중에서 이루어질 수 있다. 이러한 접촉은 당업자에 의하여 적절하게 선택될 수 있다. 상기 접촉 온도는 예를 들면, 상온 내지 45℃일 수 있으나, 이들 범위에 한정되는 것은 아니다. 상기 접촉에 의하여 시료 중의 항-PRRSV 항체는 상기 펩티드에 결합하여 항-PRRSV 항체-펩티드 복합체 를 형성한다. 상기 PRRSV 항체는 항-GP5 항체, 예를 들면, 서열번호 1의 펩티드에 결합하는 항체일 수 있다. 상기 시료는 전혈, 혈청 및 혈장으로부터 선택되는 것일 수 있다.The contact can be made by adding the sample, for example a liquid sample, to the substrate on which the peptide is immobilized. The liquid medium in which the contact is made may be made in a suitable buffer, for example a buffer such as PBS. Such contact may be appropriately selected by those skilled in the art. The contact temperature may be, for example, room temperature to 45 ° C., but is not limited thereto. The contact results in the anti-PRRSV antibody in the sample binding to the peptide to form an anti-PRRSV antibody-peptide complex. The PRRSV antibody may be an anti-GP5 antibody, eg, an antibody that binds to the peptide of SEQ ID NO: 1. The sample may be selected from whole blood, serum and plasma.

상기 접촉 단계 후에 세척하는 단계를 더 포함할 수 있다. 상기 세척단계는 상기 펩티드와 결합하지 않은 시료 중의 물질 또는 비특이적으로 상기 펩티드와 결합된 물질을 제거하는 세척액을 사용하여 이루어질 수 있다. 예를 들면, 상기 세척액은 적당한 계면활성제, 예를들면 TWEENTM을 포함하는 버퍼, 예를 들면 PBS 버퍼일 수 있다. The method may further include washing after the contacting step. The washing step may be performed using a washing solution which removes a substance in a sample that does not bind the peptide or a substance that is not specifically bound to the peptide. For example, the wash may be a buffer containing a suitable surfactant, eg TWEEN , for example PBS buffer.

상기 방법은 또한 상기 접촉 결과물에 검출가능한 표지로 표지된 항-돼지 항체를 접촉시키는 단계를 포함한다. 상기 접촉은 표지된 항-돼지 항체를 포함하는 액체를 상기 접촉 결과물에 첨가하고 배양함으로써 이루어질 수 있다. 상기 접촉 조건 및 시간은 당업자가 적절하게 선택할 수 있다. The method also includes contacting the contact result with an anti-pig antibody labeled with a detectable label. The contact can be made by adding and culturing a liquid comprising a labeled anti-pig antibody to the contact result. The contact conditions and time can be appropriately selected by those skilled in the art.

상기 검출가능한 표지는 당업계에 알려져 있다. 예를 들면, 상기 상기 검출가능한 표지는 형광물질, 방사성 물질, 및 기질을 광신호를 내는 물질로 전환시키는 반응을 촉매하는 효소일 수 있다. 상기 효소는 호스래디쉬 퍼옥시다제 (HRP), 알칼리 포스파타제 (AP) 또는 베타-갈락토시다제인 것일 수 있다. 상기 기질은 TMB, ABTS 또는 X-gal일 수 있다. 상기 형광물질은 Cy3, 또는 Cy5일 수 있다. 상기 효고가 접합된 항-돼지 항체는 또한 상업적으로 구입할 수 있다. 상기 항-돼지 항체는 항-돼지 IgG, 항-돼지 IgM,항-돼지 IgE,항-돼지 IgA 또는 항-돼지 IgE인 것일 수 있다.Such detectable labels are known in the art. For example, the detectable label can be an enzyme that catalyzes the reaction of converting the fluorescent material, radioactive material, and substrate into a light emitting material. The enzyme may be horseradish peroxidase (HRP), alkaline phosphatase (AP) or beta-galactosidase. The substrate can be TMB, ABTS or X-gal. The fluorescent material may be Cy3 or Cy5. The Hyogo conjugated anti-pig antibody can also be purchased commercially. The anti-pig antibody may be anti-pig IgG, anti-pig IgM, anti-pig IgE, anti-pig IgA or anti-pig IgE.

표지로 표지된 항-돼지 항체를 접촉시키는 단계 후에, 세척하는 단계를 더 포함할 수 있다. 상기 세척은 상기 항-돼지 항체 용액 중의 결합하지 않은 물질 또는 비특이적으로 상기 펩티드와 항-PRRSV 항체 복합체에 결합된 물질을 제거하는 세척액을 사용하여 이루어질 수 있다. 예를 들면, 상기 세척액은 적당한 계면활성제, 예를들면 TWEENTM을 포함하는 버퍼, 예를 들면 PBS 버퍼일 수 있다.After contacting the anti-pig antibody labeled with the label, the method may further include washing. The washing can be accomplished using a wash solution which removes unbound material or nonspecifically bound material to the peptide and anti-PRRSV antibody complex in the anti-pig antibody solution. For example, the wash may be a buffer containing a suitable surfactant, eg TWEEN , for example PBS buffer.

상기 방법은 또한, 상기 표지로부터의 신호를 측정하는 단계를 포함한다. 상기 신호는 광 신호, 예를 들면 흡광도, 투과도, 또는 형광일 수 있다. 광신호의 파장은 선택되는 표지에 따라 당업자가에 적절하게 선택할 수 있다. The method also includes measuring a signal from the label. The signal may be an optical signal, for example absorbance, transmittance, or fluorescence. The wavelength of the optical signal can be appropriately selected by those skilled in the art according to the label selected.

상기 신호 측정의 결과, 시료에서 측정된 광 신호가 음성 대조군에 비하여 유의하게 높게 나오는 경우, 시료 중에 항-PRRSV 항체가 존재하는 것으로 결정할 수 있다. 상기 유의한 수준은 양성 대조군으로부터 나오는 신호를 참조하여 적절하게 설정할 수 있다.As a result of the signal measurement, when the optical signal measured in the sample is significantly higher than the negative control, it can be determined that the anti-PRRSV antibody is present in the sample. The significant level can be appropriately set with reference to the signal from the positive control.

본 발명의 다른 구체예는, 서열번호 1의 펩티드 및 검출가능한 표지로 표지된 항-돼지 항체를 포함하는, 시료 중의 PRRSV 항체의 존재를 검출하기 위한 키트 를 제공한다. Another embodiment of the present invention provides a kit for detecting the presence of a PRRSV antibody in a sample comprising the peptide of SEQ ID NO: 1 and an anti-pig antibody labeled with a detectable label.

상기 서열번호 1의 펩티드, 검출가능한 표지, 항-돼지 항체, 및 PRRSV에 대하여는 상기한 바와 같다. The peptide of SEQ ID NO: 1, the detectable label, the anti-swine antibody, and the PRRSV are as described above.

본 발명의 다른 예시적 구체예는, 서열번호 1의 아미노산 서열을 갖는 분리된 펩티드를 제공한다. 상기 펩티는 북미형 PRRSV에 특이적으로 존재하며, 면역원성을 가지고 있어, 북미형 PRRSV를 특이적으로 검출하는데 사용될 수 있다. Another exemplary embodiment of the invention provides an isolated peptide having the amino acid sequence of SEQ ID NO: 1. The peptide is specifically present in North American PRRSV and has immunogenicity, and thus can be used to specifically detect North American PRRSV.

본 발명의 다른 예시적 구체예는, 서열번호 1의 아미노산 서열을 갖는 분리된 펩티드가 고정화된 기판을 갖는 마이크로어레이 또는 마이크로플레이트를 제공한다. Another exemplary embodiment of the present invention provides a microarray or microplate having a substrate to which an isolated peptide having the amino acid sequence of SEQ ID NO: 1 is immobilized.

일 예시적 구체예에 따르면, 돼지에서 PRRSV의 감염 여부를 효율적으로 진단하는 방법을 제공한다.According to one exemplary embodiment, a method for efficiently diagnosing the infection of PRRSV in a pig is provided.

다른 예시적 구체예에 따르면, 시료 중의 PRRSV 항체의 존재를 효율적으로 검출하기 위한 키트를 제공한다.According to another exemplary embodiment, a kit is provided for efficiently detecting the presence of a PRRSV antibody in a sample.

다른 예시적 구체예에 따르면, 서열번호 1의 아미노산 서열을 갖는 분리된 펩티드는 PRRSV 항체의 존재를 효율적으로 검출하는데 사용될 수 있다. According to another exemplary embodiment, an isolated peptide having the amino acid sequence of SEQ ID NO: 1 can be used to efficiently detect the presence of a PRRSV antibody.

이하 본 발명을 실시예를 통하여 상세하게 설명한다. 그러나, 이들 실시예는 본 발명을 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다. Hereinafter, the present invention will be described in detail through examples. However, these examples are for illustrative purposes only and the scope of the present invention is not limited to these examples.

실시예 1: PRRSV의 GP5 항원성 및 소수성 분석Example 1: GP5 Antigenicity and Hydrophobicity Analysis of PRRSV

북미형 (VR2332) 및 유럽형 PRRSV GP5 단백질에 대하여, 항원성을 Hopp-Woods 법을 이용하여 분석하고, 소수성을 Kyte-Doolittle 법을 이용하여 분석하였다. 그 결과를 도 1에 나타내었다. 상기 결과를 기초로 하여 두 종의 항원성 및 친수성 패턴을 비교하였다. 도 1에 따르면, 145번째부터 175번째 아미노산 부분이 북미형과 유럽형 사이에서 아미노산 서열도 상이하면서 친수성 및 항원성이 높게 나타나, 이 부분을 본 발명의 펩티드 항원으로 선택하고, 하기 표 1과 같이 합성된 펩티드를 준비하였다 (Anygen, Korea). 도 1에 있어서, 148 내지 184번 영역은 본원의 펩티드 항원이 선택된 고항원성-친수성 부위를 나타낸다.For North American (VR2332) and European PRRSV GP5 proteins, antigenicity was analyzed using Hopp-Woods method and hydrophobicity was analyzed using Kyte-Doolittle method. The results are shown in FIG. Based on the results, two antigenic and hydrophilic patterns were compared. According to Figure 1, the amino acid sequence of the 145th to 175th amino acid portion is different between the North American type and the European type, the hydrophilicity and antigenicity is high, this part is selected as the peptide antigen of the present invention, synthesized as shown in Table 1 below Prepared peptides (Anygen, Korea). In Figure 1, regions 148 to 184 represent the high antigenic-hydrophilic sites where the peptide antigens of the present application are selected.

표 1. 선택된 PRRSV GP5 고항원성-친수성 부위Table 1. Selected PRRSV GP5 high antigenic-hydrophilic sites

아미노산 서열Amino acid sequence 아미노산 위치Amino acid position LLDTKGGLYRWRSPVIIEKRGKVEVEGHLIDLLDTKGGLYRWRSPVIIEKRGKVEVEGHLID 145-175번째145-175

실시예 2: 비교실험을 위한 중화항체부위 펩티드 항원 준비Example 2 Neutralizing Site Peptide Antigen Preparation for Comparative Experiments

기존의 연구보고에 의하면 PRRSV GP5에는 중화항체부위가 존재하는 것으로 알려져 있다. 이 부위는 엑토도메인 (ectodomain) 또는 중화부위라 한다. 본 발명의 대조군으로서 위 중화항체 부위를 아래 표 2와 같이 준비하였다. Previous studies have reported that neutralizing antibody sites exist in PRRSV GP5. This site is called the ectodomain or neutralization site. The neutralizing antibody site was prepared as shown in Table 2 below as a control of the present invention.

표 2. 본 발명에서 대조군으로 이용된 PRRSV GP5 중화항체 부위 Table 2. PRRSV GP5 neutralizing antibody sites used as controls in the present invention

아미노산 서열Amino acid sequence 아미노산 위치Amino acid position SHLQLIYNLSHLQLIYNL 37-45번째37-45th

실시예 3: 양성 대조군으로서의 HerdCheck PRRS 바이러스 항체 테스트 키트를 이용한 실험Example 3: Experiment with HerdCheck PRRS Virus Antibody Test Kit as Positive Control

본 실험에 대한 대조군으로서 ELISA 키트 (Herdcheck® PRRSV 항체 키트, IDEXX Laboratories, 미국)를 이용한 혈청 검사는 제조사의 지시에 준하여 실시하였다. 실험 후 측정된 OD 값에 대해 S/P (Sample/Positive Control mean: 시료/양성 대조군 평균) 값이 0.4보다 작으면 그 혈청은 음성이고, 0.4보다 크거나 같으면 양성으로 판단하였다. 이 값을 이용하여 본원의 펩티드 항원에서 얻은 ELISA 결과를 이용하여 민감도 및 특이도를 계산하였다. ELISA를 실시한 결과 실험군의 항체가는 0.853±0.519로 나타났고 S/P 비율로 보면 1.633±1.15로 나타났다. 위 결과로 보면 총 258개 시료 중에 양성개체는 209개로서, 81%의 자연 감염률을 보였다. Serum tests using an ELISA kit (Herdcheck® PRRSV Antibody Kit, IDEXX Laboratories, USA) as a control for this experiment were performed according to the manufacturer's instructions. When the S / P (Sample / Positive Control mean) value was less than 0.4 for the OD value measured after the experiment, the serum was negative. This value was used to calculate sensitivity and specificity using the ELISA results obtained from the peptide antigens of the present application. The result of ELISA showed that the antibody titer of the experimental group was 0.853 ± 0.519 and 1.633 ± 1.15 by S / P ratio. According to the above results, 209 positive individuals out of a total of 258 samples showed a natural infection rate of 81%.

실시예 4: PRRSV의 GP5 펩티드 항원을 이용한 혈청 진단 (ELISA)Example 4: Serum Diagnosis with GP5 Peptide Antigen of PRRSV (ELISA)

실시예 1에서 준비된 본 발명의 펩티드 항원을 이용하여 ELISA 분석을 실시하였다. 즉, 상기 펩티드 항원을 PBS를 이용하여 10㎍/ml가 되도록 희석하고 96-웰 플레이트 (Maxisorp™, Nunc, Denmark)에 100㎕/웰의 농도로 코팅하였다. 이 플레이트는 1% 탈지유를 첨가한 PBS로 1시간 동안 차단하고 PBST (PBS + 0.05% Tween- 20, pH 7.4)로 3-4회 세척하였다. ELISA analysis was performed using the peptide antigen of the present invention prepared in Example 1. That is, the peptide antigen was diluted to 10 µg / ml with PBS and coated at a concentration of 100 µl / well in 96-well plates (Maxisorp ™, Nunc, Denmark). The plate was blocked for 1 hour with PBS with 1% skim milk and washed 3-4 times with PBST (PBS + 0.05% Tween-20, pH 7.4).

진단을 위한 돼지 시료 (1차 항체액)로는 PRRSV 백신을 접종하지 않은 21개 농장에서 무작위로 선택된 258개의 돼지 혈청을 사용하였다. 양성 대조군으로는 백신투여로 PRRSV에 대한 항체가 형성된 것으로 확인된 5마리의 돼지를 사용하였고 음성 대조군으로는 PRRSV에 감염되지 않은 (PRRSV-free) 모돈으로부터 출산된 10마리의 초유 급이 이전의 자돈의 혈청을 사용하였다. As porcine samples (primary antibody solution) for diagnosis, 258 pig serum randomly selected from 21 farms without PRRSV vaccine were used. As a positive control, 5 pigs whose vaccine had been identified as having antibodies to PRRSV were used. As a negative control, 10 colostrums born from PRRSV-free sows were used for the previous piglets. Serum was used.

상기 돼지에서 수득한 1차 항체액을 PBS로 희석하고 총 90㎕를 웰에 첨가하여 37℃에서 1시간 동안 반응 후 PBST로 3회 세척하고, 다시 1:500으로 희석된 HRP-접합된 염소 항-돼지 IgG (Serotec, UK)를 2차 항체로 사용하여 반응시켰다. 역시 2차 항체도 37℃에서 1시간 동안 반응시킨 후, PBST로 3회 세척하였다. 결합된 2차 항체의 검출은 기질 용액 [100mM 구연산 완충액, pH 4.0, 10ml, ABTS 원액 (4.5ml 증류수 중의 ABTS 100mg) 250㎕, H2O2 50㎕]을 사용하여 발색을 실시하였다. 기질 용액과의 반응은 암실에서 10분 간 수행하였고 흡광도 405nm에서 ELISA 판독기 (Multiskan EX, Thermo LabSystems, Beverly, MA)를 이용하여 OD 값을 측정하였다. 측정된 OD 값은 평균값±표준편차 (SD)로 표기하였고 값들은 스튜던트 t-테스트를 통해 통계적 유의성 검사를 실시하였다.The primary antibody solution obtained from the pigs was diluted with PBS and a total of 90 μl was added to the wells, followed by reaction at 37 ° C. for 1 hour, washed three times with PBST, and further diluted 1: 500 with HRP-conjugated goat antiserum. Pig IgG (Serotec, UK) was used as the secondary antibody and reacted. The secondary antibody was also reacted at 37 ° C. for 1 hour and then washed three times with PBST. Detection of bound secondary antibody was performed using a substrate solution [100 mM citric acid buffer, pH 4.0, 10 ml, 250 µl of ABTS stock solution (ABTS 100 mg in 4.5 ml distilled water), 50 µl of H 2 O 2 ]. The reaction with the substrate solution was carried out in the dark for 10 minutes and the OD value was measured using an ELISA reader (Multiskan EX, Thermo LabSystems, Beverly, MA) at absorbance 405 nm. The measured OD values were expressed as mean ± standard deviation (SD) and the values were statistically tested by Student's t-test.

결 과result

21개 농장에서 무작위로 선택된 260개의 돼지 혈청을 이용하여 ELISA를 실시한 결과, 각각의 대조군인 중화항체부위 펩티드 (37-45번 아미노산 : 서열번호 2) 항원을 이용한 ELISA에서는 PRRSV 감염에 따른 항원에 대한 항체가는 높지 않거나 유도되지 않는 것으로 나타났다 (표 3). 그러나 본 발명에 따른 서열번호 1의 펩티드는 매우 높은 민감도 (86.6%)를 보였으며, 이는 혈청진단에 이용되는 항원으로써 매우 적합한 것으로 결론지어졌다. 민감도는 통계학적으로 대조군에 비해 나타내는 수치로 진양성/(진양성+가음성)을 의미한다. 진양성이란 두 실험 모두에서 양성으로 나타낸 것을 나타내고, 가음성이란 한쪽에만 음성으로 나타낸 것을 나타낸다. ELISA was performed on 260 pigs randomly selected from 21 farms. As a result, ELISA using the neutralizing antibody peptide (amino acids 37-45: SEQ ID NO: 2) as the control group was performed. Antibody titers were found not to be high or induced (Table 3). However, the peptide of SEQ ID NO: 1 according to the present invention showed very high sensitivity (86.6%), which was concluded to be very suitable as an antigen used for serum diagnosis. Sensitivity is statistically represented as compared to the control group means true positive / (true positive + negative). True positive indicates positive in both experiments and false negative indicates negative on only one side.

표 3. 본원의 펩티드 항원을 이용한 혈청진단 (ELISA) 결과 및 ELISA 키트와의 비교를 통한 민감도와 특이도 분석Table 3. Sensitivity and Specificity Analysis by Serum Diagnosis (ELISA) Results Using the Peptide Antigens of the Application and Comparison with ELISA Kits

항원antigen ELISA 키트ELISA kit 중화항체부위
(37-45번: 서열번호2)
Chinese Antibody Site
(37-45 SEQ ID NO: 2)
본원의 펩티드 항원
(실시예1)
Peptide Antigens herein
Example 1
양성positivity 209209 8383 208208 음성voice 4949 175175 5050 진양성Jinyangseong 7474 181181 위양성False positive 99 2727 위음성False negative 135135 2828 진음성True voice 4040 2222 민감도responsiveness 35.4135.41 86.6086.60 특이도Specificity 81.6381.63 44.9044.90

특이도는 진음성/(진응성+가양성)으로 나타낸다. 본 실시예의 결과를 보면 중화항체 부위를 이용한 실험에서 175개 즉, 거의 대부분이 음성으로 나타났기 때문에, ELISA 키트에서 찾아낸 음성과 겹치는 시료가 많아 둘다 음성인 진응성이 많아진 것처럼 되어서 특이도 (확인 요망)가 높아진 것이다. 또한, ELISA 키트는 항원이 GP7, 즉 "N" 단백질이고 본원은 항원 GP5이기 때문에 특이도는 차이가 있을 수 있다. 그러나, 진단에 있어서 중요한 것은 진양성을 검출하는 효율에 관한 민감도이다. Specificity is expressed as true negative / (responsive + positive). Since looking at the example results in the embodiment 175 in the experiment using a neutralizing antibody region that is, almost always appeared negative, the negative overlap with the sample found in the ELISA kit specific lot be as both widening the negative jineung property also (Please confirm) Is higher. In addition, the ELISA kits may differ in specificity because the antigen is GP7, ie the "N" protein and the antigen is GP5. However, what is important in the diagnosis is the sensitivity regarding the efficiency of detecting true positives.

상기 결과를 통해, 본 발명에 따른 PRRSV GP5 고항원성 부위를 포함하는 펩티드를 이용한 PRRSV 감염 진단 방법은, 우리나라의 유전자형에 특이적인 북미형 바이러스에 대한 감염을 종래 기술에 비해 정확하고 간편하게 탐지할 수 있음이 밝혀졌다.Through the above results, the method for diagnosing PRRSV infection using a peptide comprising a PRRSV GP5 high antigenic site according to the present invention can accurately and easily detect infection with a genotype-specific North American virus compared to the prior art. Turned out.

도 1은 북미형 (A) 및 유럽형 (B) PRRSV GP5의 항원성 (Hopp-Woods법) 및 소수성 분석 (Kyte-Doolittle법)을 나타낸 도면이다. 1 shows antigenicity (Hopp-Woods method) and hydrophobicity analysis (Kyte-Doolittle method) of North American type (A) and European type (B) PRRSV GP5.

<110> Industry Foundation of Chonnam National University <120> Immunogenic peptide specific for a north American type PRRSV and use thereof <130> PN081134 <160> 2 <170> KopatentIn 1.71 <210> 1 <211> 31 <212> PRT <213> Arteriviridae arterivirus <220> <221> PEPTIDE <222> (1) <223> PRRSV GP5 145-175 <400> 1 Leu Leu Asp Thr Lys Gly Gly Leu Tyr Arg Trp Arg Ser Pro Val Ile 1 5 10 15 Ile Glu Lys Arg Gly Lys Val Glu Val Glu Gly His Leu Ile Asp 20 25 30 <210> 2 <211> 9 <212> PRT <213> Arteriviridae arterivirus <220> <221> PEPTIDE <222> (2) <223> PRRSV GP5 37-45 <400> 2 Ser His Leu Gln Leu Ile Tyr Asn Leu 1 5 <110> Industry Foundation of Chonnam National University <120> Immunogenic peptide specific for a north American type PRRSV and use <130> PN081134 <160> 2 <170> KopatentIn 1.71 <210> 1 <211> 31 <212> PRT <213> Arteriviridae arterivirus <220> <221> PEPTIDE <222> (1) <223> PRRSV GP5 145-175 <400> 1 Leu Leu Asp Thr Lys Gly Gly Leu Tyr Arg Trp Arg Ser Pro Val Ile   1 5 10 15 Ile Glu Lys Arg Gly Lys Val Glu Val Glu Gly His Leu Ile Asp              20 25 30 <210> 2 <211> 9 <212> PRT <213> Arteriviridae arterivirus <220> <221> PEPTIDE <222> (2) <223> PRRSV GP5 37-45 <400> 2 Ser His Leu Gln Leu Ile Tyr Asn Leu   1 5  

Claims (12)

고체 기판에 고정화된 서열번호 1의 펩티드에 항-돼지생식기호흡기 증후군 바이러스 (PRRSV) 항체를 포함하는 시료를 접촉시키는 단계; Contacting a sample comprising an anti-Swine Respiratory Syndrome Virus (PRRSV) antibody to a peptide of SEQ ID NO: 1 immobilized on a solid substrate; 상기 접촉 결과물에 검출가능한 표지로 표지된 항-돼지 항체를 접촉시키는 단계; 및Contacting the contact result with an anti-pig antibody labeled with a detectable label; And 상기 표지로부터의 신호를 측정하는 단계를 포함하는, 돼지에서 PRRSV의 감염 여부를 진단하는 방법. A method for diagnosing infection of PRRSV in a pig, comprising measuring a signal from the label. 제1항에 있어서, 상기 시료는 전혈, 혈청 및 혈장으로부터 선택되는 것인 방법. The method of claim 1, wherein the sample is selected from whole blood, serum, and plasma. 제1항에 있어서, 상기 검출가능한 표지는 형광물질, 방사성 물질, 및 기질을 광신호를 내는 물질로 전환시키는 반응을 촉매하는 효소인 것인 방법.The method of claim 1, wherein the detectable label is an enzyme that catalyzes the reaction to convert the fluorescent material, radioactive material, and substrate into an optical signal generating material. 제3항에 있어서, 상기 효소는 호스래디쉬 퍼옥시다제 (HRP) 또는 알칼리 포스파타제 (AP)인 것인 방법.The method of claim 3, wherein the enzyme is horseradish peroxidase (HRP) or alkaline phosphatase (AP). 제1항에 있어서, 상기 항-돼지 항체는 항-돼지 IgG, 항-돼지 IgM,항-돼지 IgE,항-돼지 IgA 또는 항-돼지 IgE인 것인 방법. The method of claim 1, wherein the anti-pig antibody is anti-pig IgG, anti-pig IgM, anti-pig IgE, anti-pig IgA or anti-pig IgE. 제1항에 있어서, 상기 PRRSV는 북미형 PRRSV인 것인 방법.The method of claim 1, wherein the PRRSV is a North American PRRSV. 서열번호 1의 펩티드 및 검출가능한 표지로 표지된 항-돼지 항체를 포함하는, 시료 중의 PRRSV 항체의 존재를 검출하기 위한 키트.A kit for detecting the presence of a PRRSV antibody in a sample comprising the peptide of SEQ ID NO: 1 and an anti-pig antibody labeled with a detectable label. 제7항에 있어서, 상기 검출가능한 표지는 형광물질, 방사성 물질, 및 기질을 광신호를 내는 물질로 전환시키는 반응을 촉매하는 효소인 것인 키트.8. The kit of claim 7, wherein the detectable label is an enzyme that catalyzes the reaction to convert the fluorescent material, radioactive material, and substrate into an optical signal generating material. 제8항에 있어서, 상기 효소는 호스래디쉬 퍼옥시다제 (HRP) 또는 알칼리 포스파타제 (AP)인 것인 키트.The kit of claim 8, wherein the enzyme is horseradish peroxidase (HRP) or alkaline phosphatase (AP). 제8항에 있어서, 상기 항-돼지 항체는 항-돼지 IgG, 항-돼지 IgM,항-돼지 IgE,항-돼지 IgA 또는 항-돼지 IgE인 것인 방법. The method of claim 8, wherein the anti-pig antibody is anti-pig IgG, anti-pig IgM, anti-pig IgE, anti-pig IgA or anti-pig IgE. 제8항에 있어서, 상기 PRRSV는 북미형 PRRSV인 것인 방법.The method of claim 8, wherein the PRRSV is a North American PRRSV. 서열번호 1의 아미노산 서열을 갖는 분리된 펩티드.An isolated peptide having the amino acid sequence of SEQ ID NO.
KR1020080122601A 2008-12-04 2008-12-04 Immunogenic peptide specific for a north American type PRRSV and use thereof KR101101386B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020080122601A KR101101386B1 (en) 2008-12-04 2008-12-04 Immunogenic peptide specific for a north American type PRRSV and use thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020080122601A KR101101386B1 (en) 2008-12-04 2008-12-04 Immunogenic peptide specific for a north American type PRRSV and use thereof

Publications (2)

Publication Number Publication Date
KR20100064161A true KR20100064161A (en) 2010-06-14
KR101101386B1 KR101101386B1 (en) 2012-01-02

Family

ID=42363881

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020080122601A KR101101386B1 (en) 2008-12-04 2008-12-04 Immunogenic peptide specific for a north American type PRRSV and use thereof

Country Status (1)

Country Link
KR (1) KR101101386B1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103336114A (en) * 2013-06-28 2013-10-02 无锡同心塑料制品有限公司 ELISA (Enzyme Linked Immuno-Sorbent Assay) kit for detecting porcine reproductive and respiratory syndrome
KR20190023604A (en) * 2017-08-29 2019-03-08 주식회사 옵티팜 A combination vaccine based on virus like particle

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ATE365746T1 (en) * 1997-05-06 2007-07-15 Boehringer Ingelheim Vetmed PRRSV ANTIGENS BASED ON PEPTIDE SEQUENCES OF THE PRRS VIRUS FOR USE AS VACCINES AND FOR DIAGNOSTIC TESTS
CN101184997B (en) * 2005-02-25 2017-06-13 艾德克斯实验室公司 Peptide for detecting antibody to porcine reproductive respiratory syndrome virus
US7241582B2 (en) * 2005-07-05 2007-07-10 Mj Biologics, Inc. Diagnostic test kits
JP2009506129A (en) * 2005-08-30 2009-02-12 ボード・オブ・リージエンツ・オブ・ザ・ユニバーシテイ・オブ・ネブラスカ Methods and compositions for vaccination of animals with PRRSV antigens having improved immunogenicity

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN103336114A (en) * 2013-06-28 2013-10-02 无锡同心塑料制品有限公司 ELISA (Enzyme Linked Immuno-Sorbent Assay) kit for detecting porcine reproductive and respiratory syndrome
KR20190023604A (en) * 2017-08-29 2019-03-08 주식회사 옵티팜 A combination vaccine based on virus like particle

Also Published As

Publication number Publication date
KR101101386B1 (en) 2012-01-02

Similar Documents

Publication Publication Date Title
Lin et al. Antigenic relationships among porcine epidemic diarrhea virus and transmissible gastroenteritis virus strains
TWI392735B (en) Hybridoma cell line producing monoclonal antibodies against the foot-and-mouth disease virus, the monoclonal antibodies therefrom, and reagent and elisa kit comprising the same
US10520506B2 (en) Method for the detection and classification of PRRSV-infections in swine herds and diagnostic antigen compositions for such methods
JP6383422B2 (en) Improved diagnostic test for CSFV antibodies
KR20080055791A (en) Method for the preparation of prrs virus and proteins of and diagnostic test kits for detecting them
WO2012163263A1 (en) Reagents and methods for prrsv detection
US9291624B2 (en) Vaccine diagnostics
Chang et al. Development and comparison of enzyme-linked immunosorbent assays based on recombinant trimeric full-length and truncated spike proteins for detecting antibodies against porcine epidemic diarrhea virus
EP1745291B1 (en) Detection of west nile virus
Lei et al. Specific recombinant proteins of porcine epidemic diarrhea virus are immunogenic, revealing their potential use as diagnostic markers
Kumar et al. Development of single dilution immunoassay to detect E2 protein specific classical swine fever virus antibody
KR101101386B1 (en) Immunogenic peptide specific for a north American type PRRSV and use thereof
Go et al. Development of a fluorescent-microsphere immunoassay for detection of antibodies specific to equine arteritis virus and comparison with the virus neutralization test
Chen et al. Cross-reactivities and cross-neutralization of different envelope glycoproteins E2 antibodies against different genotypes of classical swine fever virus
Pyo et al. Serodiagnosis of porcine reproductive and respiratory syndrome virus infection with the use of glycoprotein 5 antigens
KR20100031369A (en) Rapid diagnostic kit of hemorrhagic fever with renal syndrome detecting specific igm and igg using nucleocapsid protein derived from soochong virus
Mahmoodi et al. Simple Indirect Enzyme-Linked Immunosorbent Assay to Detect Antibodies Against Bovine Viral Diarrhea Virus, Based on Prokaryotically Expressed Recombinant MBP-NS3 Protein
Cai et al. Detection of asymptomatic antigenemia in pigs infected by porcine reproductive and respiratory syndrome virus (PRRSV) by a novel capture immunoassay with monoclonal antibodies against the nucleocapsid protein of PRRSV
KR102485291B1 (en) Detection kit for PEDV-specific IgA comprising recombinant spike protein of PEDV
KR20170041956A (en) Rapid Kit for Diagnosing the specific antibodies against European type Porcine Respiratory Reproductive Syndrome Virus
Chiou et al. Chia-Yu Chang1, 2, Ju-Yi Peng1, Yun-Han Cheng2, Yen-Chen Chang1, 2, Yen-Tse Wu2, Pei-Shiue Tsai2
CN117050196A (en) Chimeric antigen of Porcine Reproductive and Respiratory Syndrome Virus (PRRSV) and application thereof
NZ621257B2 (en) Improved vaccine diagnostics

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant
FPAY Annual fee payment

Payment date: 20141223

Year of fee payment: 4

FPAY Annual fee payment

Payment date: 20160111

Year of fee payment: 5

FPAY Annual fee payment

Payment date: 20170308

Year of fee payment: 6

LAPS Lapse due to unpaid annual fee