KR20050121721A - Improved heat shock protein-based vaccines and immunotherapies - Google Patents
Improved heat shock protein-based vaccines and immunotherapies Download PDFInfo
- Publication number
- KR20050121721A KR20050121721A KR1020057019351A KR20057019351A KR20050121721A KR 20050121721 A KR20050121721 A KR 20050121721A KR 1020057019351 A KR1020057019351 A KR 1020057019351A KR 20057019351 A KR20057019351 A KR 20057019351A KR 20050121721 A KR20050121721 A KR 20050121721A
- Authority
- KR
- South Korea
- Prior art keywords
- seq
- leu
- trp
- arg
- phe
- Prior art date
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6043—Heat shock proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
- A61K2039/622—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier non-covalent binding
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
본 출원은 2004년 2월 12일 출원된 미국 특허 출원번호 10/776, 521 및 2004년 2월 13일 출원된 PCT 특허 출원번호 PCT/US04/04340에 대한 우선권 주장 출원이고 여기에 그들은 레퍼런스로 삽입되었다. 이 출원은 또한 2003년 4월 11일 출원된 가 출원 번호 60/462,469; 2003년 4월 18일 출원된 출원 번호 60/463,746; 및 2003년 9월 16일 출원된 출원 번호 60/503,417에 대한 35U. S. C. 119 (e)하의 우선권 주장 출원이고 세 건 모두는 레퍼런스로 삽입되었다.This application is a priority claims application for US Patent Application Nos. 10/776, 521, filed February 12, 2004, and PCT Patent Application No. PCT / US04 / 04340, filed February 13, 2004, where they are incorporated by reference. It became. This application also discloses Provisional Application No. 60 / 462,469, filed April 11, 2003; Application No. 60 / 463,746, filed April 18, 2003; And 35U to Application No. 60 / 503,417, filed September 16, 2003. A priority claim under S. C. 119 (e), all three of which are incorporated by reference.
본 발명은 대상에서 면역 반응을 유도하는 방법 및 조성물에 관한 것이고, 여기서 대상은 유효량의 적어도 하나 이상의 정해진 하이브리드 항원 및 선택적으로 하나 이상의 열 충격 단백질들과 결합하여 투여된다. 이 방법들 및 조성물들은 감염성 질환 및 종양의 치료에 사용될 수 있다.The present invention relates to methods and compositions for inducing an immune response in a subject, wherein the subject is administered in combination with an effective amount of at least one defined hybrid antigen and optionally one or more heat shock proteins. These methods and compositions can be used to treat infectious diseases and tumors.
열 충격 단백질은 갑작스런 온도의 상승에 노출된 포유류 세포들에서 증가된 양 발현되는 것으로 초기에 관찰되었고 반면에 대부분의 세포 단백질들은 상당하게 감소된다. 그러한 단백질들은 포도당 결핍과 같은 여러 타입의 스트레스에 대하여 생성되는 것으로 결정되었다. 여기서 "열 충격 단백질"이란 용어는 그러한 표지된 단백질뿐 아니라 항시적(즉 스트레스가 없는 조건에서도)으로 발현되는 그러한 단백질들의 동족체를 포함하는 다른 스트레스 단백질 모두를 포함하여 사용될 것이다. 열 충격 단백질들의 예들은 BiP(또는 grp78로 명명), hsp70, hsc70, gp96(grp94), hsp60, hsp40 및 hsp90을 포함한다. Heat shock proteins were initially observed to have increased amounts of expression in mammalian cells exposed to sudden rises in temperature, while most cellular proteins are significantly reduced. Such proteins have been determined to be produced for several types of stress, such as glucose deficiency. The term "heat shock protein" will be used herein to include both such labeled proteins as well as other stress proteins, including homologues of such proteins that are expressed at all times (ie, even in stress-free conditions). Examples of heat shock proteins include BiP (or named grp78), hsp70, hsc70, gp96 (grp94), hsp60, hsp40 and hsp90.
열 충격 단백질들은 비-자연 상태에서 다른 단백질, 특히 리보좀으로부터 나오거나 소포체로 밀어들어가는 초기 단백질에 결합하는 능력을 가진다. Hendrick 와 Hartl, Ann. Rev. Biochem. 62: 349-384 (1993); Hartl, Nature 381 : 571-580 (1996). 게다가 열 충격 단백질들은 원형질, 소포체 및 미토콘드리아에서 단백질의 올바른 겹침과 결합에 중요한 역할을 하는 것을 나타낸다.; 이 기능의 면에서 그들은 "분자쉐프런"으로 명명된다 Frydman 등, Nature 370: 111-117(1994) ;Hendrick andHartl,Ann. Rev. Biochem. 62: 349-384 (1993); Hartl, Nature 381: 571-580 (1996). Heat shock proteins have the ability to bind to other proteins in the non-natural state, especially early proteins coming out of ribosomes or pushing into the endoplasmic reticulum. Hendrick and Hartl, Ann. Rev. Biochem. 62: 349-384 (1993); Hartl, Nature 381: 571-580 (1996). In addition, heat shock proteins have been shown to play an important role in proper overlapping and binding of proteins in plasma, endoplasmic reticulum and mitochondria; In terms of this function they are named "molecular chefs" Frydman et al., Nature 370: 111-117 (1994); Henrick and Hartl, Ann. Rev. Biochem. 62: 349-384 (1993); Hartl, Nature 381: 571-580 (1996).
예를 들어 hsp79 게열의 열 충격 단백질 군의 일원인 BiP 단백질은 소포체에서 경쇄와 결합하기 전에 새로 합성된 비겹침 μ 이뮤노글로빈 중쇄에 결합하는 것이 발견되었다. Hendershot 등, J. Cell Biol. 104: 761-767 (1987). 다른 열 ㅊ추충격 단백질인 gp96은 소포체에 위치하는 hsp90 계열의 스트레스 단백질의 일원이다. Li 와 Srivastava, EMBO J. 12: 3143-3151 (1993); Mazzarella와 Green,J. Biol. Cltem. 262: 8875-8883 (1987). gp96은 소포체에서 복합-단위체 단백질들의 결합을 지원하는 것을 알려졌다. Wiech 등, Nature 358: 169-170 (1992). For example, the BiP protein, a member of the family of heat shock proteins in the hsp79 sequence, was found to bind to the newly synthesized nonoverlapping μ immunoglobin heavy chain before binding to the light chain in the endoplasmic reticulum. Hendershot et al., J. Cell Biol. 104: 761-767 (1987). Another thermal shock protein, gp96, is a member of the hsp90 family of stress proteins located in the endoplasmic reticulum. Li and Srivastava, EMBO J. 12: 3143-3151 (1993); Mazzarella and Green, J. Biol. Cltem. 262: 8875-8883 (1987). gp96 is known to support the binding of complex-unit proteins in endoplasmic reticulum. Wiech et al., Nature 358: 169-170 (1992).
실험 동물들의 종양들에서 제조된 열 충격 단백질들은 종양 특이적 형태의 면역 반응을 유도할 수 있다고 관찰되었다; 즉 특정 종양에서 정제된 열 충격 단백질은 다른 종양이 아니라 같은 종양의 성장을 저해할 수 있는 실험 동물에서 면역 반응을 유도할 수 있다. Srivastava와 Maki, Curr. Topics Microbiol. 167: 109-123 (1991). 열 충격 단백질들을 코딩하는 유전자들은 종양 특이적 DNA 다형성을 나타내는 것이 발견되지 않았다. Srivastava와 Udono, Curr. Opin. Immunol. 6: 728-732 (1994). 고 해상 겔 전기영동은 gp96이 분자 수준에서 이종성일 수 있다는 것을 나타낸다. Feldweg와 Srivastava, Int. J. Cancer 63: 310-314 (1995). 증거들은 이종성의 근원이 수백의 수일 수 있는 열 충격 단백질에 붙어있는 작은 펩타이드들의 군일 수 있다는 것을 제안한다. Id. 종양 합성된 열 충격 단백질들에 붙어 있는 넓은 다양한 펩타이드들은 그들의 효과에서 다소 HLA-제한적일 수 있는 더 전통적인 면역원에 비하여 그러한 단백질들이 다양한 HLA 표현형을 가지는 대상에서 면역 반응들을 유도할 수 있게 할 수 있다. Id.It has been observed that heat shock proteins produced in tumors of experimental animals can induce tumor-specific forms of immune responses; In other words, the heat shock protein purified from a particular tumor can induce an immune response in experimental animals that can inhibit the growth of the same tumor rather than another tumor. Srivastava and Maki, Curr. Topics Microbiol. 167: 109-123 (1991). Genes encoding heat shock proteins were not found to exhibit tumor specific DNA polymorphism. Srivastava and Udono, Curr. Opin. Immunol. 6: 728-732 (1994). High resolution gel electrophoresis indicates that gp96 can be heterogeneous at the molecular level. Feldweg and Srivastava, Int. J. Cancer 63: 310-314 (1995). Evidence suggests that the source of heterogeneity can be a group of small peptides attached to a heat shock protein, which can be hundreds of numbers. Id. The wide variety of peptides attached to tumor synthesized heat shock proteins can enable such proteins to elicit immune responses in subjects with various HLA phenotypes, as compared to more traditional immunogens, which may be somewhat HLA-limited in their effects. Id.
Nieland 등(Proe.Natl. Acad. Sci. U. S. A. 93: 6135-6139 (1996))은 VSV-감염된 세포들에 의하여 생성된 gp96에 결합된 세포독성 T 림프구(CTL) 수포성 입안염 바이러스(VSV)에피토프를 포함하는 항원 펩타이드를 동정하였다.Neiland의 방법들은 gp96에 결합될 수 있는 부가적인 펩타이드들이나 다른 화합물들의 동정을 방해하였고 따라서 gp96에 결합된 고 분자량의 물질을 더 규명할 수 없었고 고압 액체 크로마토그래피로 검출하였다.Nieland et al. (Proe. Natl. Acad. Sci. USA 93: 6135-6139 (1996)) describe cytotoxic T lymphocyte (CTL) vesicular otitis virus (VSV) bound to gp96 produced by VSV-infected cells. Antigenic peptides containing epitopes were identified. Neiland's methods interfered with the identification of additional peptides or other compounds capable of binding to gp96 and thus were unable to further identify high molecular weight materials bound to gp96 and high pressure liquid chromatography. Was detected.
글루타알데하이드 고정된 마이코박테리아 hsp65 또는 hsp70에 화학적으로 교차 결합된 다수의 반복 NANP (Asp Ala Asp Pro) 말라리아 항원을 포함하는 ㅎ하합성 펩타이드들은 어느 부가된 어쥬번트 없이도 마우스에서 항체 형성(즉 체액성 반응)을 유도할 수 있다는 것이 보고되었고; 유사한 효과는 대장균 박테리아로부터 온 열 충격 단백질릉 사용하여 관찰되었다. Del Guidice,Experientia 50: 1061- 1066 (1994); Barrios 등, Clin. Exp.Imnzunol. 98: 224-228 (1994); Barrios 등, Eur. J. Immunol. 22: 1365-1372 (1992). 열 충격 단백질에 합성 펩타이드의 교차 결합 및 가능한 글루타알데하이드 고정화는 항체 유도에 필요하였다. Barrios 등, Cliva. Exp. Imznunol. 98: 229-233. Synthetic peptides comprising multiple repeat NANPs (Asp Ala Asp Pro) malaria antigens that are chemically crosslinked to glutaaldehyde immobilized mycobacterial hsp65 or hsp70 can form antibodies (ie humoral response) in mice without any added adjuvant. Have been reported; Similar effects were observed using heat shock proteins from Escherichia coli bacteria. Del Guidice, Experientia 50: 1061-1066 (1994); Barrios et al., Clin. Exp. Imnzunol. 98: 224-228 (1994); Barrios et al., Eur. J. Immunol. 22: 1365-1372 (1992). Cross linking of synthetic peptides and possible glutaaldehyde immobilization to heat shock proteins was required for antibody induction. Barrios et al., Cliva. Exp. Imznunol. 98: 229-233.
PCT/US96/13363는 열 충격 단백질과 복합체에서 항원에 대한 면역 반응들을 유도하고 따라서 종양 또는 감염성 질환들의 치료에 유용한항원 도메인과 열 충격 단백질 결합 도메인을 가지는 하이브리드 항원이 기재되어 있다. PCT/US98/22335는 면역 반응을 유도하기 위하여 단독으로 투여되는 하이브리드 항원에 대한 능력뿐 아니라 유사한 용도를 위하여 부가적인 열 충격 단백질 결합 도메인들이 기재된다. 하이브리드 항원에서 적어도 하나의 항원 도메인과 적어도 하나의 열 충격 단백질 결합 도메인 사이에 존재하는 펩타이드 링커에서의 개량은 생물학적 활성을 증가한다는 것이 현재 발견되었다. 이 증가는 또한 하이브리드 항원의 항원 부분에 대한 면역 반응 유도의 증가를 제공하는 것으로 알려졌다. 열 충격 단백질을 포함하거나 포함하지 않는 이 개량된 펩타이드 링커들 그것을 포함하는 하이브리드 펩타이드들 및 그들의 용도들이 본 발명에서 제공된다.PCT / US96 / 13363 describes hybrid antigens having antigenic and heat shock protein binding domains which induce immune responses to antigens in complex with heat shock proteins and are thus useful for the treatment of tumors or infectious diseases. PCT / US98 / 22335 describes additional heat shock protein binding domains for similar uses as well as the ability for hybrid antigens to be administered alone to induce an immune response. It has now been found that improvements in peptide linkers present between at least one antigen domain and at least one heat shock protein binding domain in hybrid antigens increase biological activity. This increase is also known to provide an increase in the induction of immune responses to the antigenic portion of the hybrid antigen. Improved Peptide Linkers With or Without Heat Shock Protein Hybrid peptides comprising them and their uses are provided herein.
도 1은 하이브리드 항원 또는 열 충격 단백질과 하이브리드 항원 복합체ㄹ르를 사용하여 면역화를 수행하고 7일 후 상기 항원을 발현하는 종양으로 챌리지를 수행한 종양 챌린지 연구의 결과를 나타낸다.1 shows the results of a tumor challenge study in which immunization was carried out using hybrid antigens or heat shock proteins and hybrid antigen complexes and challenged with tumors expressing the antigens 7 days later.
발명의 요약Summary of the Invention
본 발명은 대상에서 면역 반응을 유도하는 방법 및 조성물에 관한 것이고, 여기서 선택적으로 열 충격 단백질과 복합체에서의 적어도 하나의 하이브리드 항원은 대상에 투여된다. 그 하이브리드 항원은 적어도 하나의 항원 도메인 및 적어도 하나의 열 충격 단백질 결합 도메인 및 그 사이에 적어도 하나의 펩타이드 링커를 포함한다. 감염성 질환 또는 종양과 같은 질환과 관련된 항원에 대한 면역 반응의 유도는 그 질환의 치료에 유용하다. 하이브리드 항원의 항원성 또는 면역성 도메인은 전체 단백질 또는 펩타이드 항원일 수 있거나 선택된 항원의 단지 일부, 예를 들어 항원의 선택된 에피토프일 수 있다. 열 충격 단백질 결합 도메인은 열 충격 단백질에 결합하는 펩타이드, 바람직하게는 열 충격 단백질에 결합하는 7-15 아미노산의 펩타이드, 더욱 바람직하게는 열 충격 단백질에 결합하는 소수성 펩타이드이고 가장 바람직하게는 열 충격 단백질에 결합하는 7-15 아미노산의 소수성 펩타이드이다. 상기 링커는 Phe Phe Arg Lys (FFRK; 서열 번호: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, 서열 번호: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, 서열 번호: 1003); Phe Arg (FR),Gln Leu Lys (QLK),Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL;서열 번호:1001) ; Lys Asn(KN) ; Arg Lys (RK); 또는 AA1-AA2-AA3-루신 중 하나이고, 여기서 AA1은 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S이고, 가장 바람직하게는 A; AA2는 K, V, 또는 E, 바람직하게는 E, 더욱 바람직하게는 V이고 가장 바람직하게는 K;이며 AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S이고 가장 바람직하게는 V이다. 상기에서, Gln Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu(AKVL ; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열 번호: 1000)이 가장 바람직하다.The present invention relates to methods and compositions for inducing an immune response in a subject, wherein optionally at least one hybrid antigen in complex with a heat shock protein is administered to the subject. The hybrid antigen comprises at least one antigen domain and at least one heat shock protein binding domain with at least one peptide linker therebetween. Induction of an immune response to an antigen associated with a disease such as an infectious disease or a tumor is useful for the treatment of that disease. The antigenic or immunological domain of the hybrid antigen may be a whole protein or peptide antigen or only a portion of the selected antigen, for example a selected epitope of the antigen. The heat shock protein binding domain is a peptide that binds to a heat shock protein, preferably a peptide of 7-15 amino acids that binds to a heat shock protein, more preferably a hydrophobic peptide that binds to a heat shock protein and most preferably a heat shock protein. It is a hydrophobic peptide of 7-15 amino acids that binds to. The linker is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A; AA 2 is K, V, or E, preferably E, more preferably V and most preferably K; and AA 3 is V, S, F, K, A, E, or T, preferably F More preferably S and most preferably V. In the above, Gln Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred.
본 발명은 열 충격 단백질/하이브리드 항원 조성물 뿐아니라 그러한 하이브리드 항원 단독으로 투여하는 방법을 제공하고 후자는 (i) 열 충격 단백질에 ㅎ하하이브리드 항원의 결합이 하이브리드 항원/열 충격 단백질 복합체를 형성하는 ㅈ조건에서 인 비트로 하나 이상의 하이브리드 항원들과 하나 이상의 열 충격 단백질을 결합하고; (ii) 열 충격 단백질에 결합된 상기 하이브리드 항원을 그러한 치료가 필요한 대상에 유효량 투여하는 것을 포함한다. The present invention provides a method of administering such a hybrid antigen alone as well as a heat shock protein / hybrid antigen composition, the latter of which (i) the binding of the hybrid antigen to the heat shock protein to form a hybrid antigen / heat shock protein complex In vitro combining one or more hybrid antigens with one or more heat shock proteins; (ii) administering an effective amount of said hybrid antigen bound to a heat shock protein to a subject in need of such treatment.
또한 열 충격 단백질과 선택적으로 결합된 하이브리드 항원은 선택적으로 열 충격 단백질을 코딩하는 핵산과 함께 하이브리드 항원을 코딩하는 핵산을 대상에 투여하여 대상에 투입할 수 있다.In addition, the hybrid antigen selectively bound to the heat shock protein may be introduced into the subject by administering to the subject a nucleic acid encoding the hybrid antigen, together with a nucleic acid encoding the heat shock protein.
따라서 첫번째 면에서 본 발명은 감염체 또는 종양 항원의 하나의 항원 도메인, 열 충격 단백질에 비공유적으로 결합하는 하나의 결합 도메인 및 항원 도메인 및 상기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 하이브리드 항원을 제공하고, 여기서 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK; 서열번호: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn (RKN) ; Phe Phe Arg Lys Asn (FFRKN, 서열번호: 1003); Phe Arg (FR), Gin Leu Lys (QLK),Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; 서열번호:1001) ; Lys Asn (KN); Arg Lys (RK); 또는 AAl-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T더욱 바람직하게는 S, 가장 바람직하게는 A이고, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다.Thus, in a first aspect, the present invention is directed to a hybrid antigen comprising essentially one antigen domain of an infectious or tumor antigen, one binding domain that binds non-covalently to a heat shock protein, and an antigen domain and a peptide linker that separates the binding domain. Wherein the peptide linker comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gin Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, more preferably S, most preferably A, preferably F, more preferably S, most preferably V. . Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred.
두 번째 면에서, 본 발명은 하나 이상의 감염체 또는 하나 이상의 종양 항원의 복수 개의 항원 도메인, 열 충격 단백질에 비공유적으로 결합하는 적어도 하나의 결합 도메인 및 상기 항원 도메인 및 상기 결합 도메인을 분리하는 적어도 하나의 펩타이드 링커를 필수적으로 포함하는 하이브리드 항원을 제공하고, 여기서 상기 적어도 하나의 펩타이드 링커는 Phe Phe Arg Lys (FFRK; 서열번호: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn (RKN) ; Phe Phe Arg Lys Asn (FFRKN, 서열번호: 1003); Phe Arg (FR), Gin Leu Lys (QLK), Gin Leu Glu (QLE), Ala Lys Val Leu (AKVL; 서열번호: 1001) ; Lys Asn (KN); Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 특정 실시예에서 상기 하이브리드 항원에서 항원성 도메인 중 적어도 하나는 T 헬퍼 에피토프이다.In a second aspect, the invention provides a plurality of antigenic domains of one or more infectious agents or one or more tumor antigens, at least one binding domain that covalently binds to a heat shock protein, and at least one that separates the antigenic domain and the binding domain. A hybrid antigen is provided that essentially comprises a peptide linker of wherein the at least one peptide linker comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gin Leu Lys (QLK), Gin Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In certain embodiments at least one of the antigenic domains in the hybrid antigen is a T helper epitope.
세 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 항원 도메인, 열 충격 단백질에 비공유적으로 결합하는 결합 도메인 및 그 사이의 적어도 하나의 펩타이드 링커를 포함하는 적어도 하나의 하이브리드 항원을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 조성물을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 특정 실시예에서 상기 조성물은 복수개의 하이브리드 항원을 포함할 수 있고, 하나의 하이브리드 항원은 T 헬퍼 에피토프를 포함할 수 있다.In a third aspect, the invention provides an infectious disease comprising an antigenic domain of an infectious or tumor antigen, a binding domain that covalently binds to a heat shock protein, and at least one hybrid antigen comprising at least one peptide linker therebetween. Or provides a composition for inducing an immune response against a tumor antigen, wherein at least one of said peptide linkers is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In certain embodiments the composition may comprise a plurality of hybrid antigens, and one hybrid antigen may comprise a T helper epitope.
네 번째 측면에서, 본 발명은 하나 이상의 감염체 또는 하나 이상의 종양 항원의 복수 개의 항원 도메인, 열 충격 단백질에 비공유적으로 결합하는 적어도 하나의 결합 도메인 및 그 사이의 적어도 하나의 펩타이드 링커를 포함하는 하이브리드 항원을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 특정 실시예에서 적어도 하나의 항원성 도메인은 T 헬퍼 에피토프이다.상기 하이브리드 항원은 상기 항원성 도메인 및 상기 결합 도메인을 분리하는 펩타이드 링커를 가진다.In a fourth aspect, the invention provides a hybrid comprising a plurality of antigenic domains of one or more infectious agents or one or more tumor antigens, at least one binding domain that covalently binds to a heat shock protein, and at least one peptide linker therebetween. Providing an antigen, wherein at least one said peptide linker is selected from the group consisting of Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In certain embodiments at least one antigenic domain is a T helper epitope. The hybrid antigen has a peptide linker that separates the antigenic domain and the binding domain.
다섯 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 항원 도메인, 열 충격 단백질에 비공유적으로 결합하는 결합 도메인 및 그 사이의 적어도 하나의 펩타이드 링커를 포함하는 적어도 하나의 하이브리드 항원을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 조성물을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 특정 실시예에서 상기 조성물은 복수개의 하이브리드 항원을 포함할 수 있고, 하나의 하이브리드 항원은 T 헬퍼 에피토프를 포함할 수 있다.In a fifth aspect, the present invention provides an infectious disease comprising at least one hybrid antigen comprising an antigenic domain of an infectious or tumor antigen, a binding domain that covalently binds to a heat shock protein, and at least one peptide linker therebetween. Or provides a composition for inducing an immune response against a tumor antigen, wherein at least one of said peptide linkers is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In certain embodiments the composition may comprise a plurality of hybrid antigens, and one hybrid antigen may comprise a T helper epitope.
여섯 번째 측면에서, 본 발명은 감염체 또는 종양 항원으로부터 유래한 적어도 하나의 복수 개의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 적어도 하나의 결합 도메인 및 그 사이의 적어도 하나의 펩타이드 링커를 포함하는 적어도 하나의 하이브리드 항원을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 조성물을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다.In a sixth aspect, the invention includes at least one plurality of antigenic domains derived from an infectious or tumor antigen, at least one binding domain that covalently binds to a heat shock protein, and at least one peptide linker therebetween. Providing a composition for inducing an immune response to an infectious disease or tumor antigen comprising at least one hybrid antigen, wherein at least one said peptide linker comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred.
일곱 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 결합 도메인 및 상기 항원성 도메인 및 상기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 적어도 하나의 하이브리드 항원을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 조성물을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 조성물은 복수 개의 하이브리드 항원들을 포함한다. 또 다른 측면에서 적어도 하나의 복수 개의 하이브리드 항원들은 T 헬퍼 에피토프를 포함한다.In a seventh aspect, the invention provides at least one comprising essentially an antigenic domain of an infectious or tumor antigen, a binding domain that covalently binds to a heat shock protein, and a peptide linker that separates the antigenic domain and the binding domain A composition for inducing an immune response to an infectious disease or tumor antigen comprising a hybrid antigen of: wherein at least one said peptide linker is selected from Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the composition comprises a plurality of hybrid antigens. In another aspect the at least one plurality of hybrid antigens comprises a T helper epitope.
여덟 번째 측면에서, 본 발명은 감염체 또는 종양 항원으로부터 유래한 적어도 하나의 복수 개의 항원 도메인, 열 충격 단백질에 비공유적으로 결합하는 적어도 하나의 결합 도메인 및 상기 항원성 도메인 및 상기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 적어도 하나의 하이브리드 항원을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 조성물을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 적어도 하나의 항원성 도메인은 T 헬퍼 에피토프를 포함할 수 있다.In an eighth aspect, the present invention provides a method for separating at least one antigen domain derived from an infectious or tumor antigen, at least one binding domain that covalently binds to a heat shock protein, and separating the antigenic domain and the binding domain. Provided are compositions that induce an immune response against an infectious disease or tumor antigen comprising at least one hybrid antigen essentially comprising a peptide linker, wherein the at least one peptide linker comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. One at least one antigenic domain may comprise a T helper epitope.
아홉 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 펩타이드를 포함하는 적어도 하나의 결합 도메인 및 그 사이의 펩타이드 링커를 포함하는 하이브리드 항원 및 열 충격 단백질의 복합체를 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 일 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프일 수 있다. 또 다른 실시예에서 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함하는 복합체이다. 본 발명의 다른 실시예에서 상기 열 충격 단백질은 hsp70이다.In a ninth aspect, the invention provides a hybrid antigen comprising at least one antigenic domain of an infectious or tumor antigen, at least one binding domain comprising a peptide that covalently binds a heat shock protein, and a peptide linker therebetween. And inducing an immune response to an infectious disease or tumor antigen comprising administering to the subject a complex of heat shock proteins, wherein the at least one peptide linker comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000). ); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In one embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen may comprise a plurality of antigenic domains and at least one antigenic domain may be a T helper epitope. In another embodiment is a complex comprising a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains. In another embodiment of the invention the heat shock protein is hsp70.
열 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 하나의 결합 도메인 및 그 항원성 도메인 및 사기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 하이브리드 항원 및 열 충격 단백질의 복합체를 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 일 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다. 본 발명의 바람직한 실시예에서 상기 열 충격 단백질은 hsp70이다.In a tenth aspect, the present invention requires at least one antigenic domain of an infectious or tumor antigen, one binding domain that covalently binds to a heat shock protein, and a peptide linker that separates the antigenic and fraudulent binding domains thereof. A method of inducing an immune response to an infectious disease or tumor antigen comprising administering to a subject a complex of a hybrid antigen and a heat shock protein, wherein the at least one peptide linker is Phe Phe Arg Lys (FFRK). SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In one embodiment at least one hybrid antigen is a T helper epitope. In another embodiment said hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains. In a preferred embodiment of the invention the heat shock protein is hsp70.
열한 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 펩타이드를 포함하는 적어도 하나의 결합 도메인 및 그 사이에 펩타이드 링커를 포함하는 적어도 하나의 하이브리드 항원을 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 또 다른 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다. 본 발명의 또 다른 실시예에서 펩타이드 링커는 상기 항원 도메인과 상기 결합 도메인을 분리한다.In an eleventh aspect, the invention provides at least one antigenic domain of an infectious or tumor antigen, at least one binding domain comprising a peptide that covalently binds to a heat shock protein, and at least one comprising a peptide linker therebetween. A method of inducing an immune response to an infectious disease or tumor antigen comprising administering a hybrid antigen of to a subject, wherein at least one of the peptide linkers comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In another embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains. In another embodiment of the invention the peptide linker separates the antigenic domain from the binding domain.
열두 번째 측면에서, 본 발명은 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 펩타이드를 포함하는 하나의 결합 도메인 및 상기 항원성 도메인과 상기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 적어도 하나의 하이브리드 항원을 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 또 다른 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다.In a twelfth aspect, the present invention provides a method for separating at least one antigenic domain of an infectious or tumor antigen, one binding domain comprising a peptide that covalently binds to a heat shock protein, and separating the antigenic domain from the binding domain. A method of inducing an immune response to an infectious disease or tumor antigen comprising administering to a subject at least one hybrid antigen essentially comprising a peptide linker, wherein the at least one peptide linker comprises Phe Phe Arg Lys ( FFRK: SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In another embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains.
열세 번째 측면에서, 본 발명은 감염성 질환 또는 종양과 관련된 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 펩타이드를 포함하는 하나의 결합 도메인 및 그 사이에 펩타이드 링커를 필수적으로 포함하는 하이브리드 항원 및 열 충격 단백질 복합체를 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 치료 방법을 제공하고, 여기서 상기 하이브리드 항원과 상기 열 충격 단백질은 비공유적으로 결합되고, 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 또 다른 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다. 본 발명의 일 실시예에서 펩타이드 링커는 상기 항원성 도메인과 상기 결합 도메인을 분리한다. 본 발명의 바람직한 실시예에서 상기 열 충격 단백질은 hsp70이다.In a thirteenth aspect, the present invention provides a peptide linker between at least one antigenic domain of an infectious disease or tumor antigen associated with an infectious disease or tumor, one binding domain comprising a peptide that covalently binds to a heat shock protein, and a peptide linker therebetween. A method of treating an infectious disease or a tumor antigen comprising administering to a subject a hybrid antigen and a heat shock protein complex comprising essentially, wherein said hybrid antigen and said heat shock protein are non-covalently bound, at least One such peptide linker is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In another embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains. In one embodiment of the invention the peptide linker separates the antigenic domain from the binding domain. In a preferred embodiment of the invention the heat shock protein is hsp70.
열네 번째 측면에서, 본 발명은 감염성 질환 또는 종양과 관련된 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 적어도 하나의 결합 도메인 및 상기 항원성 도메인과 상기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 하이브리드 항원 및 열 충격 단백질 복합체를 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 치료 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 또 다른 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다. 본 발명의 일 실시예에서 펩타이드 링커는 상기 항원성 도메인과 상기 결합 도메인을 분리한다. 본 발명의 바람직한 실시예에서 상기 열 충격 단백질은 hsp70이다.In a fourteenth aspect, the present invention provides at least one antigenic domain of an infectious disease or tumor antigen associated with an infectious disease or tumor, at least one binding domain that covalently binds to a heat shock protein, and the antigenic domain and the binding domain Provided is a method for treating an infectious disease or tumor antigen comprising administering to a subject a hybrid antigen and a heat shock protein complex essentially comprising a peptide linker that separates the peptide linker, wherein the at least one peptide linker is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In another embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains. In one embodiment of the invention the peptide linker separates the antigenic domain from the binding domain. In a preferred embodiment of the invention the heat shock protein is hsp70.
열다섯 번째 측면에서, 본 발명은 감염성 질환 또는 종양과 관련된 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 펩타이드를 포함하는 하나의 결합 도메인 및 그 사이에 펩타이드 링커를 포함하는 적어도 하나의 하이브리드 항원을 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 치료 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 또 다른 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다. 본 발명의 일 실시예에서 펩타이드 링커는 상기 항원성 도메인과 상기 결합 도메인을 분리한다.In a fifteenth aspect, the present invention provides a peptide comprising at least one antigenic domain of an infectious disease or tumor antigen associated with an infectious disease or tumor, one binding domain comprising a peptide that covalently binds to a heat shock protein, and a peptide therebetween. A method of treating an infectious disease or tumor antigen comprising administering to a subject at least one hybrid antigen comprising a linker, wherein the at least one peptide linker comprises Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) ; Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In another embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains. In one embodiment of the invention the peptide linker separates the antigenic domain from the binding domain.
열여섯 번째 측면에서, 본 발명은 감염성 질환 또는 종양과 관련된 감염체 또는 종양 항원의 적어도 하나의 항원성 도메인, 열 충격 단백질에 비공유적으로 결합하는 펩타이드를 포함하는 하나의 결합 도메인 및 상기 항원성 도메인 및 상기 결합 도메인을 분리하는 펩타이드 링커를 필수적으로 포함하는 적어도 하나의 하이브리드 항원을 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 치료 방법을 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E, 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다. 일 실시예에서 상기 복합체는 복수 개의 하이브리드 항원을 포함한다. 또 다른 실시예에서 적어도 하나의 하이브리드 항원은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 하이브리드 항원은 복수 개의 항원성 도메인들을 포함하고 적어도 하나의 항원성 도메인들은 T 헬퍼 에피토프이다. 또 다른 실시예에서 상기 복합체는 복수 개의 항원성 도메인을 포함하는 적어도 하나의 하이브리드 항원들의 복수 개의 하이브리드 항원들을 포함한다.In a sixteenth aspect, the present invention relates to a subject comprising at least one antigenic domain of an infectious disease or tumor antigen associated with an infectious disease or tumor, one binding domain comprising a peptide that covalently binds to a heat shock protein, and the antigenic domain And administering to the subject at least one hybrid antigen essentially comprising a peptide linker separating said binding domain, wherein at least one said peptide linker is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E, preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. In one embodiment the complex comprises a plurality of hybrid antigens. In another embodiment at least one hybrid antigen is a T helper epitope. In another embodiment the hybrid antigen comprises a plurality of antigenic domains and at least one antigenic domain is a T helper epitope. In another embodiment the complex comprises a plurality of hybrid antigens of at least one hybrid antigen comprising a plurality of antigenic domains.
열일곱 번째 측면에서, 본 발명은 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나인 펩타이드를 나타낸다.In a seventeenth aspect, the invention provides Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 represents a peptide which is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V.
열여덟 번째 측면에서, 본 발명은 복수 개의 항원성 도메인, 적어도 하나의 열 충격 단백질에 결합 도메인 및 그 사이에 적어도 하나의 펩타이드 링커를 포함하는 면역성 폴리펩타이드를 제공하고, 여기서 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다.In an eighteenth aspect, the present invention provides an immunogenic polypeptide comprising a plurality of antigenic domains, a binding domain to at least one heat shock protein, and at least one peptide linker therebetween, wherein at least one of said peptide linkers Is Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred.
열아홉 번째 측면에서 본 발명은 첫 번째, 두 번째, 세 번째 또는 네 번째의 측면에서의 어느 하이브리드 항원들을 코딩하는 폴리뉴클레오타이드를 제공한다.In a ninth aspect the present invention provides a polynucleotide encoding any hybrid antigens in the first, second, third or fourth aspect.
스무 번째 측면에서, 본 발명은 감염성 질환 또는 종양과 관련된 감염체 또는 종양 항원의 하나의 항원성 도메인, 열 충격 단백질 결합 도메인 및 그 사이에 펩타이드 링커를 포함하는 하이브리드 항원을 코딩하는 폴리뉴클레오타이드를 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 방법을 제공하고, 여기서 상기 하이브리드 항원과 상기 열 충격 단백질은 비공유적으로 결합되고, 적어도 하나의 상기 펩타이드 링커는 Phe Phe Arg Lys (FFRK ; 서열번호: 1000) ; Phe Arg Lys (FRK) ; Phe Arg Lys Asn (FRKN, 서열번호: 1002); Arg Lys Asn(RKN) ; Phe Phe Arg Lys Asn(FFRKN, 서열번호: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu(QLE), Ala Lys Val Leu (AKVL ; 서열번호:1001) ; Lys Asn(KN) ; Arg Lys (RK) ; 또는 AA1-AA2-AA3-루신, 여기서 AA1는 A, S, V, E, G, L, 또는 K, 바람직하게는 V, 더욱 바람직하게는 S, 가장 바람직하게는 A이고 AA2는 K, V, 또는 E 바람직하게는 E, 더욱 바람직하게는 V, 가장 바람직하게는 K이고; AA3는 V, S, F, K, A, E, 또는 T, 바람직하게는 F, 더욱 바람직하게는 S, 가장 바람직하게는 V인 것 중 하나이다. 상기의 것 중에서, Gin Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열 번호:1001)이 바람직하고 Phe Phe Arg Lys (FFRK; 서열번호:1000)이 가장 바람직하다.In a twentieth aspect, the present invention relates to a polynucleotide encoding a hybrid antigen comprising one antigenic domain, an heat shock protein binding domain, and a peptide linker therebetween, of an infectious or tumor antigen associated with an infectious disease or tumor. A method of inducing an immune response to an infectious disease or tumor antigen comprising administering, wherein the hybrid antigen and the heat shock protein are noncovalently bound, and at least one of the peptide linkers is Phe Phe Arg Lys ( FFRK: SEQ ID NO: 1000); Phe Arg Lys (FRK); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002); Arg Lys Asn (RKN); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003); Phe Arg (FR), Gln Leu Lys (QLK), Gln Leu Glu (QLE), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001); Lys Asn (KN); Arg Lys (RK); Or AA 1 -AA 2 -AA 3 -leucine, where AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, most preferably A and AA 2 Is K, V, or E preferably E, more preferably V, most preferably K; AA 3 is one of V, S, F, K, A, E, or T, preferably F, more preferably S, most preferably V. Among the above, Gin Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred.
스물한 번째 측면에서, 본 발명은 상기 언급된 하이브리드 항원을 코딩하는 폴리뉴클레오타이드 및 열 충격 단백질을 코딩하는 폴리뉴클레오타이드를 대상에 투여하는 것을 포함하는 감염성 질환 또는 종양 항원에 대한 면역 반응을 유도하는 방법을 제공한다. 바람직한 실시예에서 상기 코딩된 열 충격 단백질은 hsp70이다.In a twenty-first aspect, the present invention provides a method of inducing an immune response to an infectious disease or tumor antigen comprising administering to a subject a polynucleotide encoding a hybrid antigen mentioned above and a polynucleotide encoding a heat shock protein. to provide. In a preferred embodiment the encoded heat shock protein is hsp70.
본 발명의 상기 언급한 어느 또는 모든 측면에서 상기 감염성 질환 항원은 박테리아, 바이러스, 원형생물, 마이코프라즈마, 진균류, 효모, 기생충 또는 프라이언과 같은 감염체로부터 비-한정적인 예를 통하여 유래할 수 있다. 종양과 관련된 암 또는 종양 항원은 육종, 임파종, 백혈병 또는 암종, 흑색종, 유방암, 전립선암, 난소암, 자궁경부암, 대장암, 폐암, 교모세포종 또는 별아교세포종으로부터 비-한정적인 예들을 통하여 유래할 수 있다. 감염체 또는 종양의 항원성 도메인은 감염성 질환 또는 종양 항원과 관련되거나 유래되어서 감염체 또는 종양 항원 각각의 항원에 대한 면역 반응의 유도는 해당 감염성 질환 또는 종양을 치료하는데 유용하다.In any or all of the aforementioned aspects of the invention the infectious disease antigen may be derived from non-limiting examples from an infectious agent, such as bacteria, viruses, protozoa, mycoplasmas, fungi, yeasts, parasites or prions. Cancer or tumor antigens associated with the tumor may originate through non-limiting examples from sarcoma, lymphoma, leukemia or carcinoma, melanoma, breast cancer, prostate cancer, ovarian cancer, cervical cancer, colon cancer, lung cancer, glioblastoma or astrocytoma Can be. The antigenic domain of an infectious agent or tumor is associated with or derived from an infectious disease or tumor antigen so that induction of an immune response to each antigen of the infectious agent or tumor antigen is useful for treating the infectious disease or tumor.
본 출원은 2003년 4월 11일 출원된 가 출원 번호 60/462,469; 2003년 4월 18일 출원된 출원 번호 60/463,746; 및 2003년 9월 16일 출원된 출원 번호 60/503,417에 대한 35U. S. C. 119 (e)하의 우선권 주장 출원이고 세 건 모두는 레퍼런스로 삽입되었다.This application claims the provisional application number 60 / 462,469, filed April 11, 2003; Application No. 60 / 463,746, filed April 18, 2003; And 35U to Application No. 60 / 503,417, filed September 16, 2003. A priority claim under S. C. 119 (e), all three of which are incorporated by reference.
본 발명을 제한하는 것이 아니라 본 발명을 명확히 할 목적으로 서브섹션인 (i) 하이브리드 항원, (ⅱ) 열 충격 단백질; 및 (ⅲ) 투여 방법들이 다음에서 자세히 설명된다.(I) hybrid antigens, (ii) heat shock proteins which are subsections for the purpose of clarifying the invention but not for limiting the invention; And (iii) methods of administration are described in detail below.
하이브리드hybrid 항원(Hybrid Antigen) Antigen (Hybrid Antigen)
본 발명에 따른 하이브리드 항원은 적어도 하나의 항원성 (면역원성(immunogenic)) 도메인, 적어도 하나의 열 충격 단백질-결합 도메인, 및 이러한 도메인들 적어도 두 개 사이의 펩타이드 링커(linker)로 구성되며, 여기에서 펩타이드 링커는 다음들 중 하나이며,The hybrid antigen according to the invention consists of at least one antigenic (immunogenic) domain, at least one heat shock protein-binding domain, and a peptide linker between at least two of these domains, wherein The peptide linker in is one of
Phe Phe Arg Lys (FFRK; 서열번호: 1000), Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000),
Phe Arg Lys (FRK); Phe Arg Lys (FRK);
Phe Arg Lys Asn (FRKN, 서열번호: 1002); Phe Arg Lys Asn (FRKN, SEQ ID NO: 1002);
Arg Lys Asn (RKN); Arg Lys Asn (RKN);
Phe Phe Arg Lys Asn (FFRKN, 서열번호: 1003); Phe Phe Arg Lys Asn (FFRKN, SEQ ID NO: 1003);
Phe Arg (FR),Phe Arg (FR),
Gln Leu Lys (QLK),Gln Leu Lys (QLK),
Gln Leu Glu (QLE), Gln Leu Glu (QLE),
Ala Lys Val Leu (AKVL; 서열번호: 1001), Ala Lys Val Leu (AKVL; SEQ ID NO: 1001),
Lys Asn(KN); Lys Asn (KN);
Arg Lys (RK); 또는 Arg Lys (RK); or
AA1-AA2-AA3-leucine, 여기에서 AA1은 A, S, V, E, G, L, 또는 K이고, 바람직하게는 V이며, 더욱 바람직하게는 S이고, 및 가장 바람직하게는 A이며; AA2는 K, V, 또는 E이고, 바람직하게는 E이며, 더욱 바람직하게는 V이고 및 가장 바람직하게는 K이며; AA3는 V, S, F, K, A, E, 또는 T이고, 바람직하게는 F이며, 더욱 바람직하게는 S이고 가장 바람직하게는 V이다.AA 1 -AA 2 -AA 3 -leucine, wherein AA 1 is A, S, V, E, G, L, or K, preferably V, more preferably S, and most preferably A; AA 2 is K, V, or E, preferably E, more preferably V and most preferably K; AA 3 is V, S, F, K, A, E, or T, preferably F, more preferably S and most preferably V.
전술한 것들 중에서, Gln Leu Lys (QLK), Arg Lys (RK) 및 Ala Lys Val Leu (AKVL; 서열번호: 1001)이 바람직하고, Phe Phe Arg Lys (FFRK; 서열번호: 1000)이 가장 바람직하다.Of the foregoing, Gln Leu Lys (QLK), Arg Lys (RK) and Ala Lys Val Leu (AKVL; SEQ ID NO: 1001) are preferred, and Phe Phe Arg Lys (FFRK; SEQ ID NO: 1000) is most preferred. .
따라서, 하이브리드 항원은 적어도 두 가지 기능을 하며, 즉 (i) 그것은 바람직한 면역 반응을 유도할 수 있는 에피토프를 포함하고, (ⅱ) 그것은 물리적으로 열 충격 단백질에 결합할 수 있다. 아래에서 설명되는 것처럼, 그러한 결합은 생체 내에서 발생할 수 있어서 하이브리드 항원 단독 투여가 바람직한 면역 반응을 유도하고 바람직한 치료 효과를 생성할 것이다.Thus, a hybrid antigen serves at least two functions, namely (i) it contains an epitope capable of eliciting a desired immune response, and (ii) it can physically bind to a heat shock protein. As described below, such binding can occur in vivo such that administration of the hybrid antigen alone will induce a desired immune response and produce a desired therapeutic effect.
본 명세서에서 사용된 용어 "항원"은 아미노산, 탄수화물, 핵산 또는 지질 단독으로 또는 어떠한 조합으로 구성될 수 있는 화합물을 말한다.As used herein, the term “antigen” refers to a compound which may consist of amino acids, carbohydrates, nucleic acids or lipids alone or in any combination.
본 명세서에서 사용된 용어 "하이브리드 항원"은 하나 이상의 열 충격 단백질에 결합하고 면역 반응이 바람직하게 지향되는 면역원(immunogen)을 대표하는 화합물을 말한다. 예를 들어, 면역원이 인플루엔자 바이러스일 경우, 하이브리드 항원은 인플루엔자 바이러스의 매트릭스 단백질의 펩타이드 절편을 포함할 수 있다. 본 명세서에서 사용될 때, 용어 "면역원(immunogen)"은 면역 반응이 향해지는 종양 세포(neoplastic cell), 감염된 세포(infected cell), 병원체(pathogen), 또는 이들의 구성성분(component)에 적용될 수 있으며, 반면에 하이브리드 항원은 바람직한 반응을 야기할 수 있는 면역원의 일부와 하나 이상의 열 충격 단백질에 결합할 수 있는 일부를 포함한다. 특히, 하이브리드 항원의 항원성 도메인은 MHC 분자로부터 얻어진 펩타이드, 돌연변이 DNA 유전자 프로덕트, 및 종양 세포로부터 얻어진 것들과 같은 직접적인 DNA 프로덕트를 포함하는 특정 질환 또는 병원체에 면역 반응을 일으키기 위하여 선택된다.As used herein, the term “hybrid antigen” refers to a compound that binds one or more heat shock proteins and represents an immunogen to which the immune response is preferably directed. For example, if the immunogen is an influenza virus, the hybrid antigen may comprise peptide fragments of the matrix protein of the influenza virus. As used herein, the term “immunogen” can be applied to tumor cells, infected cells, pathogens, or components thereof to which an immune response is directed. On the other hand, hybrid antigens include those that can bind to one or more heat shock proteins and some of the immunogens that can cause the desired response. In particular, the antigenic domain of the hybrid antigen is selected to elicit an immune response to certain diseases or pathogens, including direct DNA products such as peptides obtained from MHC molecules, mutant DNA gene products, and those obtained from tumor cells.
본 발명은 일정 타입의 면역원에 적용될 수 있는 반면, 특별히 관심 있는 면역원은 육종(sarcoma), 림프종, 백혈병 또는 암종(carcinoma)을 포함하나 이에 한정되지 않는 종양 질환, 특히, 흑색종, 유방 암종, 전립샘 암종, 난소 암종, 자궁목(cervix) 암종, 대장 암종, 폐 암종, 아교모세포종(glioblastoma), 별아교세포종(astrocytoma) 등과 관련된, 등으로부터 유래한 또는 등과 관련된 것으로 예상되는 것들이다. 본 발명의 하이브리드 항원에 유용한 흑색종 항원의 선택은 비-제한적인 실시예로서 PCT/US01/12449 (W00178655)에서 찾아질 수 있으며, 이것은 인용에 의하여 그 전체가 본 명세서에 포함된다. 게다가, p53과 같은 종양 억제 유전자 프로덕트의 변이, 또는 ras와 같은 종양유전자 프로덕트 또한 본 발명에 따라 사용되는 하이브리드 항원을 제공할 수 있다. While the present invention can be applied to certain types of immunogens, immunogens of particular interest are tumor diseases, including but not limited to sarcoma, lymphoma, leukemia or carcinoma, in particular melanoma, breast carcinoma, prostate gland Carcinoma, ovarian carcinoma, cervix carcinoma, colorectal carcinoma, lung carcinoma, glioblastoma, astrocytoma, and the like, or the like derived from, or related to, and the like. Selection of melanoma antigens useful for the hybrid antigens of the present invention can be found in PCT / US01 / 12449 (W00178655) as a non-limiting example, which is incorporated herein by reference in its entirety. In addition, mutations in tumor suppressor gene products such as p53, or oncogene products such as ras can also provide hybrid antigens used in accordance with the present invention.
다른 실시예에서, 면역원은 감염성 질환과 관련될 수 있으며, 그러한 것으로서 박테리아, 바이러스, 프로토조아, 미코플라즈마(mycoplasma), 진균, 효모, 기생충, 또는 프라이온(prion)일 수 있다. 예를 들어, 예시적으로, 면역원은 인간 유두종 바이러스(human papilloma virus, 아래 참조), 단순 헤르퍼스(herpes simplex) 또는 대상포진(herpes zoster)과 같은 헤르퍼스 바이러스, 인간 면역결핍 바이러스 1 또는 2와 같은 레트로바이러스, 간염 바이러스, 인플루엔자 바이러스, 리노바이러스(rhinovirus), 호흡기 신시티움 바이러스(respiratory syncytial virus), 사이토메갈로바이러스(cytomegalovirus0, 아데노바이러스(adenovirus), 미코플라즈마뉴모니아(Mycoplasmapneumoniae), Salmonella, Staphylococcus, Streptococcus, Enterococcus, Clostridium, Escherichia, Klebsiella, Vibrio, Mycobacterium 속의 바이러스, 아메바(amoeba), 말라리아 기생충, Trypanosoma cruzi 등일 수 있다.In other embodiments, the immunogen may be associated with an infectious disease, such as bacteria, viruses, protozoa, mycoplasma, fungi, yeast, parasites, or prions. For example, by way of example, the immunogen may be a human papilloma virus (see below), a herpes virus such as herpes simplex or herpes zoster, human immunodeficiency virus 1 or 2, and the like. Such as retrovirus, hepatitis virus, influenza virus, rhinovirus, respiratory syncytial virus, cytomegalovirus0, adenovirus, Mycoplasmapneumoniae, Salmonella , Staphylococcus , Streptococcus , Enterococcus , Clostridium , Escherichia , Klebsiella , Vibrio , Mycobacterium virus, amoeba, malaria parasite, Trypanosoma cruzi and the like.
면역원은 종양, 감염 세포, 감염 개체로부터의 표본, 세포 배양물, 또는 세균(organism) 배양물로부터 직접적인 분리를 통하여 얻어지거나, 또는 화학적 또는 재조합 기술을 통하여 만들어질 수 있다. 비-제한적 예로서, 바이러스, 박테리아 및 이와 유사한 것에 대한 적당한 항원성 펩타이드는, 특히 하이브리드 항원에 사용하기 위한 것은 아래와 같은 HLA-A2 펩타이드 결합 서열과 같은, 하지만 이에 한정되지 않는, HLA 결합 서열을 포함하는 MHC 클래스 I 제한(restricted) 펩타이드 에피토프에 대한 그들의 서열을 통한 검색을 통해 설계될 수 있다:Immunogens can be obtained through direct isolation from tumors, infected cells, samples from infected individuals, cell cultures, or organism cultures, or can be made through chemical or recombinant techniques. By way of non-limiting example, suitable antigenic peptides for viruses, bacteria and the like include, but are not limited to, HLA binding sequences, such as, but not limited to, the HLA-A2 peptide binding sequences below, for use in hybrid antigens. Can be designed through their sequence search for MHC class I restricted peptide epitopes:
Xaa(Leu/Met)XaaXaaXaa(Val/Ile/Leu/Thr)XaaXaa(Val/Leu) (서열번호: 2), 예를 들어,Xaa (Leu / Met) XaaXaaXaa (Val / Ile / Leu / Thr) XaaXaa (Val / Leu) (SEQ ID NO: 2), for example
바이러스로부터:From the virus:
Ser Gly Pro Ser Asn Thr Pro Pro Glu Ile (서열번호: 31);Ser Gly Pro Ser Asn Thr Pro Pro Glu Ile (SEQ ID NO .: 31);
Ser Gly Val Glu Asn Pro Gly Gly Tyr Cys Leu (서열번호: 32);Ser Gly Val Glu Asn Pro Gly Gly Tyr Cys Leu (SEQ ID NO: 32);
Lys Ala Val Tyr Asn Phe Ala Thr Cys Gly (서열번호: 33);Lys Ala Val Tyr Asn Phe Ala Thr Cys Gly (SEQ ID NO: 33);
Arg Pro Gln Ala Ser Gly Val Tyr Met (서열번호: 34);Arg Pro Gln Ala Ser Gly Val Tyr Met (SEQ ID NO .: 34);
Phe Gln Pro Gln Asn Gly Gln Phe Ile (서열번호: 35);Phe Gln Pro Gln Asn Gly Gln Phe Ile (SEQ ID NO .: 35);
Ile Glu Gly Gly Trp Thr Gly Met Ile (서열번호: 36);Ile Glu Gly Gly Trp Thr Gly Met Ile (SEQ ID NO .: 36);
Thr Tyr Val Ser Val Ser Thr Ser Thr Leu (서열번호: 37);Thr Tyr Val Ser Val Ser Thr Ser Thr Leu (SEQ ID NO .: 37);
Phe Glu Ala Asn Gly Asn Leu Ile (서열번호: 38);Phe Glu Ala Asn Gly Asn Leu Ile (SEQ ID NO .: 38);
Ile Tyr Ser Thr Val Ala Ser Ser Leu (서열번호: 39);Ile Tyr Ser Thr Val Ala Ser Ser Leu (SEQ ID NO .: 39);
Thr Tyr Gln Arg Thr Arg Ala Leu Val (서열번호: 40);Thr Tyr Gln Arg Thr Arg Ala Leu Val (SEQ ID NO .: 40);
Cys Thr Glu Leu Lys Leu Ser Asp Tyr (서열번호: 41); Cys Thr Glu Leu Lys Leu Ser Asp Tyr (SEQ ID NO: 41);
Ser Asp Tyr Glu Gly Arg Leu Ile (서열번호: 42);Ser Asp Tyr Glu Gly Arg Leu Ile (SEQ ID NO: 42);
Glu Glu Gly Ala Ile Val Gly Glu Ile (서열번호: 43);Glu Glu Gly Ala Ile Val Gly Glu Ile (SEQ ID NO: 43);
Val Ser Asp Gly Gly Pro Asn Leu Tyr (서열번호: 44);Val Ser Asp Gly Gly Pro Asn Leu Tyr (SEQ ID NO: 44);
Ala Ser Asn Glu Asn Met Glu Thr Met (서열번호: 45);Ala Ser Asn Glu Asn Met Glu Thr Met (SEQ ID NO: 45);
Ala Ser Asn Glu Asn Met Asp Ala Met (서열번호: 46);Ala Ser Asn Glu Asn Met Asp Ala Met (SEQ ID NO .: 46);
Lys Leu Gly Glu Phe Tyr Asn Gln Met Met (서열번호: 47);Lys Leu Gly Glu Phe Tyr Asn Gln Met Met (SEQ ID NO .: 47);
Leu Tyr Gln Asn Val Gly Thr Tyr Val (서열번호: 48);Leu Tyr Gln Asn Val Gly Thr Tyr Val (SEQ ID NO: 48);
Thr Tyr Val Ser Val Gly Thr Ser Thr Leu (서열번호: 49);Thr Tyr Val Ser Val Gly Thr Ser Thr Leu (SEQ ID NO: 49);
Phe Glu Ser Thr Gly Asn Leu Ile (서열번호: 50);Phe Glu Ser Thr Gly Asn Leu Ile (SEQ ID NO: 50);
Val Tyr Gln Ile Leu Ala Ile Tyr Ala (서열번호:51);Val Tyr Gln Ile Leu Ala Ile Tyr Ala (SEQ ID NO: 51);
Ile Tyr Ala Thr Val Ala Gly Ser Leu (서열번호: 52);Ile Tyr Ala Thr Val Ala Gly Ser Leu (SEQ ID NO: 52);
Gly Ile Leu Gly Phe Val Phe Thr Leu (서열번호: 53);Gly Ile Leu Gly Phe Val Phe Thr Leu (SEQ ID NO: 53);
Ile Leu Gly Phe Val Phe Thr Leu Thr Val (서열번호: 54); Ile Leu Gly Phe Val Phe Thr Leu Thr Val (SEQ ID NO: 54);
Ile Leu Arg Gly Ser Val Ala His Lys (서열번호: 55); Ile Leu Arg Gly Ser Val Ala His Lys (SEQ ID NO: 55);
Glu Asp Leu Arg Val Leu Ser Phe Ile (서열번호: 56); Glu Asp Leu Arg Val Leu Ser Phe Ile (SEQ ID NO: 56);
Glu Leu Arg Ser Arg Tyr Trp Ala Ile (서열번호:57);Glu Leu Arg Ser Arg Tyr Trp Ala Ile (SEQ ID NO: 57);
Ser Arg Tyr Trp Ala Ile Arg Thr Arg (서열번호: 58);Ser Arg Tyr Trp Ala Ile Arg Thr Arg (SEQ ID NO: 58);
Lys Thr Gly Gly Pro Ile Tyr Lys Arg (서열번호: 59);Lys Thr Gly Gly Pro Ile Tyr Lys Arg (SEQ ID NO: 59);
Phe Ala Pro Gly Jtsn TyT Pro Ala Leu (서열번호: 60);Phe Ala Pro Gly Jtsn Ty T Pro Ala Leu (SEQ ID NO: 60);
Arg Arg Tyr Pro Asp Ala Val Tyr Leu (서열번호: 61);Arg Arg Tyr Pro Asp Ala Val Tyr Leu (SEQ ID NO: 61);
Asp Pro Val Ile Asp Arg Leu Tyr Leu (서열번호: 62);Asp Pro Val Ile Asp Arg Leu Tyr Leu (SEQ ID NO: 62);
Ser Pro Gly Arg Ser Phe Ser Tyr Phe (서열번호: 63);Ser Pro Gly Arg Ser Phe Ser Tyr Phe (SEQ ID NO: 63);
Tyr Pro Ala Leu Gly Leu His Glu Phe (서열번호: 64);Tyr Pro Ala Leu Gly Leu His Glu Phe (SEQ ID NO: 64);
Thr Tyr Lys Asp Thr Val Gln Leu (서열번호: 65);Thr Tyr Lys Asp Thr Val Gln Leu (SEQ ID NO: 65);
Phe Tyr Asp Gly Phe Ser Lys Val Pro Leu (서열번호: 66);Phe Tyr Asp Gly Phe Ser Lys Val Pro Leu (SEQ ID NO: 66);
Phe Ile Ala Gly Asn Ser Ala Tyr Glu Tyr Val (서열번호: 67);Phe Ile Ala Gly Asn Ser Ala Tyr Glu Tyr Val (SEQ ID NO: 67);
Tyr Pro His Phe Met Pro Thr Asn Leu (서열번호: 68);Tyr Pro His Phe Met Pro Thr Asn Leu (SEQ ID NO: 68);
Ala Pro Thr Ala Gly Ala Phe Phe Phe (서열번호: 69);Ala Pro Thr Ala Gly Ala Phe Phe Phe (SEQ ID NO: 69);
Ser Thr Leu Pro Glu Thr Thr Val Val Arg Arg (서열번호: 70);Ser Thr Leu Pro Glu Thr Thr Val Val Arg Arg (SEQ ID NO: 70);
Phe Leu Pro Ser Asp Phe Phe Pro Ser Val (서열번호: 71);Phe Leu Pro Ser Asp Phe Phe Pro Ser Val (SEQ ID NO: 71);
Trp Leu Ser Leu Leu Val Pro Phe Val (서열번호: 72);Trp Leu Ser Leu Leu Val Pro Phe Val (SEQ ID NO: 72);
Gly Leu Ser Pro Thr Val Trp Leu Ser Val (서열번호: 73);Gly Leu Ser Pro Thr Val Trp Leu Ser Val (SEQ ID NO: 73);
Asp Leu Met Gly Tyr Ile Pro Leu Val (서열번호: 74);Asp Leu Met Gly Tyr Ile Pro Leu Val (SEQ ID NO: 74);
Leu Met Gly Tyr Ile Pro Leu Val Gly Ala (서열번호: 75);Leu Met Gly Tyr Ile Pro Leu Val Gly Ala (SEQ ID NO: 75);
Ala Ser Arg Cys Trp Val Ala Met (서열번호: 76);Ala Ser Arg Cys Trp Val Ala Met (SEQ ID NO: 76);
Lys Leu Val Ala Leu Gly Ile Asn Ala Val (서열번호: 77);Lys Leu Val Ala Leu Gly Ile Asn Ala Val (SEQ ID NO: 77);
Phe Leu Arg Gly Arg Ala Tyr Gly Leu (서열번호: 78);Phe Leu Arg Gly Arg Ala Tyr Gly Leu (SEQ ID NO: 78);
Arg Arg Ile Tyr Asp Leu Ile Glu Leu (서열번호: 79);Arg Arg Ile Tyr Asp Leu Ile Glu Leu (SEQ ID NO: 79);
Ile Val Thr Asp Phe Ser Val Ile Lys (서열번호: 80);Ile Val Thr Asp Phe Ser Val Ile Lys (SEQ ID NO: 80);
Arg Arg Arg Trp Arg Arg Leu Thr Val (서열번호: 81);Arg Arg Arg Trp Arg Arg Leu Thr Val (SEQ ID NO: 81);
Glu Glu Asn Leu Leu Asp Phe Val Arg Phe (서열번호: 82);Glu Glu Asn Leu Leu Asp Phe Val Arg Phe (SEQ ID NO: 82);
Cys Leu Gly Gly Leu Leu Thr Met Val (서열번호: 83);Cys Leu Gly Gly Leu Leu Thr Met Val (SEQ ID NO: 83);
Ser Ser Ile Glu Phe Ala Arg Leu (서열번호: 84);Ser Ser Ile Glu Phe Ala Arg Leu (SEQ ID NO: 84);
Leu Tyr Arg Thr Phe Ala Gly Asn Pro Arg Ala (서열번호: 85);Leu Tyr Arg Thr Phe Ala Gly Asn Pro Arg Ala (SEQ ID NO: 85);
Asp Tyr Ala Thr Leu Gly Val Gly Val (서열번호: 86);Asp Tyr Ala Thr Leu Gly Val Gly Val (SEQ ID NO: 86);
Leu Leu Leu Gly Thr Leu Asn Ile Val (서열번호: 87);Leu Leu Leu Gly Thr Leu Asn Ile Val (SEQ ID NO: 87);
Leu Leu Met Gly Thr Leu Gly Ile Val (서열번호: 88); Leu Leu Met Gly Thr Leu Gly Ile Val (SEQ ID NO: 88);
Thr Leu Gln Asp Ile Val Leu His Leu (서열번호: 89);Thr Leu Gln Asp Ile Val Leu His Leu (SEQ ID NO: 89);
Gly Leu His Cys Tyr Glu Gln Leu Val (서열번호: 90);Gly Leu His Cys Tyr Glu Gln Leu Val (SEQ ID NO: 90);
Pro Leu Lys Gln His Phe Gln Ile Val (서열번호: 91);Pro Leu Lys Gln His Phe Gln Ile Val (SEQ ID NO: 91);
Arg Leu Val Thr Leu Lys Asp Ile Val (서열번호: 92);Arg Leu Val Thr Leu Lys Asp Ile Val (SEQ ID NO: 92);
Arg Ala His Tyr Asn Ile Val Thr Phe (서열번호: 93);Arg Ala His Tyr Asn Ile Val Thr Phe (SEQ ID NO: 93);
Leu Leu Phe Gly Tyr Pro Val Tyr Val (서열번호: 94);Leu Leu Phe Gly Tyr Pro Val Tyr Val (SEQ ID NO: 94);
Ser Ala Ile Asn Asn Tyr Ala Gln Lyb Leu (서열번호: 95);Ser Ala Ile Asn Asn Tyr Ala Gln Lyb Leu (SEQ ID NO: 95);
His Gln Ala Ile Ser Pro Arg Thr Leu (서열번호: 96);His Gln Ala Ile Ser Pro Arg Thr Leu (SEQ ID NO: 96);
Gln Met Val His Gln Ala Ile Ser Pro Arg Thr Leu (서열번호: 97);Gln Met Val His Gln Ala Ile Ser Pro Arg Thr Leu (SEQ ID NO: 97);
Cys Lys Gly Val Asn Lys Glu Tyr Leu (서열번호: 98);Cys Lys Gly Val Asn Lys Glu Tyr Leu (SEQ ID NO: 98);
Gln Gly Ile Asn Asn Leu Asp Asn Leu (서열번호: 99);Gln Gly Ile Asn Asn Leu Asp Asn Leu (SEQ ID NO: 99);
Asn Asn Leu Asp Asn Leu Arg Asp Tyr (서열번호: 100);Asn Asn Leu Asp Asn Leu Arg Asp Tyr (SEQ ID NO: 100);
Ser Glu Phe Leu Leu Glu Lys Arg Ile (서열번호: 101);Ser Glu Phe Leu Leu Glu Lys Arg Ile (SEQ ID NO: 101);
Ser Tyr Ile Gly Ser Ile Asn Asn Ile (서열번호: 102);Ser Tyr Ile Gly Ser Ile Asn Asn Ile (SEQ ID NO: 102);
Ile Leu Gly Asn Lys Ile Val Arg Met Tyr (서열번호: 103);Ile Leu Gly Asn Lys Ile Val Arg Met Tyr (SEQ ID NO: 103);
Arg Leu Arg Pro Gly Cly Lys Lys Lys (서열번호: 104);Arg Leu Arg Pro Gly Cly Lys Lys Lys (SEQ ID NO: 104);
Glu Tle Lys Asp Thr Lys Glu Ala Leu (서열번호: 105);Glu Tle Lys Asp Thr Lys Glu Ala Leu (SEQ ID NO: 105);
Gly Glu Ile Tyr Lys Arg Trp Ile Ile (서열번호: 106);Gly Glu Ile Tyr Lys Arg Trp Ile Ile (SEQ ID NO: 106);
Glu Ile Tyr Lys Arg Trp Ile Ile Leu (서열번호: 107);Glu Ile Tyr Lys Arg Trp Ile Ile Leu (SEQ ID NO: 107);
Arg Tyr Leu Lys Asp Gln Gln Leu Leu (서열번호: 108);Arg Tyr Leu Lys Asp Gln Gln Leu Leu (SEQ ID NO .: 108);
Arg Gly Pro Gly Arg Ala Phe Val Thr Ile (서열번호: 109);Arg Gly Pro Gly Arg Ala Phe Val Thr Ile (SEQ ID NO: 109);
Ile Val Gly Leu Asn Lys Ile Val Arg (서열번호: 110);Ile Val Gly Leu Asn Lys Ile Val Arg (SEQ ID NO: 110);
Thr Val Tyr Tyr Gly Val Pro Val Trp Lys (서열번호: 111);Thr Val Tyr Tyr Gly Val Pro Val Trp Lys (SEQ ID NO: 111);
Arg Leu Arg Asp Leu Leu Leu Ile Val Thr Arg (서열번호: 112);Arg Leu Arg Asp Leu Leu Leu Ile Val Thr Arg (SEQ ID NO: 112);
Lys Arg Tip Ile Ile Leu Gly Leu Asn Lys (서열번호: 113);Lys Arg Tip Ile Ile Leu Gly Leu Asn Lys (SEQ ID NO: 113);
Ser Phe Asn Cys Gly Gly Glu Phe Phe (서열번호: 114);Ser Phe Asn Cys Gly Gly Glu Phe Phe (SEQ ID NO: 114);
Gly Arg Ala Phe Val Thr Ile Gly Lys (서열번호: 115);Gly Arg Ala Phe Val Thr Ile Gly Lys (SEQ ID NO .: 115);
Thr Pro Gly Pro Cly Val Arg Tyr Pro Leu (서열번호: 116);Thr Pro Gly Pro Cly Val Arg Tyr Pro Leu (SEQ ID NO: 116);
Gln Val Pro Leu Arg Pro Met Thr Tyr Lys (서열번호: 117);Gln Val Pro Leu Arg Pro Met Thr Tyr Lys (SEQ ID NO: 117);
Thr Glu Met Glu Lys Glu Gly Lys Ile (서열번호: 118);Thr Glu Met Glu Lys Glu Gly Lys Ile (SEQ ID NO: 118);
Ile Leu Lys Glu Pro Val His Gly Val (서열번호: 119);Ile Leu Lys Glu Pro Val His Gly Val (SEQ ID NO: 119);
Val Glu Ala Glu Ile Ala His Gln Ile (서열번호: 120);Val Glu Ala Glu Ile Ala His Gln Ile (SEQ ID NO: 120);
Arg Gly Tyr Val Tyr Gln Gly Leu (서열번호: 121);Arg Gly Tyr Val Tyr Gln Gly Leu (SEQ ID NO: 121);
Tyr Ser Gly Tyr Ile Phe Arg Asp Leu (서열번호: 122);Tyr Ser Gly Tyr Ile Phe Arg Asp Leu (SEQ ID NO: 122);
Val Gly Pro Val Phe Pro Pro Gly Met (서열번호: 123);Val Gly Pro Val Phe Pro Pro Gly Met (SEQ ID NO: 123);
Ile Ile Tyr Arg Phe Leu Leu Ile (서열번호: 124)Ile Ile Tyr Arg Phe Leu Leu Ile (SEQ ID NO .: 124)
박테리아로부터:From bacteria:
Lys Tyr Gly Val Ser Val Gln Asp Ile (서열번호: 125);Lys Tyr Gly Val Ser Val Gln Asp Ile (SEQ ID NO: 125);
Ile Gln Val Gly Asn Thr Arg Thr Ile (서열번호: 126);Ile Gln Val Gly Asn Thr Arg Thr Ile (SEQ ID NO: 126);
Thr Pro His Pro Ala Arg Ile Gly Leu (서열번호: 127);Thr Pro His Pro Ala Arg Ile Gly Leu (SEQ ID NO: 127);
기생충(parasite)으로부터:From parasites:
Ser Tyr Ile Pro Ser Ala Glu Lys Ile (서열번호: 128);Ser Tyr Ile Pro Ser Ala Glu Lys Ile (SEQ ID NO: 128);
Lys Pro Lys Asp Glu Leu Asp Tyr (서열번호: 129);Lys Pro Lys Asp Glu Leu Asp Tyr (SEQ ID NO: 129);
Lys Ser Lys Asp Glu Leu Asp Tyr (서열번호: 130):Lys Ser Lys Asp Glu Leu Asp Tyr (SEQ ID NO .: 130):
Lys Pro Asn Asp Lys Ser Leu Tyr (서열번호: 131);Lys Pro Asn Asp Lys Ser Leu Tyr (SEQ ID NO: 131);
Lys Tyr Leu Lys Lys Ile Lys Asn Ser Leu (서열번호: 132);Lys Tyr Leu Lys Lys Ile Lys Asn Ser Leu (SEQ ID NO: 132);
Tyr Glu Asn Asp Ile Glu Lys Lys Ile (서열번호: 133);Tyr Glu Asn Asp Ile Glu Lys Lys Ile (SEQ ID NO: 133);
Asn Tyr Asp Asn Ala Gly Thr Asn Leu (서열번호: 134);Asn Tyr Asp Asn Ala Gly Thr Asn Leu (SEQ ID NO: 134);
Asp Glu Leu Asp Tyr Glu Asn Asp Ile (서열번호: 135);Asp Glu Leu Asp Tyr Glu Asn Asp Ile (SEQ ID NO .: 135);
Ser Tyr Val Pro Ser Ala Glu Gln Ile (서열번호: 136);Ser Tyr Val Pro Ser Ala Glu Gln Ile (SEQ ID NO: 136);
암으로부터:From cancer:
Phe Glu Gln Asn Thr Ala Gln Pro (서열번호: 137);Phe Glu Gln Asn Thr Ala Gln Pro (SEQ ID NO: 137);
Phe Glu Gln Asn Thr Ala Gln Ala (서열번호: 138);Phe Glu Gln Asn Thr Ala Gln Ala (SEQ ID NO: 138);
Glu Ala Asp Pro Thr Gly His Ser Tyr (서열번호: 139);Glu Ala Asp Pro Thr Gly His Ser Tyr (SEQ ID NO: 139);
Glu Val Asp Pro Ile Gly His Leu Tyr (서열번호: 140);Glu Val Asp Pro Ile Gly His Leu Tyr (SEQ ID NO: 140);
Ala Ala Gly Ile Gly Ile Leu Thr Val (서열번호: 141);Ala Ala Gly Ile Gly Ile Leu Thr Val (SEQ ID NO: 141);
Thr Leu Glu Pro Cly Pro Val Thr Ala (서열번호: 142);Thr Leu Glu Pro Cly Pro Val Thr Ala (SEQ ID NO: 142);
Ile Leu Asp Gly Thr Ala Thr Leu Arg Leu (서열번호: 143);Ile Leu Asp Gly Thr Ala Thr Leu Arg Leu (SEQ ID NO: 143);
Met Leu Leu Ala Leu Leu Tyr Cys Leu (서열번호: 144);Met Leu Leu Ala Leu Leu Tyr Cys Leu (SEQ ID NO: 144);
Tyr Met Asn Gly Thr Met Ser Gln Val (서열번호: 145);Tyr Met Asn Gly Thr Met Ser Gln Val (SEQ ID NO: 145);
Leu Pro Tyr Leu Gly Trp Leu Val Phe (서열번호: 146);Leu Pro Tyr Leu Gly Trp Leu Val Phe (SEQ ID NO: 146);
Phe Gly Pro Tyr Lys Leu Asn Arg Leu (서열번호: 147);Phe Gly Pro Tyr Lys Leu Asn Arg Leu (SEQ ID NO: 147);
Lys Ser Pro Trp Phe Thr Thr Leu (서열번호: 148);Lys Ser Pro Trp Phe Thr Thr Leu (SEQ ID NO: 148);
Gly Pro Pro His Ser Asn Asn Phe Gly Tp (서열번호: 149); 및Gly Pro Pro His Ser Asn Asn Phe Gly Tp (SEQ ID NO: 149); And
Ile Ser Thr Gln Asn His Arg Ala Leu (서열번호: 150)Ile Ser Thr Gln Asn His Arg Ala Leu (SEQ ID NO .: 150)
(Rammensee et al., Immunogenetics 41: 178-223 (1995)),(Rammensee et al., Immunogenetics 41: 178-223 (1995)),
Xaa(Leu/Met)XaaXaaXaaXaaXaaXaaVal (서열번호: 3)Xaa (Leu / Met) XaaXaaXaaXaaXaaXaaVal (SEQ ID NO: 3)
(Tarpey et al., Immunology 81: 222-227 (1994)),Tarpey et al., Immunology 81: 222-227 (1994),
Xaa(Val/Gln)XaaXaaXaaXaaXaaXaaLeu (서열번호: 28),Xaa (Val / Gln) XaaXaaXaaXaaXaaXaaLeu (SEQ ID NO: 28),
예를 들어, 바이러스로부터:For example, from a virus:
Tyr Gly Ile Leu Gly Lys Val Phe Thr Leu (서열번호: 151);Tyr Gly Ile Leu Gly Lys Val Phe Thr Leu (SEQ ID NO: 151);
Ser Leu Tyr Asn Thr Val Ala Thr Leu (서열번호: 152);Ser Leu Tyr Asn Thr Val Ala Thr Leu (SEQ ID NO .: 152);
(Barouch et al., J Exp . Med . 182: 1847-1856 (1995)).(Barouch et al., J Exp . Med . 182: 1847-1856 (1995)).
전술한 에피토프들은 단지 다양한 감염성 질환 및 암과 관련되어 이용가능한 선택의 예들이며, 조금이라도 본 발명을 제한하는 의도로 제공되는 것이 아니다.The epitopes described above are merely examples of the options available in connection with various infectious diseases and cancers and are not intended to be limiting of the invention in any way.
바람직한 면역 반응의 타입을 고려하는 것 또한 바람직할 수 있다. 예를 들어, 일정 환경하에서, 체액성(humoral) 면역 반응이 적당할 수 있다. 다른 경우에, 정말로 종양 세포 또는 감염 세포를 향한 면역 반응이 발휘되도록 요구되는 곳에서, 세포성 면역 반응이 특히 바람직하다. 따라서, B 세포, T 헬퍼 세포, 또는 세포독성 T 세포의 활성화와 관련된 특정 에피토프가 확인되고 하이브리드 항원에 포함되기 위하여 선택될 수 있다.It may also be desirable to consider the type of immune response desired. For example, under certain circumstances, a humoral immune response may be appropriate. In other cases, a cellular immune response is particularly preferred where it is really required to exert an immune response towards tumor cells or infected cells. Thus, specific epitopes associated with activation of B cells, T helper cells, or cytotoxic T cells can be identified and selected for inclusion in the hybrid antigen.
자가면역 질환 또는 알레르기와 관련된 하이브리드 항원을 이용하는 것 또한 바람직하다. 그러한 하이브리드 항원은 개체 내에서 하이브리드 항원에 대한 기-존재(pre-existing) 면역 반응을 억제하거나 면역허용원(tolerogenic)이 되기에 충분한 양을 하나 이상의 열 충격 단백질과 함께 투여될 수 있다. 면역 반응을 억제하기 위해 필요한 열 충격 단백질의 양은 자극을 위해 필요한 양보다 실질적으로 클 것이다. It is also desirable to use hybrid antigens associated with autoimmune diseases or allergies. Such hybrid antigens may be administered with one or more heat shock proteins in an amount sufficient to inhibit a pre-existing immune response to the hybrid antigen or to be tolerogenic in the individual. The amount of heat shock protein needed to suppress the immune response will be substantially greater than the amount required for stimulation.
하이브리드 항원의 크기는 사용된 열 충격 단백질에 따라 다양할 수 있지만, 본 발명의 비-제한적 실시예에서, 하이브리드 항원은 10 내지 500 아미노산 잔기들을 가진 펩타이드 크기일 수 있으며, 바람직하게는 14 내지 100 아미노산 잔기를 가진 펩타이드 크기이며, 가장 바람직하게는 18 내지 50 아미노산 잔기를 가진 펩타이드 크기이다. 그러한 것으로서, 하이브리드 항원의 항원성 도메인으로 작용하기 위하여 면역원의 절편을 생산하거나, 대안적으로 화학적 또는 재조합적 DNA 방법에 의해 하이브리드 항원을 합성하는 것이 바람직할 수 있다.The size of the hybrid antigen may vary depending on the heat shock protein used, but in a non-limiting embodiment of the invention, the hybrid antigen may be peptide size with 10 to 500 amino acid residues, preferably 14 to 100 amino acids. Peptide size with residues, most preferably peptide size with 18-50 amino acid residues. As such, it may be desirable to produce fragments of an immunogen to act as the antigenic domain of the hybrid antigen, or alternatively synthesize the hybrid antigen by chemical or recombinant DNA methods.
전술한 점들에 기초하여, 하이브리드 항원은 제조될 수 있고, 열 충격 단백질에 결합하는 그것의 능력이 시험될 수 있다. 몇몇 실시예에서, 특정 열 충격 단백질에의 하이브리드 항원의 결합은 하나의 열 충격 단백질이 될 수도 있는 적어도 하나의 다른 단백질의 존재에 의해 촉진될 수도 있다. Based on the foregoing, hybrid antigens can be prepared and their ability to bind heat shock proteins can be tested. In some embodiments, binding of the hybrid antigen to a particular heat shock protein may be facilitated by the presence of at least one other protein that may be one heat shock protein.
예를 들어, 열 충격 단백질과 하이브리드 항원의 결합은 방사활성, 형광, 효소 또는 색소 표지와 같은 검출가능한 표지를 가지고 하이브리드 항원을 표지하고, 결합이 발생가능할 것으로 예상되는 조건하에서 열 충격 단백질과 상기 하이브리드 항원을 결합시키고, 그 후 비결합 하이브리드 항원을 제거하는 동안 열 충격 단백질을 분리하고, 및 표지된 하이브리드 항원이 열 충격 단백질에 고정되어 있는 지를 측정함으로써 평가될 수 있다. 본 발명을 한정하는 것이 아닌 특정 실시예로서, 열 충격 단백질 BiP에 결합하는 하이브리드 항원의 능력은 2 μg BiP과 최대 약 1150 pmole의 방사활성 표지된 하이브리드 항원을 50 mM Tris HCI (pH 7.5), 200 mM NaCl, 및 1 mM Na2EDTA를 포함하는 완충액 내에서 최종 부피가 50 μl가 되게 37도 섭씨에서 30분 동안 결합시켜 평가될 수 있다. 비결합 하이브리드 항원은 그 후 100g에서 원심분리하고 1 ml Sephadex-G 컬럼에서 2분 동안 탈염(desalting)함으로써 결합된 BiP-하이브리드 항원으로부터 제거될 수 있다. Penefsky, J. Biol . Chem. 252: 2891 (1977). 레진에 결합하는 것을 막기 위하여, 컬럼은 먼저 동일한 완충액에서 소 혈청 알부민 100 μl로 처리되고 위와 같이 원심분리될 수 있다. 결합된 하이브리드 항원은 그 후 액상 신틸레이션 카운팅(liquid scintillation counting)으로 정량화될 수 있다. Flynn et al., Science 245: 385-390 (1989) 참조.For example, the binding of a heat shock protein to a hybrid antigen can be performed by labeling the hybrid antigen with a detectable label, such as radioactive, fluorescent, enzymatic or pigmented labels, and under conditions where binding is expected to occur. It can be assessed by binding the antigen, then separating the heat shock protein during removal of the unbound hybrid antigen, and measuring whether the labeled hybrid antigen is immobilized on the heat shock protein. In certain non-limiting embodiments, the ability of the hybrid antigen to bind to the heat shock protein BiP is characterized by the presence of 2 μg BiP and up to about 1150 pmole of radioactively labeled hybrid antigen in 50 mM Tris HCI (pH 7.5), 200. It can be assessed by binding for 30 minutes at 37 degrees Celsius so that the final volume is 50 μl in a buffer comprising mM NaCl, and 1 mM Na 2 EDTA. Unbound hybrid antigen can then be removed from bound BiP-Hybrid antigen by centrifugation at 100 g and desalting for 2 minutes on a 1 ml Sephadex-G column. Penefsky, J. Biol . Chem. 252: 2891 (1977). To prevent binding to the resin, the column may first be treated with 100 μl of bovine serum albumin in the same buffer and centrifuged as above. Bound hybrid antigens can then be quantified by liquid scintillation counting. See Flynn et al., Science 245: 385-390 (1989).
ATP 가수분해가 많은 알려진 열 충격 단백질로부터 펩타이드의 방출을 유도할 수 있기 때문에, ATPase 활성의 양은 종종 열 충격 단백질에 결합한 하이브리드 항원의 양을 정량하기 위해 사용될 수 있다. 그러한 분석이 수행되는 방법의 예는 Flynn et al., Science 245: 385-390 (1989)에 설명되어 있다.Since ATP hydrolysis can induce release of peptides from many known heat shock proteins, the amount of ATPase activity can often be used to quantify the amount of hybrid antigen bound to the heat shock protein. Examples of how such an assay is performed are described in Flynn et al., Science 245: 385-390 (1989).
열 충격 단백질-결합 도메인은 선택되고 따라서 하이브리드 항원은 생체 외 또는 생체 내에서 BiP, hsp70, gp96, 또는 hsp90, 또는 수많은 전술한 열 충격 단백질 패밀리에 단독 또는 hsp40, 또는 hsp60와 같은 부속(accessory) 열 충격 단백질과 함께 결합할 것이다.Heat shock protein-binding domains are selected so that the hybrid antigen is either biP, hsp70, gp96, or hsp90, or accessory columns such as hsp40, or hsp60, alone or in numerous of the aforementioned heat shock protein families in vitro or in vivo. Will combine together with the impact protein.
이러한 기준을 만족시키는 비-제한적 펩타이드의 예는 Blond-Elguindi et al., Cell 75:717-728 (1993)에 설명된 것처럼 하나 이상의 열 충격 단백질에 잘 결합하는 것으로 알려진 항원 라이브러리를 패닝(panning)함으로써 식별될 수 있다:Examples of non-limiting peptides that meet this criterion include panning antigen libraries known to bind well to one or more heat shock proteins, as described in Blond-Elguindi et al., Cell 75: 717-728 (1993). Can be identified by:
Leu Phe Trp Pro Phe Glu Trp Ile (서열번호: 153);Leu Phe Trp Pro Phe Glu Trp Ile (SEQ ID NO .: 153);
Asp Gly Val Gly Ser Phe Ile Gly (서열번호: 154);Asp Gly Val Gly Ser Phe Ile Gly (SEQ ID NO: 154);
Glu Ser Leu Trp Asn Pro Gln Cys (서열번호: 155);Glu Ser Leu Trp Asn Pro Gln Cys (SEQ ID NO: 155);
Leu His Phe Asp Val Leu Trp Arg (서열번호: 156);Leu His Phe Asp Val Leu Trp Arg (SEQ ID NO: 156);
Cys His Leu Lys Met Val Pro Trp (서열번호: 157);Cys His Leu Lys Met Val Pro Trp (SEQ ID NO: 157);
Asn Ser Val Leu Val Cys Glu Leu (서열번호: 158);Asn Ser Val Leu Val Cys Glu Leu (SEQ ID NO: 158);
Asp Arg Gly His Ser Thr Tyr Ser (서열번호: 159);Asp Arg Gly His Ser Thr Tyr Ser (SEQ ID NO: 159);
Asp Val Trp Gly Trp Val Thr Trp (서열번호: 160);Asp Val Trp Gly Trp Val Thr Trp (SEQ ID NO .: 160);
Ile Gln Phe Arg Val Glu Leu Phe (서열번호: 161);Ile Gln Phe Arg Val Glu Leu Phe (SEQ ID NO: 161);
Leu Trp Leu Glu Leu Ser Leu Ser (서열번호: 162);Leu Trp Leu Glu Leu Ser Leu Ser (SEQ ID NO: 162);
Val Gly Ile Cys Ala Leu Phe Gly (서열번호: 163);Val Gly Ile Cys Ala Leu Phe Gly (SEQ ID NO: 163);
Pro Tyr Pro Ser Gly Leu Asp Ser (서열번호: 164);Pro Tyr Pro Ser Gly Leu Asp Ser (SEQ ID NO: 164);
Phe Trp Gly Val Leu Pro Tyr Pro (서열번호: 165);Phe Trp Gly Val Leu Pro Tyr Pro (SEQ ID NO: 165);
Phe Thr His Gly Ile Ser Leu Tyr (서열번호: 166);Phe Thr His Gly Ile Ser Leu Tyr (SEQ ID NO: 166);
Asn His Ser Phe Gly Gly Ser Thr (서열번호: 167);Asn His Ser Phe Gly Gly Ser Thr (SEQ ID NO: 167);
Val Asp Tyr Val Tyr Phe His His (서열번호: 168);Val Asp Tyr Val Tyr Phe His His (SEQ ID NO: 168);
Phe Leu Asp Ile Ile Gly Tyr Gly (서열번호: 169);Phe Leu Asp Ile Ile Gly Tyr Gly (SEQ ID NO: 169);
Trp Asp Asp Leu Leu His Gly Arg (서열번호: 170);Trp Asp Asp Leu Leu His Gly Arg (SEQ ID NO: 170);
Leu Arg Leu Leu Gly Thr Leu Asn (서열번호: 171);Leu Arg Leu Leu Gly Thr Leu Asn (SEQ ID NO: 171);
Phe Glu Gln His Asn Gln Glu Pro (서열번호: 172);Phe Glu Gln His Asn Gln Glu Pro (SEQ ID NO: 172);
Phe Val Gly Thr Val Thr Trp Ser (서열번호: 173);Phe Val Gly Thr Val Thr Trp Ser (SEQ ID NO: 173);
Leu Trp Ala Leu Thr Tyr Arg Gly (서열번호: 174);Leu Trp Ala Leu Thr Tyr Arg Gly (SEQ ID NO: 174);
Ser Trp Gly Ser Asn Gly Gly Phe (서열번호: 175);Ser Trp Gly Ser Asn Gly Gly Phe (SEQ ID NO: 175);
Asp Met Trp Arg Arg Ala Val Gln (서열번호: 176); Asp Met Trp Arg Arg Ala Val Gln (SEQ ID NO: 176);
Cys Arg Val Ile Tyr His Ala Thr (서열번호: 177);Cys Arg Val Ile Tyr His Ala Thr (SEQ ID NO: 177);
Met Val Val Ala Arg Cys Gly His (서열번호: 178);Met Val Val Ala Arg Cys Gly His (SEQ ID NO: 178);
His Met Trp Ile Asn Trp Val Gln (서열번호: 179);His Met Trp Ile Asn Trp Val Gln (SEQ ID NO: 179);
Cys Ala Gly Arg Cys Phe Gly Tyr (서열번호: 180);Cys Ala Gly Arg Cys Phe Gly Tyr (SEQ ID NO: 180);
Cys Thr His Val Leu Ala Tyr Ser (서열번호: 181); Cys Thr His Val Leu Ala Tyr Ser (SEQ ID NO: 181);
Ser Trp Met Pro Trp Leu Thr Met (서열번호: 182);Ser Trp Met Pro Trp Leu Thr Met (SEQ ID NO: 182);
Leu Glu Trp Cys Ile Trp Arg Tyr (서열번호: 183);Leu Glu Trp Cys Ile Trp Arg Tyr (SEQ ID NO: 183);
Cys Leu Ala Cys Ile Ile His Ser (서열번호: 184);Cys Leu Ala Cys Ile Ile His Ser (SEQ ID NO: 184);
Phe Trp Phe Pro Trp Asp Arg Ser (서열번호: 185);Phe Trp Phe Pro Trp Asp Arg Ser (SEQ ID NO: 185);
Trp Arg Thr Gly Val Phe His Gly (서열번호: 186);Trp Arg Thr Gly Val Phe His Gly (SEQ ID NO: 186);
Met His Leu Arg Val Ala Asp Arg (서열번호: 187); Met His Leu Arg Val Ala Asp Arg (SEQ ID NO: 187);
Ala Leu Asp Leu Tyr Leu Tyr Val (서열번호: 188); Ala Leu Asp Leu Tyr Leu Tyr Val (SEQ ID NO: 188);
Phe Phe Trp Phe Thr Leu Lys Glu (서열번호: 189); Phe Phe Trp Phe Thr Leu Lys Glu (SEQ ID NO: 189);
Leu Ser Phe Ala Gly Trp Gly Val (서열번호: 190); Leu Ser Phe Ala Gly Trp Gly Val (SEQ ID NO: 190);
Met Met Met Leu Gly Arg Ala Pro (서열번호: 191); Met Met Met Leu Gly Arg Ala Pro (SEQ ID NO: 191);
Trp Ser Phe Tyr Thr Trp Leu Asn (서열번호: 192); Trp Ser Phe Tyr Thr Trp Leu Asn (SEQ ID NO: 192);
Phe Val Trp Met Arg Trp Ile Asp (서열번호: 193); Phe Val Trp Met Arg Trp Ile Asp (SEQ ID NO: 193);
Met Gln Val Asn Thr Pro Asp Asn (서열번호: 194); Met Gln Val Asn Thr Pro Asp Asn (SEQ ID NO: 194);
Phe Trp Gly Trp Leu Ile Pro Trp (서열번호: 195);Phe Trp Gly Trp Leu Ile Pro Trp (SEQ ID NO: 195);
Trp Gly Trp Val Trp Trp Asp (서열번호: 196); Trp Gly Trp Val Trp Trp Asp (SEQ ID NO: 196);
Trp Ile Phe Pro Trp Ile Gln Leu (서열번호: 197); Trp Ile Phe Pro Trp Ile Gln Leu (SEQ ID NO: 197);
Trp Met Phe Asn Trp Pro Trp Tyr (서열번호: 198); Trp Met Phe Asn Trp Pro Trp Tyr (SEQ ID NO: 198);
Met Asn Met Ile Val Leu Asp Lys (서열번호: 199); Met Asn Met Ile Val Leu Asp Lys (SEQ ID NO: 199);
Phe Trp Gly Trp Pro Gly Trp Ser (서열번호: 200); Phe Trp Gly Trp Pro Gly Trp Ser (SEQ ID NO: 200);
Trp Leu Ile Arg Val Gly Thr Ala (서열번호: 201); Trp Leu Ile Arg Val Gly Thr Ala (SEQ ID NO: 201);
Gly Leu Leu Thr His Leu Ile Trp (서열번호: 202); Gly Leu Leu Thr His Leu Ile Trp (SEQ ID NO: 202);
Leu Trp Trp Leu Asn Val His Gly (서열번호: 203); Leu Trp Trp Leu Asn Val His Gly (SEQ ID NO: 203);
Trp Trp Trp Ile Asn Asp Glu Ser (서열번호: 204); Trp Trp Trp Ile Asn Asp Glu Ser (SEQ ID NO: 204);
Ala Asn Pro Ser Leu Ala Thr Tyr (서열번호: 205); Ala Asn Pro Ser Leu Ala Thr Tyr (SEQ ID NO: 205);
Trp Leu Gln Gly Trp Trp Gly Trp (서열번호: 206); Trp Leu Gln Gly Trp Trp Gly Trp (SEQ ID NO: 206);
Met Met Pro Val Thr Ser Phe Arg (서열번호: 207); Met Met Pro Val Thr Ser Phe Arg (SEQ ID NO: 207);
Gly Trp Met Asp Trp Trp Tyr Tyr (서열번호: 208); Gly Trp Met Asp Trp Trp Tyr Tyr (SEQ ID NO: 208);
Leu Ala Ser Met Arg Asn Ser Met (서열번호: 209); Leu Ala Ser Met Arg Asn Ser Met (SEQ ID NO: 209);
Asp Leu Met Arg Trp Leu Gly Leu (서열번호: 210); Asp Leu Met Arg Trp Leu Gly Leu (SEQ ID NO: 210);
Tyr Phe Tyr Ala Trp Trp Leu Asp (서열번호: 211); Tyr Phe Tyr Ala Trp Trp Leu Asp (SEQ ID NO: 211);
Leu Gly His Leu Trp Thr Gln Val (서열번호: 212); Leu Gly His Leu Trp Thr Gln Val (SEQ ID NO: 212);
Leu Trp Trp Arg Asp Val Met Ala (서열번호: 213); Leu Trp Trp Arg Asp Val Met Ala (SEQ ID NO: 213);
Phe Ile Trp Trp Ala Pro Leu Ala (서열번호: 214); Phe Ile Trp Trp Ala Pro Leu Ala (SEQ ID NO: 214);
Gly Ser Val Gly Gly Gly Val Val (서열번호: 215); Gly Ser Val Gly Gly Gly Val Val (SEQ ID NO: 215);
Asp Ser His Asp Asp Trp Arg Met (서열번호: 216); Asp Ser His Asp Asp Trp Arg Met (SEQ ID NO: 216);
Phe Trp Arg Phe Asp Tyr Tyr Phe (서열번호: 217);Phe Trp Arg Phe Asp Tyr Tyr Phe (SEQ ID NO: 217);
Trp Thr Trp Trp Glu Trp Leu Ala (서열번호: 218); Trp Thr Trp Trp Glu Trp Leu Ala (SEQ ID NO: 218);
Trp Leu Tip Asp Trp Ile Val Val (서열번호: 219); Trp Leu Tip Asp Trp Ile Val Val (SEQ ID NO: 219);
Gly Trp Thr Trp Phe Phe Asp Met (서열번호: 220); Gly Trp Thr Trp Phe Phe Asp Met (SEQ ID NO: 220);
Ala Trp Trp Gln His Phe Ile Val (서열번호: 221); Ala Trp Trp Gln His Phe Ile Val (SEQ ID NO: 221);
Leu Trp Trp Asp Ile Ile Thr Gly (서열번호: 222); Leu Trp Trp Asp Ile Ile Thr Gly (SEQ ID NO: 222);
Phe Thr Tyr Gly Ser Arg Trp Leu (서열번호: 223); Phe Thr Tyr Gly Ser Arg Trp Leu (SEQ ID NO: 223);
Phe Ser Leu Trp Pro Leu Ala Trp (서열번호: 224); Phe Ser Leu Trp Pro Leu Ala Trp (SEQ ID NO: 224);
Gly Ile Ile Leu Gly Tyr Asn Val (서열번호: 225); Gly Ile Ile Leu Gly Tyr Asn Val (SEQ ID NO: 225);
Ser Trp Met Thr Trp Ile Glu His (서열번호: 226); Ser Trp Met Thr Trp Ile Glu His (SEQ ID NO: 226);
Gly Trp Trp Val Thr Trp Pro Trp (서열번호: 227); Gly Trp Trp Val Thr Trp Pro Trp (SEQ ID NO: 227);
Val Val Ser Pro Trp Trp Leu Gly (서열번호: 228); Val Val Ser Pro Trp Trp Leu Gly (SEQ ID NO: 228);
Asn Val Leu Ser Arg Gly Phe Ser (서열번호: 229); Asn Val Leu Ser Arg Gly Phe Ser (SEQ ID NO: 229);
Ser Phe Glu Ser Leu Gly Gly Leu (서열번호: 230); Ser Phe Glu Ser Leu Gly Gly Leu (SEQ ID NO .: 230);
Ile Thr Lys Gly Ser Ser Phe Pro (서열번호: 231); Ile Thr Lys Gly Ser Ser Phe Pro (SEQ ID NO: 231);
Leu Asp Trp Ala Arg Lys Leu Arg (서열번호: 232); Leu Asp Trp Ala Arg Lys Leu Arg (SEQ ID NO: 232);
Thr Ala Trp Asn Leu Leu Gly Tyr (서열번호: 233); Thr Ala Trp Asn Leu Leu Gly Tyr (SEQ ID NO: 233);
Phe Gly Gln Gly Ile Lys His Val (서열번호: 234); Phe Gly Gln Gly Ile Lys His Val (SEQ ID NO: 234);
Asp Val Val Trp Gin Arg Leu Leu (서열번호: 235); Asp Val Val Trp Gin Arg Leu Leu (SEQ ID NO: 235);
Tyr Val Asp Arg Phe Ile Gly Trp (서열번호: 236); Tyr Val Asp Arg Phe Ile Gly Trp (SEQ ID NO: 236);
Lys Met Ala Arg Pro Glu Gly Asn (서열번호: 237); Lys Met Ala Arg Pro Glu Gly Asn (SEQ ID NO: 237);
Leu Gly Arg Trp Gly His Glu Ser (서열번호: 238); Leu Gly Arg Trp Gly His Glu Ser (SEQ ID NO: 238);
Ser Ile Trp Ser Leu Leu Val Leu (서열번호: 239); Ser Ile Trp Ser Leu Leu Val Leu (SEQ ID NO: 239);
Val Trp Leu Asp Leu Leu Leu Ser (서열번호: 240); Val Trp Leu Asp Leu Leu Leu Ser (SEQ ID NO: 240);
Tyr Leu Thr Asp Ser Leu Phe Gly (서열번호: 241); Tyr Leu Thr Asp Ser Leu Phe Gly (SEQ ID NO: 241);
Thr Trp Trp Pro Ser Ile Thr Trp (서열번호: 242); Thr Trp Trp Pro Ser Ile Thr Trp (SEQ ID NO: 242);
Tyr Gly Leu Trp Trp Phe Pro Trp (서열번호: 243); Tyr Gly Leu Trp Trp Phe Pro Trp (SEQ ID NO: 243);
Phe Ser Pro Ala Asp Thr Arg Tyr (서열번호: 244); Phe Ser Pro Ala Asp Thr Arg Tyr (SEQ ID NO: 244);
Cys Asn Arg Leu Gln He Asp Cys (서열번호: 245); Cys Asn Arg Leu Gln He Asp Cys (SEQ ID NO: 245);
Ser Leu Val Ala Ala Arg Asn Leu (서열번호: 246); Ser Leu Val Ala Ala Arg Asn Leu (SEQ ID NO: 246);
Phe Thr He His Asn Val Ala Val (서열번호: 247); Phe Thr He His Asn Val Ala Val (SEQ ID NO: 247);
Met Gly Pro Leu Gly Pro Leu Leu (서열번호: 248); Met Gly Pro Leu Gly Pro Leu Leu (SEQ ID NO: 248);
Arg Gln Leu Ser Glu Leu Phe Val (서열번호: 249); Arg Gln Leu Ser Glu Leu Phe Val (SEQ ID NO: 249);
Arg Val Val Cys Gln Ala Leu Leu (서열번호: 250); Arg Val Val Cys Gln Ala Leu Leu (SEQ ID NO: 250);
Trp Pro His Leu Trp Trp Leu Asp (서열번호: 251); Trp Pro His Leu Trp Trp Leu Asp (SEQ ID NO: 251);
Trp Met Asp Trp Val Trp His Thr (서열번호: 252); Trp Met Asp Trp Val Trp His Thr (SEQ ID NO: 252);
Trp Trp Gly Tyr Leu Ile Cys Gln (서열번호: 253); Trp Trp Gly Tyr Leu Ile Cys Gln (SEQ ID NO: 253);
Phe Arg Gly Leu Ser Glu Gly Pro (서열번호: 254); Phe Arg Gly Leu Ser Glu Gly Pro (SEQ ID NO: 254);
Ser Trp Phe Asp Trp Leu Val Ala (서열번호: 255); Ser Trp Phe Asp Trp Leu Val Ala (SEQ ID NO: 255);
Val Val Met Trp Tyr Ser Val Asp (서열번호: 256); Val Val Met Trp Tyr Ser Val Asp (SEQ ID NO: 256);
Trp Gly Trp Ser Leu Ala Thr (서열번호: 257); Trp Gly Trp Ser Leu Ala Thr (SEQ ID NO: 257);
Leu Gly Trp Phe Asp Arg Phe Phe (서열번호: 258); Leu Gly Trp Phe Asp Arg Phe Phe (SEQ ID NO: 258);
Ala Trp Trp Trp Pro Thr Tyr Val (서열번호: 259); Ala Trp Trp Trp Pro Thr Tyr Val (SEQ ID NO: 259);
Gly Phe Leu Ser Ser Trp Phe Leu (서열번호: 260); Gly Phe Leu Ser Ser Trp Phe Leu (SEQ ID NO: 260);
Gly Val Ile Asn Cys Ala Gly Thr (서열번호: 261); Gly Val Ile Asn Cys Ala Gly Thr (SEQ ID NO: 261);
Val Cys Ala Arg Ala Ala His Leu (서열번호: 262); Val Cys Ala Arg Ala Ala His Leu (SEQ ID NO: 262);
Gly Asn Ser Tyr Gly Asp Gly Gly (서열번호: 263); Gly Asn Ser Tyr Gly Asp Gly Gly (SEQ ID NO: 263);
Gly Phe Leu Ser Ser Trp Phe Leu (서열번호: 264); Gly Phe Leu Ser Ser Trp Phe Leu (SEQ ID NO: 264);
Phe Asp Gln Pro Gly Arg Phe Leu (서열번호: 265); Phe Asp Gln Pro Gly Arg Phe Leu (SEQ ID NO: 265);
Arg Ser His Ala Thr Gly Val Val (서열번호: 266); Arg Ser His Ala Thr Gly Val Val (SEQ ID NO: 266);
Gly Tyr Trp Ala Met Met Ser Trp (서열번호: 267); Gly Tyr Trp Ala Met Met Ser Trp (SEQ ID NO: 267);
Cys His Ser Met Trp Asp Gly Leu (서열번호: 268); Cys His Ser Met Trp Asp Gly Leu (SEQ ID NO: 268);
Phe Ile Trp Arg Gly Trp Pro His (서열번호: 269); Phe Ile Trp Arg Gly Trp Pro His (SEQ ID NO: 269);
Leu Ser Phe Leu Gly Gly Arg Leu (서열번호: 270); Leu Ser Phe Leu Gly Gly Arg Leu (SEQ ID NO: 270);
Phe Ser Gly Val Arg Gln Pro Asn (서열번호: 271); Phe Ser Gly Val Arg Gln Pro Asn (SEQ ID NO: 271);
Trp Gly Trp Met Pro Phe Tyr Tyr (서열번호: 272); Trp Gly Trp Met Pro Phe Tyr Tyr (SEQ ID NO: 272);
Phe Thr Arg Pro Ala Val Val Asp (서열번호: 273); Phe Thr Arg Pro Ala Val Val Asp (SEQ ID NO: 273);
Asp Leu Trp Thr Trp Leu Gly Leu (서열번호: 274); Asp Leu Trp Thr Trp Leu Gly Leu (SEQ ID NO: 274);
Cys Asp Thr Ala Ala Val Ala Asp (서열번호: 275); Cys Asp Thr Ala Ala Val Ala Asp (SEQ ID NO: 275);
Trp Trp Val Lys His His Met Leu (서열번호: 276);Trp Trp Val Lys His His Met Leu (SEQ ID NO: 276);
Ile Ala Phe Leu Arg Asp Asn Arg (서열번호: 277); Ile Ala Phe Leu Arg Asp Asn Arg (SEQ ID NO: 277);
Leu Ala Arg Pro Asp His Tyr Ser (서열번호: 278);Leu Ala Arg Pro Asp His Tyr Ser (SEQ ID NO: 278);
Met Glu Ser Lys Arg Trp Thr Val (서열번호: 279);Met Glu Ser Lys Arg Trp Thr Val (SEQ ID NO: 279);
Met Ile Leu Lys Gly Tyr Ser Aig (서열번호: 280);Met Ile Leu Lys Gly Tyr Ser Aig (SEQ ID NO: 280);
Ala Pro Ser Asp Tyr Asp Glu Ser (서열번호: 281);Ala Pro Ser Asp Tyr Asp Glu Ser (SEQ ID NO: 281);
His Trp Leu Arg Ser Lys Arg Thr (서열번호: 282);His Trp Leu Arg Ser Lys Arg Thr (SEQ ID NO: 282);
Gly Ala Arg Val Trp Asn Tyr Gln (서열번호: 283);Gly Ala Arg Val Trp Asn Tyr Gln (SEQ ID NO: 283);
Leu Ser Asn Trp Asn Met Arg Leu (서열번호: 284);Leu Ser Asn Trp Asn Met Arg Leu (SEQ ID NO: 284);
Cys Gly Ala Ala Gln Gln Gly Met (서열번호: 285); 및 Cys Gly Ala Ala Gln Gln Gly Met (SEQ ID NO: 285); And
Gly Ser Ser Met Val Val Gln Arg (서열번호: 286). 이러한 기술을 사용하여, Blond-Elguindi는 열 충격 단백질 BiP는 다음의 서열을 가진 7개로 이루어진(heptameric) 영역을 포함하는 폴리펩타이드를 인식한다고 결론지었다.Gly Ser Ser Met Val Val Gln Arg (SEQ ID NO: 286). Using this technique, Blond-Elguindi concluded that the heat shock protein BiP recognizes a polypeptide comprising a seven-hepatic region with the following sequence.
Hy(Trp/X)HyXHyXHy (서열번호: 29) Hy (Trp / X) HyXHyXHy (SEQ ID NO .: 29)
여기에서 Hy는 비친수성 아미노산 잔기, 특히 트립토판, 루신 또는 페닐알라닌 (서열번호: 30)을 의미하고, 및 X는 어떠한 아미노산도 될 수 있다. 이러한 모티프(motif)를 포함하는 높은 친화성 열-충격 단백질 결합 서열은 His Trp Asp Phe Ala Trp Pro Trp (서열번호: 1); 및 Phe Trp Gly Leu Trp Pro Trp Glu (서열번호: 4)를 포함한다. Hy here means non-hydrophilic amino acid residues, in particular tryptophan, leucine or phenylalanine (SEQ ID NO: 30), and X can be any amino acid. High affinity heat-shock protein binding sequences comprising such motifs include His Trp Asp Phe Ala Trp Pro Trp (SEQ ID NO: 1); And Phe Trp Gly Leu Trp Pro Trp Glu (SEQ ID NO: 4).
다른 열 충격 단백질 결합 모티프 또한 식별될 수 있다. 예를 들어, Auger et al., Nature Medicine 2: 306-310 (1996)는 두 개의 펜타펩타이드 결합 모티프를 확인하였다.Other heat shock protein binding motifs can also be identified. For example, Auger et al., Nature Medicine 2: 306-310 (1996) identified two pentapeptide binding motifs.
류머티스성 관절염과 관련된 HLA-DR 타입의Type of HLA-DR associated with rheumatoid arthritis
Gln Lys Arg Ala Ala (서열번호: 5) 및Gln Lys Arg Ala Ala (SEQ ID NO .: 5) and
Arg Arg Arg Ala Ala (서열번호: 6)은 Arg Arg Arg Ala Ala (SEQ ID NO .: 6)
열 충격 단백질과 결합한다.Combine with heat shock protein.
열 충격 결합 모티프는 또한 비친수성 아미노산들이 풍부한 7 내지 15개 잔기의 긴 펩타이드들로 구성된 것으로 확인되었다.Heat shock binding motifs have also been identified as consisting of 7 to 15 residues of long peptides rich in non-hydrophilic amino acids.
Lys Arg Gln Ile Tyr Asp Leu Glu Met Asn Arg Leu Gly Lys (서열번호: 287);Lys Arg Gln Ile Tyr Asp Leu Glu Met Asn Arg Leu Gly Lys (SEQ ID NO: 287);
Leu Ser Ser Leu Phe Arg Pro Lys Arg Arg Pro Ile Tyr Lys Ser (서열번호: 288);Leu Ser Ser Leu Phe Arg Pro Lys Arg Arg Pro Ile Tyr Lys Ser (SEQ ID NO: 288);
Lys Leu Ile Gly Val Leu Ser Ser Leu Phe Arg Pro Lys (서열번호: 289);Lys Leu Ile Gly Val Leu Ser Ser Leu Phe Arg Pro Lys (SEQ ID NO: 289);
Arg Arg Pro Ile Tyr Lys Ser Asp Val Gly Met Ala His Phe Arg (서열번호: 290);Arg Arg Pro Ile Tyr Lys Ser Asp Val Gly Met Ala His Phe Arg (SEQ ID NO: 290);
Cys Lys Ile Gln Ser Thr Pro Val Lys Gln Ser (서열번호: 291);Cys Lys Ile Gln Ser Thr Pro Val Lys Gln Ser (SEQ ID NO: 291);
Tyr His Cys Asp Gly Phe Gln Asn Glu (서열번호: 292);Tyr His Cys Asp Gly Phe Gln Asn Glu (SEQ ID NO: 292);
Val Gly Ile Asp Leu Gly Thr Thr Tyr Ser Cys (서열번호: 293);Val Gly Ile Asp Leu Gly Thr Thr Tyr Ser Cys (SEQ ID NO: 293);
Ser Asn Gly Ser Leu Gln Cys Arg Ile Cys (서열번호: 294)Ser Asn Gly Ser Leu Gln Cys Arg Ile Cys (SEQ ID NO: 294)
(Flynn et al., Science 245: 385-390 (1989)),(Flynn et al., Science 245: 385-390 (1989)),
게다가, 다른 열 충격 단백질 결합 펩타이드는 다음을 포함한다:In addition, other heat shock protein binding peptides include:
Gly Lys Trp Val Tyr Ile (서열번호: 295);Gly Lys Trp Val Tyr Ile (SEQ ID NO: 295);
Ala Lys Arg Glu Thr Lys (서열번호: 296); Ala Lys Arg Glu Thr Lys (SEQ ID NO: 296);
Lys Trp Val His Leu Phe (서열번호: 297); Lys Trp Val His Leu Phe (SEQ ID NO: 297);
Arg Leu Val Leu Val Leu (서열번호: 298); Arg Leu Val Leu Val Leu (SEQ ID NO: 298);
Trp Lys Trp Gly Ile Tyr (서열번호: 299); Trp Lys Trp Gly Ile Tyr (SEQ ID NO: 299);
Ser Ser His Ala Ser Ala (서열번호: 300); Ser Ser His Ala Ser Ala (SEQ ID NO: 300);
Trp Gly Pro Trp Ser Phe (서열번호: 301); Trp Gly Pro Trp Ser Phe (SEQ ID NO: 301);
Ala Ile Pro Gly Lys Val (서열번호: 302); Ala Ile Pro Gly Lys Val (SEQ ID NO: 302);
Arg Val His Asp Pro Ala (서열번호: 303); Arg Val His Asp Pro Ala (SEQ ID NO: 303);
Arg Ser Val Ser Ser Phe (서열번호: 304); Arg Ser Val Ser Ser Phe (SEQ ID NO: 304);
Leu Gly Thr Arg Lys Gly (서열번호: 305); Leu Gly Thr Arg Lys Gly (SEQ ID NO: 305);
Lys Asp Pro Leu Phe Asn (서열번호: 306); Lys Asp Pro Leu Phe Asn (SEQ ID NO: 306);
Leu Ser Gln His Thr Asn (서열번호: 307); Leu Ser Gln His Thr Asn (SEQ ID NO: 307);
Asn Arg Leu Leu Leu Thr (서열번호: 308); Asn Arg Leu Leu Leu Thr (SEQ ID NO: 308);
Tyr Pro Leu Trp Val Ile (서열번호: 309); Tyr Pro Leu Trp Val Ile (SEQ ID NO: 309);
Leu Leu Ile Ile Asp Arg (서열번호: 310); Leu Leu Ile Ile Asp Arg (SEQ ID NO: 310);
Arg Val Ile Ser Leu Gln (서열번호: 311); Arg Val Ile Ser Leu Gln (SEQ ID NO: 311);
Glu Val Ser Arg Glu Asp (서열번호: 312); Glu Val Ser Arg Glu Asp (SEQ ID NO: 312);
Ser Ile Leu Arg Ser Thr (서열번호: 313); Ser Ile Leu Arg Ser Thr (SEQ ID NO: 313);
Pro Gly Leu Val Trp Leu (서열번호: 314); Pro Gly Leu Val Trp Leu (SEQ ID NO: 314);
Val Lys Lys Leu Tyr Ile (서열번호: 315); Val Lys Lys Leu Tyr Ile (SEQ ID NO .: 315);
Asn Asn Arg Leu Leu Asp (서열번호: 316); Asn Asn Arg Leu Leu Asp (SEQ ID NO: 316);
Ser Lys Gly Arg Trp Gly (서열번호: 317); Ser Lys Gly Arg Trp Gly (SEQ ID NO: 317);
Ile Arg Pro Ser Gly Ile (서열번호: 318); Ile Arg Pro Ser Gly Ile (SEQ ID NO: 318);
Ala Ser Leu Cys Pro Thr (서열번호: 319); Ala Ser Leu Cys Pro Thr (SEQ ID NO: 319);
Asp Val Pro Gly Leu Arg (서열번호: 320); Asp Val Pro Gly Leu Arg (SEQ ID NO: 320);
Arg His Arg Glu Val Gln (서열번호: 321); Arg His Arg Glu Val Gln (SEQ ID NO: 321);
Leu Ala Arg Lys Arg Ser (서열번호: 322); Leu Ala Arg Lys Arg Ser (SEQ ID NO: 322);
Ser Val Leu Asp His Val (서열번호: 323); Ser Val Leu Asp His Val (SEQ ID NO: 323);
Asn Leu Leu Arg Arg Ala (서열번호: 324); Asn Leu Leu Arg Arg Ala (SEQ ID NO: 324);
Ser Gly Ile Ser Ala Trp (서열번호: 325); Ser Gly Ile Ser Ala Trp (SEQ ID NO: 325);
Phe Tyr Phe Trp Val Arg (서열번호: 326); Phe Tyr Phe Trp Val Arg (SEQ ID NO: 326);
Lys Leu Phe Leu Pro Leu (서열번호: 327); Lys Leu Phe Leu Pro Leu (SEQ ID NO .: 327);
Thr Pro Thr Leu Ser Asp (서열번호: 328); Thr Pro Thr Leu Ser Asp (SEQ ID NO: 328);
Thr His Ser Leu Ile Leu (서열번호: 329); Thr His Ser Leu Ile Leu (SEQ ID NO .: 329);
Leu Leu Leu Leu Ser Arg (서열번호: 330); Leu Leu Leu Leu Ser Arg (SEQ ID NO: 330);
Leu Leu Arg Val Arg Ser (서열번호: 331); Leu Leu Arg Val Arg Ser (SEQ ID NO: 331);
Glu Arg Arg ser Arg Gly (서열번호: 332); Glu Arg Arg ser Arg Gly (SEQ ID NO: 332);
Arg Met Leu Gln Leu Ala (서열번호: 333); Arg Met Leu Gln Leu Ala (SEQ ID NO: 333);
Age Gly Trp Ala Asn Ser (서열번호: 334); Age Gly Trp Ala Asn Ser (SEQ ID NO: 334);
Arg Pro Phe Tyr Ser Tyr (서열번호: 335); Arg Pro Phe Tyr Ser Tyr (SEQ ID NO: 335);
Ser Ser Ser Trp Asn Ala (서열번호: 336); Ser Ser Ser Trp Asn Ala (SEQ ID NO: 336);
Leu Gly His Leu Glu Glu (서열번호: 337); Leu Gly His Leu Glu Glu (SEQ ID NO .: 337);
Ser Ala Val Thr Asn Thr (서열번호: 338); Ser Ala Val Thr Asn Thr (SEQ ID NO: 338);
Leu Arg Arg Ala Ser Leu (서열번호: 339);Leu Arg Arg Ala Ser Leu (SEQ ID NO .: 339);
Leu Arg Arg Trp Ser Leu (서열번호: 340);Leu Arg Arg Trp Ser Leu (SEQ ID NO: 340);
Lys Trp Val His Leu Phe (서열번호: 341);Lys Trp Val His Leu Phe (SEQ ID NO: 341);
Asn Arg Leu Leu Leu Thr (서열번호: 342);Asn Arg Leu Leu Leu Thr (SEQ ID NO .: 342);
Ala Arg Leu Leu Leu Thr (서열번호: 343);Ala Arg Leu Leu Leu Thr (SEQ ID NO .: 343);
Asn Ala Leu Leu Leu Th. (서열번호: 344);Asn Ala Leu Leu Leu Th. (SEQ ID NO: 344);
Asn Arg Leu Ala Leu Thr (서열번호: 345);Asn Arg Leu Ala Leu Thr (SEQ ID NO: 345);
Asn Leu Leu Arg Leu Thr (서열번호: 346);Asn Leu Leu Arg Leu Thr (SEQ ID NO: 346);
Asn Arg Leu Trp Leu Thr (서열번호: 347);Asn Arg Leu Trp Leu Thr (SEQ ID NO: 347);
Asn Arg Leu Leu Leu Ala (서열번호: 348);Asn Arg Leu Leu Leu Ala (SEQ ID NO: 348);
Met Gln Glu Arg Ile Thr Leu Lys Asp Tyr Ala Met (서열번호: 349);Met Gln Glu Arg Ile Thr Leu Lys Asp Tyr Ala Met (SEQ ID NO: 349);
Leu Arg Arg Trp Ser Leu Gly (서열번호: 353);Leu Arg Arg Trp Ser Leu Gly (SEQ ID NO .: 353);
Lys Trp Val His Leu Phe Gly (서열번호: 354);Lys Trp Val His Leu Phe Gly (SEQ ID NO: 354);
Asn Arg Leu Leu Leu Thr Gly (서열번호: 355);Asn Arg Leu Leu Leu Thr Gly (SEQ ID NO: 355);
Ala Arg Leu Leu Leu Thr Gly (서열번호: 356);Ala Arg Leu Leu Leu Thr Gly (SEQ ID NO: 356);
Asn Ala Leu Leu Leu Thr Gly (서열번호: 357);Asn Ala Leu Leu Leu Thr Gly (SEQ ID NO: 357);
Asn Arg Leu Ala Leu Thr Gly (서열번호: 358);Asn Arg Leu Ala Leu Thr Gly (SEQ ID NO: 358);
Asn Leu Leu Arg Leu Thr Gly (서열번호: 359);Asn Leu Leu Arg Leu Thr Gly (SEQ ID NO: 359);
Asn Arg Leu Trp Leu Thr Gly (서열번호: 360);Asn Arg Leu Trp Leu Thr Gly (SEQ ID NO: 360);
Asn Arg Leu Leu Leu Ala Gly (서열번호: 361);Asn Arg Leu Leu Leu Ala Gly (SEQ ID NO .: 361);
Gly Lys Trp Val Tyr Ile Gly (서열번호: 295);Gly Lys Trp Val Tyr Ile Gly (SEQ ID NO: 295);
Ala Lys Arg Glu Thr Lys Gly (서열번호: 296);Ala Lys Arg Glu Thr Lys Gly (SEQ ID NO: 296);
Lys Trp Val His Leu Phe Gly (서열번호: 297);Lys Trp Val His Leu Phe Gly (SEQ ID NO: 297);
Arg Leu Val Leu Val Leu Gly (서열번호: 298);Arg Leu Val Leu Val Leu Gly (SEQ ID NO: 298);
Trp Lys Trp Gly Ile Tyr (서열번호: 299);Trp Lys Trp Gly Ile Tyr (SEQ ID NO: 299);
Ser Ser His Ala Ser Ala (서열번호: 300);Ser Ser His Ala Ser Ala (SEQ ID NO: 300);
Trp Gly Pro Trp Ser Phe (서열번호: 301);Trp Gly Pro Trp Ser Phe (SEQ ID NO: 301);
Ala Ile Pro Gly Lys Val (서열번호: 302);Ala Ile Pro Gly Lys Val (SEQ ID NO: 302);
Arg Val His Asp Pro Ala Gly (서열번호: 303);Arg Val His Asp Pro Ala Gly (SEQ ID NO: 303);
Arg Ser Val Ser Ser Phe Gly (서열번호: 304);Arg Ser Val Ser Ser Phe Gly (SEQ ID NO: 304);
Leu Gly Thr Arg Lys Gly Cly (서열번호: 305);Leu Gly Thr Arg Lys Gly Cly (SEQ ID NO: 305);
Lys Asp Pro Leu Phe Asn Gly (서열번호: 306);Lys Asp Pro Leu Phe Asn Gly (SEQ ID NO: 306);
Leu Ser Gln His Thr Asn Gly (서열번호: 307);Leu Ser Gln His Thr Asn Gly (SEQ ID NO: 307);
Asn Arg Leu Leu Leu Thr Gly (서열번호: 308);Asn Arg Leu Leu Leu Thr Gly (SEQ ID NO: 308);
Tyr Pro Leu Trp Val Ile Gly (서열번호: 309);Tyr Pro Leu Trp Val Ile Gly (SEQ ID NO: 309);
Leu Leu Ile Ile Asp Arg Gly (서열번호: 310);Leu Leu Ile Ile Asp Arg Gly (SEQ ID NO .: 310);
Arg Val Ile Ser Leu Gln Gly (서열번호: 311);Arg Val Ile Ser Leu Gln Gly (SEQ ID NO: 311);
Glu Val Ser Arg Glu Asp Gly (서열번호: 312);Glu Val Ser Arg Glu Asp Gly (SEQ ID NO: 312);
Ser Ile Leu Arg Ser Thr Gly (서열번호: 313);Ser Ile Leu Arg Ser Thr Gly (SEQ ID NO: 313);
Pro Gly Leu Val Trp Leu Gly (서열번호: 314);Pro Gly Leu Val Trp Leu Gly (SEQ ID NO: 314);
Val Lys Lys Leu Tyr Ile Gly (서열번호: 315);Val Lys Lys Leu Tyr Ile Gly (SEQ ID NO: 315);
Asn Asn Arg Leu Leu Asp Gly (서열번호: 316);Asn Asn Arg Leu Leu Asp Gly (SEQ ID NO: 316);
Ser Lys Gly Arg Trp Gly Gly (서열번호: 317);Ser Lys Gly Arg Trp Gly Gly (SEQ ID NO: 317);
Ile Arg Pro Ser Gly Ile Gly (서열번호: 318);Ile Arg Pro Ser Gly Ile Gly (SEQ ID NO .: 318);
Ala Ser Leu Cys Pro Thr Gly (서열번호: 319);Ala Ser Leu Cys Pro Thr Gly (SEQ ID NO: 319);
Asp Val Pro Gly Leu Arg Gly (서열번호: 320);Asp Val Pro Gly Leu Arg Gly (SEQ ID NO: 320);
Arg His Arg Glu Val Gln Gly (서열번호: 321);Arg His Arg Glu Val Gln Gly (SEQ ID NO: 321);
Leu Ala Arg Lys Arg Ser Gly (서열번호: 322):Leu Ala Arg Lys Arg Ser Gly (SEQ ID NO .: 322):
Ser Val Leu Asp His Val Gly (서열번호: 323);Ser Val Leu Asp His Val Gly (SEQ ID NO: 323);
Asn Leu Leu Arg Arg Ala Gly (서열번호: 324);Asn Leu Leu Arg Arg Ala Gly (SEQ ID NO: 324);
Ser Gly Ile Ser Ala Trp Gly (서열번호: 325);Ser Gly Ile Ser Ala Trp Gly (SEQ ID NO: 325);
Phe Tyr Phe Trp Val Arg Gly (서열번호: 326);Phe Tyr Phe Trp Val Arg Gly (SEQ ID NO: 326);
Lys Leu Phe Leu Pro Leu Gly (서열번호: 327)Lys Leu Phe Leu Pro Leu Gly (SEQ ID NO .: 327)
Thr Pro Thr Leu Ser Asp Gly (서열번호: 328);Thr Pro Thr Leu Ser Asp Gly (SEQ ID NO: 328);
Thr His Ser Leu Ile Leu Gly (서열번호: 329);Thr His Ser Leu Ile Leu Gly (SEQ ID NO .: 329);
Leu Leu Leu Leu Ser Arg Gly (서열번호: 330);Leu Leu Leu Leu Ser Arg Gly (SEQ ID NO: 330);
Leu Leu Arg Val Arg Ser Gly (서열번호: 331);Leu Leu Arg Val Arg Ser Gly (SEQ ID NO: 331);
Glu Arg Arg ser Arg Gly Gly (서열번호: 332);Glu Arg Arg ser Arg Gly Gly (SEQ ID NO: 332);
Arg Met Leu Gln Leu Ala Gly (서열번호: 333);Arg Met Leu Gln Leu Ala Gly (SEQ ID NO: 333);
Age Gly Trp Ala Asn Ser Gly (서열번호: 334);Age Gly Trp Ala Asn Ser Gly (SEQ ID NO: 334);
Arg Pro Phe Tyr Ser Tyr Gly (서열번호: 335);Arg Pro Phe Tyr Ser Tyr Gly (SEQ ID NO: 335);
Ser Ser Ser Trp Asn Ala Gly (서열번호: 336);Ser Ser Ser Trp Asn Ala Gly (SEQ ID NO: 336);
Leu Gly His Leu Glu Glu Gly (서열번호: 337); 및Leu Gly His Leu Glu Glu Gly (SEQ ID NO .: 337); And
Ser Ala Val Thr Asn Thr Gly (서열번호: 338); Gragerov et at., J. Molec. Biol. 235:848-854 (1994)에 설명된 바와 같음.Ser Ala Val Thr Asn Thr Gly (SEQ ID NO: 338); Gragerov et at., J. Molec. Biol. 235: 848-854 (1994).
다른 열 충격 단백질 결합 도메인은 Phe Tyr Gln Leu Ala Leu Thr (서열번호: ), Phe Tyr Gln Leu Ala Leu Thr Trp (서열번호: ), Arg Lys Leu Phe Phe Asn Leu Arg (서열번호: ), Arg Lys Leu Phe Phe Asn Leu Arg Trp (서열번호: ), Lys Phe Glu Arg Gln (서열번호: ), Asn Ile Val Arg Lys Lys Lys (서열번호: ), 및 Arg Gly Tyr Val Tyr Gln Gly Leu (서열번호: )를 포함한다. Other heat shock protein binding domains are Phe Tyr Gln Leu Ala Leu Thr (SEQ ID NO:), Phe Tyr Gln Leu Ala Leu Thr Trp (SEQ ID NO:), Arg Lys Leu Phe Phe Asn Leu Arg (SEQ ID NO:), Arg Lys Leu Phe Phe Asn Leu Arg Trp (SEQ ID NO:), Lys Phe Glu Arg Gln (SEQ ID NO:), Asn Ile Val Arg Lys Lys Lys (SEQ ID NO:), and Arg Gly Tyr Val Tyr Gln Gly Leu (SEQ ID NO: ).
더욱이, 다른 열 충격 단백질 결합 도메인은 W09922761에 설명된 것들을 포함한다. Xaa는 어떠한 아미노산도 될 수 있다.Moreover, other heat shock protein binding domains include those described in W09922761. Xaa can be any amino acid.
HTTVYGAG (서열번호: 82); HTTVYGAG (SEQ ID NO: 82);
TETPYPTG (서열번호: 83); TETPYPTG (SEQ ID NO: 83);
LTTPFSSG (서열번호: 84); LTTPFSSG (SEQ ID NO: 84);
GVPLTMDG (서열번호: 85);GVPLTMDG (SEQ ID NO: 85);
KLPTVLRG (서열번호: 86);KLPTVLRG (SEQ ID NO: 86);
CRFHGNRG (서열번호: 87); CRFHGNRG (SEQ ID NO: 87);
YTRDFEAG (서열번호: 88);YTRDFEAG (SEQ ID NO: 88);
SSAAGPRG (서열번호: 89);SSAAGPRG (SEQ ID NO: 89);
SLIQYSRG (서열번호: 90);SLIQYSRG (SEQ ID NO: 90);
DALMWPP Xaa G (서열번호: 91);DALMWPP Xaa G (SEQ ID NO: 91);
SS Xaa SLYIG (서열번호: 92);SS Xaa SLYIG (SEQ ID NO: 92);
FNTSTRTG (서열번호: 93)FNTSTRTG (SEQ ID NO: 93)
TVQHVAFG (서열번호: 94);TVQHVAFG (SEQ ID NO: 94);
DYSFPPLG (서열번호: 95);DYSFPPLG (SEQ ID NO: 95);
VGSMESLG (서열번호: 96);VGSMESLG (SEQ ID NO: 96);
F Xaa PMI Xaa SG (서열번호: 97);F Xaa PMI Xaa SG (SEQ ID NO: 97);
APPRVTMG (서열번호: 98);APPRVTMG (SEQ ID NO: 98);
IATKTPKG (서열번호: 99);IATKTPKG (SEQ ID NO: 99);
KPPLFQIG (서열번호: 100);KPPLFQIG (SEQ ID NO: 100);
YHTAHNMG (서열번호: 101);YHTAHNMG (SEQ ID NO: 101);
SYIQATHG (서열번호: 102);SYIQATHG (SEQ ID NO: 102);
SSFATFLG (서열번호: 103);SSFATFLG (SEQ ID NO: 103);
TTPPNFAG (서열번호: 104);TTPPNFAG (SEQ ID NO: 104);
ISLDPRMG (서열번호: 105);ISLDPRMG (SEQ ID NO: 105);
SLPLFGAG (서열번호: 106);SLPLFGAG (SEQ ID NO: 106);
NLLKTTLG (서열번호: 107):NLLKTTLG (SEQ ID NO: 107):
DQNLPRRG (서열번호: 108);DQNLPRRG (SEQ ID NO: 108);
SHFEQLLG (서열번호: 109);SHFEQLLG (SEQ ID NO: 109);
TPQLHHGG (서열번호: 110);TPQLHHGG (SEQ ID NO: 110);
APLDRITG (서열번호: 111);APLDRITG (SEQ ID NO: 111);
FAPLIAHG (서열번호: 112);FAPLIAHG (SEQ ID NO: 112);
SWIQTFMG (서열번호: 113);SWIQTFMG (SEQ ID NO: 113);
NTWPHMYG (서열번호: 114);NTWPHMYG (SEQ ID NO .: 114);
EPLPTTLG (서열번호: 115);EPLPTTLG (SEQ ID NO: 115);
HGPHLFNG (서열번호: 116);HGPHLFNG (SEQ ID NO: 116);
YLNSTLAG (서열번호: 117);YLNSTLAG (SEQ ID NO: 117);
HLHSPSGG (서열번호: 118);HLHSPSGG (SEQ ID NO: 118);
TLPHRLNG (서열번호: 119);TLPHRLNG (SEQ ID NO: 119);
SSPREVHG (서열번호: 120);SSPREVHG (SEQ ID NO: 120);
NQVDTARG (서열번호: 121);NQVDTARG (SEQ ID NO: 121);
YPTPLLTG (서열번호: 122);YPTPLLTG (SEQ ID NO: 122);
HPAAFPWG (서열번호: 123);HPAAFPWG (SEQ ID NO: 123);
LLPHSSAG (서열번호: 124);LLPHSSAG (SEQ ID NO: 124);
LETYTASG (서열번호: 125);LETYTASG (SEQ ID NO: 125);
KYVPLPPG (서열번호: 126);KYVPLPPG (SEQ ID NO: 126);
APLALHAG (서열번호: 127);APLALHAG (SEQ ID NO: 127);
YESLLTKG (서열번호: 128);YESLLTKG (SEQ ID NO: 128);
SHAASGTG (서열번호: 129);SHAASGTG (SEQ ID NO: 129);
GLATVKSG (서열번호: 130);GLATVKSG (SEQ ID NO: 130);
GATSFGLG (서열번호: 131);GATSFGLG (SEQ ID NO: 131);
KPPGPVSG (서열번호: 132);KPPGPVSG (SEQ ID NO: 132);
TLYVSGNG (서열번호: 133);TLYVSGNG (SEQ ID NO: 133);
HAPFKSQG (서열번호: 134);HAPFKSQG (SEQ ID NO: 134);
VAFTRLPG (서열번호: 135);VAFTRLPG (SEQ ID NO: 135);
LPTRTPAG (서열번호: 136);LPTRTPAG (SEQ ID NO: 136);
ASFDLLIG (서열번호: 137);ASFDLLIG (SEQ ID NO: 137);
RMNTEPPG (서열번호: 138);RMNTEPPG (SEQ ID NO: 138);
KMTPLTTG (서열번호: 139);KMTPLTTG (SEQ ID NO: 139);
ANATPLLG (서열번호: 140);ANATPLLG (SEQ ID NO: 140);
TIWPPPVG (서열번호: 141);TIWPPPVG (SEQ ID NO: 141);
QTKVMTTG (서열번호: 142);QTKVMTTG (SEQ ID NO: 142);
NHAVFASG (서열번호: 143);NHAVFASG (SEQ ID NO: 143);
LHAA Xaa TSG (서열번호: 144);LHAA Xaa TSG (SEQ ID NO: 144);
TWQPYFHG (서열번호: 145);TWQPYFHG (SEQ ID NO: 145);
APLALHAG (서열번호: 146);APLALHAG (SEQ ID NO: 146);
TAHDLTVG (서열번호: 147);TAHDLTVG (SEQ ID NO: 147);
NMTNMLTG (서열번호: 148);NMTNMLTG (SEQ ID NO: 148);
GSGLSQDG (서열번호: 149);GSGLSQDG (SEQ ID NO: 149);
TPIKTIYG (서열번호: 150);TPIKTIYG (SEQ ID NO: 150);
SHLYRSSG (서열번호: 151);SHLYRSSG (SEQ ID NO: 151);
YTLVQPL (서열번호: 152);YTLVQPL (SEQ ID NO: 152);
TPDITPTK (서열번호: 153);TPDITPTK (SEQ ID NO: 153);
TYPDLRY (서열번호: 154);TYPDLRY (SEQ ID NO: 154);
DRTHATS (서열번호: 155);DRTHATS (SEQ ID NO: 155);
MSTTFYS (서열번호: 156);MSTTFYS (SEQ ID NO: 156);
YQHAVQT (서열번호: 157);YQHAVQT (SEQ ID NO: 157);
FPFSAST (서열번호: 158);FPFSAST (SEQ ID NO: 158);
SSFPPLD (서열번호: 159);SSFPPLD (SEQ ID NO: 159);
MAPSPPH (서열번호: 160);MAPSPPH (SEQ ID NO: 160);
SSFPDLL (서열번호: 161);SSFPDLL (SEQ ID NO: 161);
HSYNRLP (서열번호: 162);HSYNRLP (SEQ ID NO: 162);
HLTHSQR (서열번호: 163);HLTHSQR (SEQ ID NO: 163);
QAAQSRS (서열번호: 164);QAAQSRS (SEQ ID NO: 164);
FATHHIG (서열번호: 165);FATHHIG (SEQ ID NO: 165);
SMPEPLI (서열번호: 166);SMPEPLI (SEQ ID NO: 166);
IPRYHLI (서열번호: 167);IPRYHLI (SEQ ID NO: 167);
SAPHMTS (서열번호: 168);SAPHMTS (SEQ ID NO: 168);
KAPVWAS (서열번호: 169);KAPVWAS (SEQ ID NO: 169);
LPHWLLI (서열번호: 170);LPHWLLI (SEQ ID NO: 170);
ASAGYQl (서열번호: 171);ASAGYQl (SEQ ID NO: 171);
VTPKTGS (서열번호: 172);VTPKTGS (SEQ ID NO: 172);
EHPMPVL (서열번호: 173);EHPMPVL (SEQ ID NO: 173);
VSSFVTS (서열번호: 174);VSSFVTS (SEQ ID NO: 174);
STHFTWP (서열번호: 175);STHFTWP (SEQ ID NO: 175);
GQWWSPD (서열번호: 176);GQWWSPD (SEQ ID NO: 176);
GPPHQDS (서열번호: 177);GPPHQDS (SEQ ID NO: 177);
NTLPSTI (서열번호: 178);NTLPSTI (SEQ ID NO: 178);
HQPSRWV (서열번호: 179);HQPSRWV (SEQ ID NO: 179);
YGNPLQP (서열번호: 180);YGNPLQP (SEQ ID NO: 180);
FHWWWQP (서열번호: 181);FHWWWQP (SEQ ID NO: 181);
ITLKYPL (서열번호: 182);ITLKYPL (SEQ ID NO: 182);
FHWPWLF (서열번호: 153);FHWPWLF (SEQ ID NO: 153);
TAQDSTG (서열번호: 184);TAQDSTG (SEQ ID NO: 184);
FHWWWQP (서열번호: 185);FHWWWQP (SEQ ID NO: 185);
FHWWDWW (서열번호: 186);FHWWDWW (SEQ ID NO: 186);
EPFFRMQ (서열번호: 187);EPFFRMQ (SEQ ID NO: 187);
TWWLNYR (서열번호: 188);TWWLNYR (SEQ ID NO: 188);
FHWWWQP (서열번호: 189);FHWWWQP (SEQ ID NO: 189);
QPSHLRW (서열번호: 190);QPSHLRW (SEQ ID NO: 190);
SPASPVY (서열번호: 191);SPASPVY (SEQ ID NO: 191);
FHWWWQP (서열번호: 192);FHWWWQP (SEQ ID NO: 192);
HPSNQAS (서열번호: 193);HPSNQAS (SEQ ID NO: 193);
NSAPRPV (서열번호: 194);NSAPRPV (SEQ ID NO: 194);
QLWSIYP (서열번호: 195);QLWSIYP (SEQ ID NO: 195);
SWPFFDL (서열번호: 196);SWPFFDL (SEQ ID NO: 196);
DTTLPLH (서열번호: 197);DTTLPLH (SEQ ID NO: 197);
WHWQMLW (서열번호: 198);WHWQMLW (SEQ ID NO: 198);
DSFRTPV (서열번호: 199);DSFRTPV (SEQ ID NO: 199);
TSPLSLL (서열번호: 200);TSPLSLL (SEQ ID NO: 200);
AYNYVSD (서열번호: 201);AYNYVSD (SEQ ID NO: 201);
RPLHDPM (서열번호: 202);RPLHDPM (SEQ ID NO: 202);
WPSTTLF (서열번호: 203);WPSTTLF (SEQ ID NO: 203);
ATLEPYR (서열번호: 204);ATLEPYR (SEQ ID NO: 204);
SMTVLRP (서열번호: 205);SMTVLRP (SEQ ID NO: 205);
QIGAPSW (서열번호: 206);QIGAPSW (SEQ ID NO: 206);
APDLYVP (서열번호: 207);APDLYVP (SEQ ID NO: 207);
RMPPLLP (서열번호: 208);RMPPLLP (SEQ ID NO: 208);
AKATPEH (서열번호: 209);AKATPEH (SEQ ID NO: 209);
TPPLRIN (서열번호: 210);TPPLRIN (SEQ ID NO: 210);
LPIHAPH (서열번호: 211);LPIHAPH (SEQ ID NO: 211);
DLNAYTH (서열번호: 212);DLNAYTH (SEQ ID NO: 212);
VTLPNFH (서열번호: 213);VTLPNFH (SEQ ID NO: 213);
NSRLPTL (서열번호: 214);NSRLPTL (SEQ ID NO: 214);
YPHPSRS (서열번호: 215);YPHPSRS (SEQ ID NO: 215);
GTAHFMY (서열번호: 216);GTAHFMY (SEQ ID NO: 216);
YSLLPTR (서열번호: 217);YSLLPTR (SEQ ID NO: 217);
LPRRTLL (서열번호: 218);LPRRTLL (SEQ ID NO: 218);
TSTLLWK (서열번호: 219);TSTLLWK (SEQ ID NO: 219);
TSDMKPH (서열번호: 220);TSDMKPH (SEQ ID NO: 220);
TSSYLAL (서열번호: 221);TSSYLAL (SEQ ID NO: 221);
NLYGPHD (서열번호: 222);NLYGPHD (SEQ ID NO: 222);
LETYTAS (서열번호: 223);LETYTAS (SEQ ID NO: 223);
AYKSLTQ (서열번호: 224);AYKSLTQ (SEQ ID NO: 224);
STSVYSS (서열번호: 225);STSVYSS (SEQ ID NO: 225);
EGPLRSP (서열번호: 226);EGPLRSP (SEQ ID NO: 226);
TTYHALG (서열번호: 227);TTYHALG (SEQ ID NO: 227);
VSIGHPS (서열번호: 228);VSIGHPS (SEQ ID NO: 228);
THSHRPS (서열번호: 229);THSHRPS (SEQ ID NO: 229);
ITNPLTT (서열번호: 230);ITNPLTT (SEQ ID NO: 230);
SIQAHHS (서열번호: 231);SIQAHHS (SEQ ID NO: 231);
LNWPRVL (서열번호: 232);LNWPRVL (SEQ ID NO: 232);
YYYAPPP (서열번호: 233);YYYAPPP (SEQ ID NO: 233);
SLWTRLP (서열번호: 234);SLWTRLP (SEQ ID NO: 234);
NVYHSSL (서열번호: 235);NVYHSSL (SEQ ID NO: 235);
NSPHPPT (서열번호: 236);NSPHPPT (SEQ ID NO: 236);
VPAKPRH (서열번호: 237);VPAKPRH (SEQ ID NO: 237);
HNLHPNR (서열번호: 238);HNLHPNR (SEQ ID NO: 238);
YTTHRWL (서열번호: 239);YTTHRWL (SEQ ID NO: 239);
AVTAAIV (서열번호: 240);AVTAAIV (SEQ ID NO: 240);
TLMHDRV (서열번호: 241);TLMHDRV (SEQ ID NO: 241);
TPLKVPY (서열번호: 242);TPLKVPY (SEQ ID NO: 242);
FINQQYH (서열번호: 243);FINQQYH (SEQ ID NO: 243);
SIHPSMA (서열번호: 244);SIHPSMA (SEQ ID NO: 244);
HTTVYGA (서열번호: 245);HTTVYGA (SEQ ID NO: 245);
TETPYPT (서열번호: 246);TETPYPT (SEQ ID NO: 246);
LTTPFSS (서열번호: 247);LTTPFSS (SEQ ID NO: 247);
GVPLTMD (서열번호: 248);GVPLTMD (SEQ ID NO: 248);
KLPTVLR (서열번호: 249);KLPTVLR (SEQ ID NO: 249);
CRFHGNR (서열번호: 250);CRFHGNR (SEQ ID NO: 250);
YTRDFEA (서열번호: 251);YTRDFEA (SEQ ID NO: 251);
SSAAGPR (서열번호: 252);SSAAGPR (SEQ ID NO: 252);
SLIQYSR (서열번호: 253);SLIQYSR (SEQ ID NO: 253);
DALMWP Xaa (서열번호: 254);DALMWP Xaa (SEQ ID NO: 254);
SS Xaa SLYI (서열번호: 255);SS Xaa SLYI (SEQ ID NO: 255);
FNTSTRT (서열번호: 256);FNTSTRT (SEQ ID NO: 256);
TVQHVAF (서열번호: 257);TVQHVAF (SEQ ID NO: 257);
DYSFPPL (서열번호: 258);DYSFPPL (SEQ ID NO: 258);
VGSMESL (서열번호: 259);VGSMESL (SEQ ID NO: 259);
F Xaa PMI Xaa S (서열번호: 260);F Xaa PMI Xaa S (SEQ ID NO: 260);
APPRVTM (서열번호: 261);APPRVTM (SEQ ID NO: 261);
IATKTPK (서열번호: 262);IATKTPK (SEQ ID NO: 262);
KPPLFQI (서열번호: 263);KPPLFQI (SEQ ID NO: 263);
YHTAHNM (서열번호: 264);YHTAHNM (SEQ ID NO: 264);
SYIQATH (서열번호: 265);SYIQATH (SEQ ID NO: 265);
SSFATFL (서열번호: 266);SSFATFL (SEQ ID NO: 266);
TTPPNFA (서열번호: 267);TTPPNFA (SEQ ID NO: 267);
ISLDPRM (서열번호: 268);ISLDPRM (SEQ ID NO: 268);
SLPLFGA (서열번호: 269);SLPLFGA (SEQ ID NO: 269);
NLLKTTL (서열번호: 270);NLLKTTL (SEQ ID NO: 270);
DQNLPRR (서열번호: 271);DQNLPRR (SEQ ID NO: 271);
SHFEQLL (서열번호: 272);SHFEQLL (SEQ ID NO: 272);
TPQLHHG (서열번호: 273);TPQLHHG (SEQ ID NO: 273);
APLDRIT (서열번호: 274);APLDRIT (SEQ ID NO: 274);
FAPLIAH (서열번호: 275);FAPLIAH (SEQ ID NO: 275);
SWIQTFM (서열번호: 276);SWIQTFM (SEQ ID NO: 276);
NTWPHMY (서열번호: 277);NTWPHMY (SEQ ID NO: 277);
EPLPTTL (서열번호: 278);EPLPTTL (SEQ ID NO: 278);
HGPHLFN (서열번호: 279);HGPHLFN (SEQ ID NO: 279);
YLNSTLA (서열번호: 280);YLNSTLA (SEQ ID NO: 280);
HLHSPSG (서열번호: 281);HLHSPSG (SEQ ID NO: 281);
TLPHRLN (서열번호: 282);TLPHRLN (SEQ ID NO: 282);
SSPREVH (서열번호: 283);SSPREVH (SEQ ID NO: 283);
NQVDTAR (서열번호: 284);NQVDTAR (SEQ ID NO: 284);
YPTPLLT (서열번호: 285);YPTPLLT (SEQ ID NO: 285);
HPAAFPW (서열번호: 286);HPAAFPW (SEQ ID NO: 286);
LLPHSSA (서열번호: 287);LLPHSSA (SEQ ID NO: 287);
LETYTAS (서열번호: 288);LETYTAS (SEQ ID NO: 288);
KYVPLPP (서열번호: 289);KYVPLPP (SEQ ID NO: 289);
APLALHA (서열번호: 290);APLALHA (SEQ ID NO: 290);
YESLLTK (서열번호: 291);YESLLTK (SEQ ID NO: 291);
SHAASGT (서열번호: 292);SHAASGT (SEQ ID NO: 292);
GLATVKS (서열번호: 293);GLATVKS (SEQ ID NO: 293);
GATSFGL (서열번호: 294);GATSFGL (SEQ ID NO: 294);
KPPGPVS (서열번호: 295);KPPGPVS (SEQ ID NO: 295);
TLYVSGN (서열번호: 296);TLYVSGN (SEQ ID NO: 296);
HAPFKSQ (서열번호: 297);HAPFKSQ (SEQ ID NO: 297);
VAFTRLP (서열번호: 298);VAFTRLP (SEQ ID NO: 298);
LPTRTPA (서열번호: 299);LPTRTPA (SEQ ID NO: 299);
ASFDLLI (서열번호: 300);ASFDLLI (SEQ ID NO: 300);
RMNTEPP (서열번호: 301);RMNTEPP (SEQ ID NO: 301);
KMTPLTT (서열번호: 302);KMTPLTT (SEQ ID NO: 302);
ANATPLL (서열번호: 303);ANATPLL (SEQ ID NO: 303);
TIWPPPV (서열번호: 304);TIWPPPV (SEQ ID NO: 304);
QTKVMTT (서열번호: 305);QTKVMTT (SEQ ID NO: 305);
NHAVFAS (서열번호: 306);NHAVFAS (SEQ ID NO: 306);
LHAA Xaa TS (서열번호: 307);LHAA Xaa TS (SEQ ID NO: 307);
TWQPYFH (서열번호: 308);TWQPYFH (SEQ ID NO: 308);
APLALHA (서열번호: 309);APLALHA (SEQ ID NO: 309);
TAHDLTV (서열번호: 310);TAHDLTV (SEQ ID NO: 310);
NMTNMLT (서열번호: 311);NMTNMLT (SEQ ID NO: 311);
GSGLSQD (서열번호: 312); GSGLSQD (SEQ ID NO: 312);
TPIKTIY (서열번호: 313); TPIKTIY (SEQ ID NO: 313);
SHLYRSS (서열번호: 314);SHLYRSS (SEQ ID NO: 314);
HGQAWQF (서열번호: 315); 및HGQAWQF (SEQ ID NO: 315); And
FHWWW (서열번호: 317). FHWWW (SEQ ID NO: 317).
전술한 열 충격 단백질 결합 도메인들은 단지 본 발명의 이용에 사용될 수 있는 펩타이드 및 비-펩타이드 열 충격 단백질 결합 분자들 중 다양한 펩타이드들의 예이다. 다른 실시예에서, 열 충격 단백질 결합 도메인은 전술한 것과 같은 포유류 열 충격 단백질의 다른 부분에 결합하도록 지향될 수 있고, 본 발명의 열 충격 단백질-결합 도메인은 열 충격 단백질 분자의 어떠한 특정 부분에 결합하는 것에 제한되는 것은 아니다. 비-제한적 실시예에서, 펩타이드 IFAGIKKKAERADLIAYLKQATAK (Greene et al., 1995, J. Biol. Chem. 270:2967-2973; 서열번호: 331) 또는 이 펩타이드의 열 충격 단백질-결합 절편은 열 충격 단백질과 미리-선택된 분자의 결합을 촉진하기 위하여 본 발명의 접합체(conjugate) 어디에서도 사용될 수 있다. 열 충격 단백질에 결합하는 전술한 펩타이드 이외에, 결합은 열 충격 단백질 결합 활성을 가진 유기 분자 또는 화합물의 사용을 통하여 달성될 수 있다. 예를 들어, 적당한 분자는 헤비마이신(herbimycin) A, 젤다나마이신(geldanamycin), 마크미마이신(macmimycin) I, 미모사마이신(mimosamycin), 및 쿠웨이티마이신(kuwaitimycin)과 같은 벤조퀴논 안사마이신(benzoquinone ansamycin) 항생제 멤버들 (Omura et al. , 1979, J. Antibiotics 32: 255-261; 또한 W09922761 참조, 상기 문헌들은 인용에 의하여 그 전체가 본 명세서에 포함됨), 또는 구조적으로 관련된 화합물, 및 그들의 유사체 또는 유도체를 포함한다. 이러한 분자들은 열 충격 단백질과 생체 내 또는 생체 외에서 결합할 수 있고 여기에서 제시된 항원에 대한 면역 반응을 발휘할 수 있는 하이브리드 항원을 생성하기 위하여 펩타이드 링커에 의해 본 발명의 항원성 도메인에 확립된 화학적 수단을 통하여 접합될 수 있다.The aforementioned heat shock protein binding domains are merely examples of various peptides among peptides and non-peptide heat shock protein binding molecules that can be used in the use of the present invention. In other embodiments, the heat shock protein binding domain can be directed to bind to other portions of a mammalian heat shock protein as described above, and the heat shock protein-binding domain of the invention binds to any particular portion of the heat shock protein molecule. It is not limited to doing. In a non-limiting example, the peptide IFAGIKKKAERADLIAYLKQATAK (Greene et al., 1995, J. Biol. Chem. 270: 2967-2973; SEQ ID NO: 331) or a heat shock protein-binding fragment of this peptide is previously associated with a heat shock protein. -Can be used anywhere in the conjugates of the present invention to facilitate binding of selected molecules. In addition to the aforementioned peptides that bind to heat shock proteins, binding can be accomplished through the use of organic molecules or compounds with heat shock protein binding activity. For example, suitable molecules are benzoquinone ansamycins such as herbimycin A, geldanamycin, macmimycin I, mimosamycin, and kuwaitimycin. ansamycin) antibiotic members (Omura et al., 1979, J. Antibiotics 32: 255-261; see also W09922761, which is incorporated herein by reference in its entirety), or structurally related compounds, and analogs thereof Or derivatives. These molecules utilize chemical means established in the antigenic domains of the invention by peptide linkers to produce hybrid antigens that can bind heat shock proteins in vivo or ex vivo and can exert an immune response against the antigens presented herein. Can be bonded through.
2004년 2월 12일 출원되었으며, 현재 같이 출원된 상태이고, 보통으로 소유된(commonly-owned) 출원 번호 제10/776,521호에 설명된 바와 같이, 상기 문헌은 인용에 의하여 그 전체가 본 명세서에 포함됨, 위에서 설명된 바와 같이 확인된 것들과 같은, 하지만 이에 한정되지 않는 열 충격 단백질 결합 도메인의 C-말단에 트립토판 잔기(Trp, 또는 단일 아미노산 코드 W)를 포함시키는 것은 열 충격 단백질에의 결합을 촉진한다. 열 충격 단백질로의 증가된 결합은 열 충격 단백질과의 복합체로 투여되든지 또는 단독으로 투여되든지 간에 하이브리드 항원의 항원성 도메인에 대한 면역 반응을 유도하는 하이브리드 항원의 능력을 증가시키는 것으로 나타났다. 증가된 면역 반응은 질병 치료의 증가된 효율과 관련이 있다. 친화성을 결정하는 방법의 다른 예는 PCT/US96/13363 (W09706821)에 설명되어 있으며, 상기 문헌은 인용에 의하여 그 전체가 본 명세서에 포함된다.As filed on February 12, 2004, and currently filed together, and described in commonly-owned application number 10 / 776,521, the document is incorporated herein in its entirety by reference. Inclusion, including a tryptophan residue (Trp, or single amino acid code W) at the C-terminus of a heat shock protein binding domain, such as but not limited to those identified above, may indicate binding to a heat shock protein. Promote. Increased binding to heat shock proteins has been shown to increase the ability of hybrid antigens to induce an immune response to the antigenic domains of hybrid antigens, whether administered in combination with heat shock proteins or alone. Increased immune response is associated with increased efficiency of disease treatment. Another example of a method of determining affinity is described in PCT / US96 / 13363 (W09706821), which is incorporated herein in its entirety by reference.
열 충격 단백질 결합 도메인의 전술한 선택들 중에서, 본 발명의 항원성 도메인 및 펩타이드 링커를 포함하는 하이브리드 항원의 일부로 본 발명에서 바람직한 것들은 다음의 열 충격 단백질 결합 도메인들을 포함한다:Among the aforementioned choices of heat shock protein binding domains, those which are preferred in the present invention as part of a hybrid antigen comprising the antigenic domain and peptide linker of the invention include the following heat shock protein binding domains:
Gly Lys Trp Val Tyr Ile Gly Trp (서열번호: );Gly Lys Trp Val Tyr Ile Gly Trp (SEQ ID NO:);
Ala Lys Arg Glu Thr Lys Gly Trp (서열번호: ); Ala Lys Arg Glu Thr Lys Gly Trp (SEQ ID NO:);
Lys Trp Val His Leu Phe Gly Trp (서열번호: ); Lys Trp Val His Leu Phe Gly Trp (SEQ ID NO:);
Arg Leu Val Leu Val Leu Gly Trp (서열번호: ); Arg Leu Val Leu Val Leu Gly Trp (SEQ ID NO:);
Trp Lys Trp Gly Ile Tyr Gly Trp (서열번호: ); Trp Lys Trp Gly Ile Tyr Gly Trp (SEQ ID NO:);
Ser Ser His Ala Ser Ala Gly Trp (서열번호: ); Ser Ser His Ala Ser Ala Gly Trp (SEQ ID NO:);
Trp Gly Pro Trp Ser Phe Gly Trp (서열번호: ); Trp Gly Pro Trp Ser Phe Gly Trp (SEQ ID NO:);
Ala Ile Pro Gly Lys Val Gly Trp (서열번호: ); Ala Ile Pro Gly Lys Val Gly Trp (SEQ ID NO:);
Arg Val His Asp Pro Ala Gly Trp (서열번호: ); Arg Val His Asp Pro Ala Gly Trp (SEQ ID NO:);
Arg Ser Val Ser Ser Phe Gly Trp (서열번호: ); Arg Ser Val Ser Ser Phe Gly Trp (SEQ ID NO:);
Leu Gly Thr Arg Lys Gly Gly Trp (서열번호: ); Leu Gly Thr Arg Lys Gly Gly Trp (SEQ ID NO:);
Lys Asp Pro Leu Phe Asn Gly Trp (서열번호: ); Lys Asp Pro Leu Phe Asn Gly Trp (SEQ ID NO:);
Leu Ser Gln His Thr Asn Gly Trp (서열번호: ); Leu Ser Gln His Thr Asn Gly Trp (SEQ ID NO:);
Asn Arg Leu Leu Leu Thr Gly Trp (서열번호: ); Asn Arg Leu Leu Leu Thr Gly Trp (SEQ ID NO:);
Tyr Pro Leu Trp Val Ile Gly Trp (서열번호: ); Tyr Pro Leu Trp Val Ile Gly Trp (SEQ ID NO:);
Leu Leu Ile Ile Asp Arg Gly Trp (서열번호: ); Leu Leu Ile Ile Asp Arg Gly Trp (SEQ ID NO:);
Arg Val Ile Ser Leu Gln Gly Trp (서열번호: ); Arg Val Ile Ser Leu Gln Gly Trp (SEQ ID NO:);
Glu Val Ser Arg Glu Asp Gly Trp (서열번호: ); Glu Val Ser Arg Glu Asp Gly Trp (SEQ ID NO:);
Ser Ile Leu Arg Ser Thr Gly Trp (서열번호: ); Ser Ile Leu Arg Ser Thr Gly Trp (SEQ ID NO:);
Pro Gly Leu Val Trp Leu Gly Trp (서열번호: ); Pro Gly Leu Val Trp Leu Gly Trp (SEQ ID NO:);
Val Lys Lys Leu Tyr Ile Gly Trp (서열번호: ); Val Lys Lys Leu Tyr Ile Gly Trp (SEQ ID NO:);
Asn Asn Arg Leu Leu Asp Gly Trp (서열번호: ); Asn Asn Arg Leu Leu Asp Gly Trp (SEQ ID NO:);
Ser Lys Gly Arg Trp Gly Gly Trp (서열번호: ); Ser Lys Gly Arg Trp Gly Gly Trp (SEQ ID NO:);
Ile Arg Pro Ser Gly Ile Gly Trp (서열번호: ); Ile Arg Pro Ser Gly Ile Gly Trp (SEQ ID NO:);
Ala Ser Leu Cys Pro Thr Gly Trp (서열번호: ); Ala Ser Leu Cys Pro Thr Gly Trp (SEQ ID NO:);
Asp Val Pro Gly Leu Arg Gly Trp (서열번호: ); Asp Val Pro Gly Leu Arg Gly Trp (SEQ ID NO:);
Arg His Arg Glu Val Gln Gly Trp (서열번호: ); Arg His Arg Glu Val Gln Gly Trp (SEQ ID NO:);
Leu Ala Arg Lys Arg Ser Gly Trp (서열번호: ); Leu Ala Arg Lys Arg Ser Gly Trp (SEQ ID NO:);
Ser Val Leu Asp His Val Gly Trp (서열번호: ); Ser Val Leu Asp His Val Gly Trp (SEQ ID NO:);
Asn Leu Leu Arg Arg Ala Gly Trp (서열번호: ); Asn Leu Leu Arg Arg Ala Gly Trp (SEQ ID NO:);
Ser Gly Ile Ser Ala Trp Gly Trp (서열번호: ); Ser Gly Ile Ser Ala Trp Gly Trp (SEQ ID NO:);
Phe Tyr Phe Trp Val Arg Gly Trp (서열번호: ); Phe Tyr Phe Trp Val Arg Gly Trp (SEQ ID NO:);
Lys Leu Phe Leu Pro Leu Gly Trp (서열번호: ); Lys Leu Phe Leu Pro Leu Gly Trp (SEQ ID NO:);
Thr Pro Thr Leu Ser Asp Gly Trp (서열번호: );Thr Pro Thr Leu Ser Asp Gly Trp (SEQ ID NO:);
Thr His Ser Leu Ile Leu Gly Trp (서열번호: ); Thr His Ser Leu Ile Leu Gly Trp (SEQ ID NO:);
Leu Leu Leu Leu Ser Arg Gly Trp (서열번호: ); Leu Leu Leu Leu Ser Arg Gly Trp (SEQ ID NO:);
Leu Leu Arg Val Arg Ser Gly Trp (서열번호: );Leu Leu Arg Val Arg Ser Gly Trp (SEQ ID NO:);
Glu Arg Arg ser Arg Gly Gly Trp (서열번호: ); Glu Arg Arg ser Arg Gly Gly Trp (SEQ ID NO:);
Arg Met Leu Gln Leu Ala Gly Trp (서열번호: ); Arg Met Leu Gln Leu Ala Gly Trp (SEQ ID NO:);
Age Gly Trp Ala Asn Ser Gly Trp (서열번호: ); Age Gly Trp Ala Asn Ser Gly Trp (SEQ ID NO:);
Arg Pro Phe Tyr Ser Tyr Gly Trp (서열번호: ); Arg Pro Phe Tyr Ser Tyr Gly Trp (SEQ ID NO:);
Ser Ser Ser Trp Asn Ala Gly Trp (서열번호: ); Ser Ser Ser Trp Asn Ala Gly Trp (SEQ ID NO:);
Leu Gly His Leu Glu Glu Gly Trp (서열번호: ); Leu Gly His Leu Glu Glu Gly Trp (SEQ ID NO:);
Ser Ala Val Thr Asn Thr Gly Trp (서열번호: ); Ser Ala Val Thr Asn Thr Gly Trp (SEQ ID NO:);
Phe Tyr Gln Leu Ala Leu Thr (서열번호: ); Phe Tyr Gln Leu Ala Leu Thr (SEQ ID NO:);
Phe Tyr Gln Leu Ala Leu Thr Trp (서열번호: ), Phe Tyr Gln Leu Ala Leu Thr Trp (SEQ ID NO.),
Arg Lys Leu Phe Phe Asn Leu Arg (서열번호: ), Arg Lys Leu Phe Phe Asn Leu Arg (SEQ ID NO:),
Arg Lys Leu Phe Phe Asn Leu Arg Trp (서열번호: ), Arg Lys Leu Phe Phe Asn Leu Arg Trp (SEQ ID NO:),
Lys Phe Glu Arg Gln (서열번호: ), Lys Phe Glu Arg Gln (SEQ ID NO.),
Asn Ile Val Arg Lys Lys Lys (서열번호: ), 및 Asn Ile Val Arg Lys Lys Lys (SEQ ID NO.), And
Arg Gly Tyr Val Tyr Gin Gly Leu (서열번호: ). Arg Gly Tyr Val Tyr Gin Gly Leu (SEQ ID NO:).
본 발명의 다양한 측면에 유용한 말단에 Trp 잔기를 가진 열 충격 단백질 결합 도메인의 다른 비-제한적 예는 다음을 포함한다:Other non-limiting examples of heat shock protein binding domains having Trp residues at the ends useful in various aspects of the present invention include:
Asn Leu Leu Arg Leu Thr Gly Trp (서열번호: 350);Asn Leu Leu Arg Leu Thr Gly Trp (SEQ ID NO: 350);
Phe Tyr Gln Leu Ala Leu Tyr Trp (서열번호: 351);Phe Tyr Gln Leu Ala Leu Tyr Trp (SEQ ID NO .: 351);
Arg Lys Leu Phe Phe Asn Leu Arg Trp (서열번호: 352);Arg Lys Leu Phe Phe Asn Leu Arg Trp (SEQ ID NO: 352);
Gly Lys Trp Val Tyr Ile Gly Trp (서열번호: 295); Gly Lys Trp Val Tyr Ile Gly Trp (SEQ ID NO: 295);
Ala Lys Arg Glu Thr Lys Gly Trp (서열번호: 296);Ala Lys Arg Glu Thr Lys Gly Trp (SEQ ID NO: 296);
Lys Trp Val His Leu Phe Gly Trp (서열번호: 297); Lys Trp Val His Leu Phe Gly Trp (SEQ ID NO: 297);
Arg Leu Val Leu Val Leu Gly Trp (서열번호: 298); Arg Leu Val Leu Val Leu Gly Trp (SEQ ID NO: 298);
Trp Lys Trp Gly Ile Tyr Gly Trp (서열번호: 299); Trp Lys Trp Gly Ile Tyr Gly Trp (SEQ ID NO: 299);
Ser Ser His Ala Ser Ala Gly Trp (서열번호: 300); Ser Ser His Ala Ser Ala Gly Trp (SEQ ID NO: 300);
Trp Gly Pro Trp Ser Phe Gly Trp (서열번호: 301); Trp Gly Pro Trp Ser Phe Gly Trp (SEQ ID NO: 301);
Ala Ile Pro Gly Lys Val Gly Trp (서열번호: 302); Ala Ile Pro Gly Lys Val Gly Trp (SEQ ID NO: 302);
Arg Val His Asp Pro Ala Gly Trp (서열번호: 303); Arg Val His Asp Pro Ala Gly Trp (SEQ ID NO: 303);
Arg Ser Val Ser Ser Phe Gly Trp (서열번호: 304); Arg Ser Val Ser Ser Phe Gly Trp (SEQ ID NO: 304);
Leu Gly Thr Arg Lys Gly Gly Trp (서열번호: 305); Leu Gly Thr Arg Lys Gly Gly Trp (SEQ ID NO: 305);
Lys Asp Pro Leu Phe Asn Gly Trp (서열번호: 306); Lys Asp Pro Leu Phe Asn Gly Trp (SEQ ID NO: 306);
Leu Ser Gln His Thr Asn Gly Trp (서열번호: 307); Leu Ser Gln His Thr Asn Gly Trp (SEQ ID NO: 307);
Asn Arg Leu Leu Leu Thr Gly Trp (서열번호: 308); Asn Arg Leu Leu Leu Thr Gly Trp (SEQ ID NO: 308);
Tyr Pro Leu Trp Val Ile Gly Trp (서열번호: 309); Tyr Pro Leu Trp Val Ile Gly Trp (SEQ ID NO: 309);
Leu Leu Ile Ile Asp Arg Gly Trp (서열번호: 310); Leu Leu Ile Ile Asp Arg Gly Trp (SEQ ID NO .: 310);
Arg Val Ile Ser Leu Gln Gly Trp (서열번호: 311); Arg Val Ile Ser Leu Gln Gly Trp (SEQ ID NO: 311);
Glu Val Ser Arg Glu Asp Gly Trp (서열번호: 312); Glu Val Ser Arg Glu Asp Gly Trp (SEQ ID NO .: 312);
Ser Ile Leu Arg Ser Thr Gly Trp (서열번호: 313); Ser Ile Leu Arg Ser Thr Gly Trp (SEQ ID NO: 313);
Pro Gly Leu Val Trp Leu Gly Trp (서열번호: 314); Pro Gly Leu Val Trp Leu Gly Trp (SEQ ID NO: 314);
Val Lys Lys Leu Tyr He Gly Trp (서열번호: 315); Val Lys Lys Leu Tyr He Gly Trp (SEQ ID NO: 315);
Asn Asn Arg Leu Leu Asp Gly Trp (서열번호: 316); Asn Asn Arg Leu Leu Asp Gly Trp (SEQ ID NO: 316);
Ser Lys Gly Arg Trp Gly Gly Trp (서열번호: 317); Ser Lys Gly Arg Trp Gly Gly Trp (SEQ ID NO: 317);
Ile Arg Pro Ser Gly Ile Gly Trp (서열번호: 318); Ile Arg Pro Ser Gly Ile Gly Trp (SEQ ID NO: 318);
Ala Ser Leu Cys Pro Thr Gly Trp (서열번호: 319); Ala Ser Leu Cys Pro Thr Gly Trp (SEQ ID NO: 319);
Asp Val Pro Gly Leu Arg Gly Trp (서열번호: 320); Asp Val Pro Gly Leu Arg Gly Trp (SEQ ID NO: 320);
Arg His Arg Glu Val Gln Gly Trp (서열번호: 321); Arg His Arg Glu Val Gln Gly Trp (SEQ ID NO: 321);
Leu Ala Arg Lys Arg Ser Gly Trp (서열번호: 322); Leu Ala Arg Lys Arg Ser Gly Trp (SEQ ID NO .: 322);
Ser Val Leu Asp His Val Gly Trp (서열번호: 323); Ser Val Leu Asp His Val Gly Trp (SEQ ID NO: 323);
Asn Leu Leu Arg Arg Ala Gly Trp(서열번호: 324);Asn Leu Leu Arg Arg Ala Gly Trp (SEQ ID NO: 324);
Ser Gly Ile Ser Ala Trp Gly Trp(서열번호: 325);Ser Gly Ile Ser Ala Trp Gly Trp (SEQ ID NO: 325);
Phe Tyr Phe Trp Val Arg Gly Trp(서열번호: 326);Phe Tyr Phe Trp Val Arg Gly Trp (SEQ ID NO: 326);
Lys Leu Phe Leu Pro Leu Gly Trp(서열번호: 327);Lys Leu Phe Leu Pro Leu Gly Trp (SEQ ID NO: 327);
Thr Pro Thr Leu Ser Asp Gly Trp(서열번호: 328);Thr Pro Thr Leu Ser Asp Gly Trp (SEQ ID NO: 328);
Thr His Ser Leu Ile Leu Gly Trp(SEQ ID N0 : 329);Thr His Ser Leu Ile Leu Gly Trp (SEQ ID NO: 329);
Leu Leu Leu Leu Ser Arg Gly Trp(서열번호: 330);Leu Leu Leu Leu Ser Arg Gly Trp (SEQ ID NO: 330);
Leu Leu Arg Val Arg Ser Gly Trp(서열번호: 331);Leu Leu Arg Val Arg Ser Gly Trp (SEQ ID NO: 331);
Glu Arg Arg ser Arg Gly Gly Trp(서열번호: 332);Glu Arg Arg ser Arg Gly Gly Trp (SEQ ID NO: 332);
Arg Met Leu Gln Leu Ala Gly Trp(서열번호: 333);Arg Met Leu Gln Leu Ala Gly Trp (SEQ ID NO: 333);
Age Gly Trp Ala Asn Ser Gly Trp(SEQ ID N0 : 334);Age Gly Trp Ala Asn Ser Gly Trp (SEQ ID NO: 334);
Arg Pro Phe Tyr Ser Tyr Gly Trp(서열번호: 335);Arg Pro Phe Tyr Ser Tyr Gly Trp (SEQ ID NO: 335);
Ser Ser Ser Trp Asn Ala Gly Trp(서열번호: 336);Ser Ser Ser Trp Asn Ala Gly Trp (SEQ ID NO: 336);
Leu Gly His Leu Glu Glu Gly Trp(서열번호: 337);Leu Gly His Leu Glu Glu Gly Trp (SEQ ID NO .: 337);
Ser Ala Val Thr Asn Thr Gly Trp(서열번호: 338); Ser Ala Val Thr Asn Thr Gly Trp (SEQ ID NO: 338);
Leu Arg Arg Ala Ser Leu Trp(서열번호: 339);Leu Arg Arg Ala Ser Leu Trp (SEQ ID NO .: 339);
Leu Arg Arg Trp Ser Leu Trp(서열번호: 340);Leu Arg Arg Trp Ser Leu Trp (SEQ ID NO: 340);
Lys Trp Val His Leu Phe Trp(서열번호: 341);Lys Trp Val His Leu Phe Trp (SEQ ID NO: 341);
Asn Arg Leu Leu Leu Thr Trp(서열번호: 342);Asn Arg Leu Leu Leu Thr Trp (SEQ ID NO: 342);
Ala Arg Leu Leu Leu Thr Trp(SEQ ID N0 : 343);Ala Arg Leu Leu Leu Thr Trp (SEQ ID NO: 343);
Asn Ala Leu Leu Leu Thr Trp(서열번호: 344);Asn Ala Leu Leu Leu Thr Trp (SEQ ID NO: 344);
Asn Arg Leu Ala Leu Thr Trp(서열번호: 345);Asn Arg Leu Ala Leu Thr Trp (SEQ ID NO: 345);
Asn Leu Leu Arg Leu Thr Trp(서열번호: 346);Asn Leu Leu Arg Leu Thr Trp (SEQ ID NO: 346);
Asn Arg Leu Trp Leu Thr Trp(SEQ ID N0 : 347); 및Asn Arg Leu Trp Leu Thr Trp (SEQ ID NO: 347); And
Asn Arg Leu Leu Leu Ala Trp(서열번호: 348). Asn Arg Leu Leu Leu Ala Trp (SEQ ID NO: 348).
본 발명의 실시에 유용한 기타 열충격 단백질 결합 영역으로는 Phe Tyr Gln Leu Ala Leu Thr Trp(서열번호: 501), Phe TyrGln Leu Ala Leu Thr Trp(서열번호: 502), Arg Lys Leu Phe Phe Asn Leu Arg Trp(서열번호: 503), Arg Lys Leu Phe Phe Asn Leu Arg Trp(서열번호: 504), Lys Phe Glu Arg Gln Trp(서열번호: 505), Asn Ile Val Arg Lys Lys Lys Trp (SEQ ID N0 : 506), 및 Arg Gly TyrVal Tyr Gln Gly Leu Trp (SEQ ID N0 : 507)을 들 수 있다.Other heat shock protein binding regions useful in the practice of the present invention include Phe Tyr Gln Leu Ala Leu Thr Trp (SEQ ID NO: 501), Phe TyrGln Leu Ala Leu Thr Trp (SEQ ID NO: 502), Arg Lys Leu Phe Phe Asn Leu Arg Trp (SEQ ID NO: 503), Arg Lys Leu Phe Phe Asn Leu Arg Trp (SEQ ID NO: 504), Lys Phe Glu Arg Gln Trp (SEQ ID NO: 505), Asn Ile Val Arg Lys Lys Lys Lys Trp (SEQ ID N0: 506), and Arg Gly Tyr Val Tyr Gln Gly Leu Trp (SEQ ID NO: 507).
또한, 기타 열충격 단백질 결합 영역으로는 PCT 공개공보 제 W09922761 호에 개시된 것들을 들 수 있으며, 본 발명의 목적을 달성하기 위하여 첨가된 말단 Trp 잔기를 가질 수 있다. Xaa는 임의의 아미노산을 나타낸다.In addition, other heat shock protein binding regions include those disclosed in PCT Publication No. W09922761, and may have terminal Trp residues added to achieve the object of the present invention. Xaa represents any amino acid.
Tyr Thr Leu Val Gln Pro Leu Trp(SEQ ID N0 : 1149);Tyr Thr Leu Val Gln Pro Leu Trp (SEQ ID NO: 1149);
Thr Pro Asp Ile Thr Pro Lys Trp(SEQ ID N0 : 1150);Thr Pro Asp Ile Thr Pro Lys Trp (SEQ ID NO: 1150);
Thr Tyr Pro Asp Leu Arg Tyr Trp(SEQ ID N0 : 1151);Thr Tyr Pro Asp Leu Arg Tyr Trp (SEQ ID NO: 1151);
Asp Arg Thr His Ala Thr Ser Trp(SEQ ID N0 : 1152);Asp Arg Thr His Ala Thr Ser Trp (SEQ ID NO: 1152);
Met Ser Thr Thr Phe Tyr Ser Trp(SEQ ID N0 : 1153);Met Ser Thr Thr Phe Tyr Ser Trp (SEQ ID NO: 1153);
Tyr Gln His Ala Val Gln Thr Trp(SEQ ID N0 : 1154);Tyr Gln His Ala Val Gln Thr Trp (SEQ ID NO: 1154);
Phe Pro Phe Ser Ala Ser Thr Trp(SEQ ID N0 : 1155);Phe Pro Phe Ser Ala Ser Thr Trp (SEQ ID NO: 1155);
Ser Ser Phe Pro Pro Leu Asp Trp(SEQ ID N0 : 1156);Ser Ser Phe Pro Pro Leu Asp Trp (SEQ ID NO: 1156);
Met Ala Pro Ser Pro Pro His Trp(SEQ ID N0 : 1157);Met Ala Pro Ser Pro Pro His Trp (SEQ ID NO: 1157);
Ser Ser Phe Pro Aspleu Leu Trp(SEQ ID N0 : 1158);Ser Ser Phe Pro Aspleu Leu Trp (SEQ ID NO: 1158);
His Ser Tyr Asn Arg Leu Pro Trp(SEQ ID N0 : 1159);His Ser Tyr Asn Arg Leu Pro Trp (SEQ ID NO: 1159);
His Leu Thr His Ser Gln Arg Trp(SEQ ID N0 : 1160);His Leu Thr His Ser Gln Arg Trp (SEQ ID NO: 1160);
Gln Ala Ala Gln Ser Arg Ser Trp(SEQ ID N0 : 1161);Gln Ala Ala Gln Ser Arg Ser Trp (SEQ ID NO: 1161);
Phe Ala Thr His His Ile Gly Trp(SEQ ID N0 : 1162);Phe Ala Thr His His Ile Gly Trp (SEQ ID NO: 1162);
Ser Met Pro Glu Pro Leu Ile Trp(SEQ ID N0 : 1163);Ser Met Pro Glu Pro Leu Ile Trp (SEQ ID NO: 1163);
Ile Pro Arg Tyr His Leu Ile Trp(SEQ ID N0 : 1164);Ile Pro Arg Tyr His Leu Ile Trp (SEQ ID NO: 1164);
Ser Ala Pro His Met Thr Ser Trp(SEQ ID N0 : 1165);Ser Ala Pro His Met Thr Ser Trp (SEQ ID NO: 1165);
Lys Ala Pro Val Trp Ala Ser Trp(SEQ ID N0 : 1166);Lys Ala Pro Val Trp Ala Ser Trp (SEQ ID NO: 1166);
Leu Pro His Trp Leu Leu Ile Trp(SEQ ID N0 : 1167);Leu Pro His Trp Leu Leu Ile Trp (SEQ ID NO: 1167);
Ala Ser Ala Gly Tyr Gln Ile Trp(SEQ ID N0 : 1168);Ala Ser Ala Gly Tyr Gln Ile Trp (SEQ ID NO: 1168);
Val Thr Pro Lys Thr Gly Ser Trp(SEQ ID N0 : 1169);Val Thr Pro Lys Thr Gly Ser Trp (SEQ ID NO: 1169);
Glu His Pro Met Pro Val Leu Trp(SEQ ID N0 : 1170);Glu His Pro Met Pro Val Leu Trp (SEQ ID NO: 1170);
Val Ser Ser Phe Val Thr Ser Trp(SEQ ID N0 : 1171);Val Ser Ser Phe Val Thr Ser Trp (SEQ ID NO: 1171);
Ser Thr His Phe Thr Trp Pro Trp(SEQ ID N0 : 1172);Ser Thr His Phe Thr Trp Pro Trp (SEQ ID NO: 1172);
Gly Gln Trp Trp Ser Pro Asp Trp(SEQ ID N0 : 1173);Gly Gln Trp Trp Ser Pro Asp Trp (SEQ ID NO: 1173);
Gly Pro Pro His Gln Asp Ser Trp(SEQ ID N0 : 1174);Gly Pro Pro His Gln Asp Ser Trp (SEQ ID NO: 1174);
Asn Thr Leu Pro Ser Thr Ile Trp(SEQ ID N0 : 1175);Asn Thr Leu Pro Ser Thr Ile Trp (SEQ ID NO: 1175);
His Gln Pro Ser Arg Trp Val Trp(SEQ ID N0 : 1176);His Gln Pro Ser Arg Trp Val Trp (SEQ ID NO: 1176);
Tyr Gly Asn Pro Leu Gln Pro Trp(SEQ ID N0 : 1177);Tyr Gly Asn Pro Leu Gln Pro Trp (SEQ ID NO: 1177);
Phe His Trp Trp TrpGln Pro Trp(서열번호: 1178);Phe His Trp Trp TrpGln Pro Trp (SEQ ID NO: 1178);
Ile Thr Leu Lys Tyr Pro Leu Trp(서열번호: 1179);Ile Thr Leu Lys Tyr Pro Leu Trp (SEQ ID NO: 1179);
Phe His Trp Pro Trp Leu Phe Trp(서열번호: 1180);Phe His Trp Pro Trp Leu Phe Trp (SEQ ID NO: 1180);
Thr Ala Gln Asp Ser Thr Gly Trp(서열번호: 1181);Thr Ala Gln Asp Ser Thr Gly Trp (SEQ ID NO: 1181);
Phe His Trp Trp Trp Gln Pro Trp(서열번호: 1182);Phe His Trp Trp Trp Gln Pro Trp (SEQ ID NO: 1182);
Phe His Trp Trp Asp Trp Trp Trp(서열번호: 1183);Phe His Trp Trp Asp Trp Trp Trp (SEQ ID NO: 1183);
Glu Pro Phe Phe Arg Met Gln Trp(서열번호: 1184);Glu Pro Phe Phe Arg Met Gln Trp (SEQ ID NO: 1184);
Thr Trp Trp Leu Asn Tyr Arg Trp(서열번호: 1185);Thr Trp Trp Leu Asn Tyr Arg Trp (SEQ ID NO: 1185);
Phe His Trp Trp Trp Gln Pro Trp(서열번호: 1186);Phe His Trp Trp Trp Gln Pro Trp (SEQ ID NO: 1186);
Gln Pro Ser His Leu Arg Trp Trp(서열번호: 1187);Gln Pro Ser His Leu Arg Trp Trp (SEQ ID NO: 1187);
Ser Pro Ala Ser Pro Val Tyr Trp(서열번호: 1188);Ser Pro Ala Ser Pro Val Tyr Trp (SEQ ID NO: 1188);
Phe His Trp Trp Trp Gln Pro Trp(서열번호: 1189);Phe His Trp Trp Trp Gln Pro Trp (SEQ ID NO: 1189);
His Pro Ser Asn Gln Ala Ser Trp(서열번호: 1190);His Pro Ser Asn Gln Ala Ser Trp (SEQ ID NO: 1190);
Asn Ser Ala Pro Arg Pro Val Trp(서열번호: 1191);Asn Ser Ala Pro Arg Pro Val Trp (SEQ ID NO: 1191);
Gln Leu Trp Ser Ile Tyr Pro Trp(서열번호: 1192);Gln Leu Trp Ser Ile Tyr Pro Trp (SEQ ID NO: 1192);
Ser Trp Pro Phe Phe Asp Leu Trp(서열번호: 1193);Ser Trp Pro Phe Phe Asp Leu Trp (SEQ ID NO: 1193);
Asp Thr Thr Leu Pro Leu His Trp(서열번호: 1194);Asp Thr Thr Leu Pro Leu His Trp (SEQ ID NO: 1194);
Trp His Trp Gln Met Leu Trp Trp(서열번호: 1195);Trp His Trp Gln Met Leu Trp Trp (SEQ ID NO: 1195);
Asp Ser Phe Arg Thr Pro Val Trp(서열번호: 1196);Asp Ser Phe Arg Thr Pro Val Trp (SEQ ID NO: 1196);
Thr Ser Pro Leu Ser Leu Leu Trp(서열번호: 1197);Thr Ser Pro Leu Ser Leu Leu Trp (SEQ ID NO .: 1197);
Ala Tyr Asn Tyr Val Ser Asp Trp(서열번호: 1198);Ala Tyr Asn Tyr Val Ser Asp Trp (SEQ ID NO: 1198);
Arg Pro Leu His Asp Pro Met Trp(서열번호: 1199);Arg Pro Leu His Asp Pro Met Trp (SEQ ID NO: 1199);
Trp Pro Ser Thr Thr Leu Phe Trp(서열번호: 1200);Trp Pro Ser Thr Thr Leu Phe Trp (SEQ ID NO .: 1200);
Ala Thr Leu Glu Pro Val Arg Trp(서열번호: 1201);Ala Thr Leu Glu Pro Val Arg Trp (SEQ ID NO: 1201);
Ser Met Thr Val Leu Arg Pro Trp(서열번호: 1202);Ser Met Thr Val Leu Arg Pro Trp (SEQ ID NO: 1202);
Gln Ile Gly Ala Pro Ser Trp Trp(서열번호: 1203);Gln Ile Gly Ala Pro Ser Trp Trp (SEQ ID NO: 1203);
Ala Pro Asp Leu Tyr Val Pro Trp(서열번호: 1204);Ala Pro Asp Leu Tyr Val Pro Trp (SEQ ID NO: 1204);
Arg Met Pro Pro Leu Leu Pro Trp(서열번호: 1205);Arg Met Pro Pro Leu Leu Pro Trp (SEQ ID NO .: 1205);
Ala Lys Ala Thr Pro Glu His Trp(서열번호: 1206);Ala Lys Ala Thr Pro Glu His Trp (SEQ ID NO: 1206);
Thr Pro Pro Leu Arg Ile Asn Trp(서열번호: 1207);Thr Pro Pro Leu Arg Ile Asn Trp (SEQ ID NO .: 1207);
Leu Pro He His Ala Pro His Trp(서열번호: 1208);Leu Pro He His Ala Pro His Trp (SEQ ID NO .: 1208);
Asp Leu Asn Ala Tyr Thr His Trp(서열번호: 1209);Asp Leu Asn Ala Tyr Thr His Trp (SEQ ID NO: 1209);
Val Thr Leu Pro Asn Phe His Trp(서열번호: 1210)Val Thr Leu Pro Asn Phe His Trp (SEQ ID NO .: 1210)
Asn Ser Arg Leu Pro Thr Leu Trp(서열번호: 1211)Asn Ser Arg Leu Pro Thr Leu Trp (SEQ ID NO .: 1211)
Tyr Pro His Pro Ser Arg Ser Trp(서열번호: 1212)Tyr Pro His Pro Ser Arg Ser Trp (SEQ ID NO .: 1212)
Gly Thr Ala His Phe Met Tyr Trp(서열번호: 1213)Gly Thr Ala His Phe Met Tyr Trp (SEQ ID NO .: 1213)
Tyr Ser Leu Leu Pro Thr Arg Trp(서열번호: 1214)Tyr Ser Leu Leu Pro Thr Arg Trp (SEQ ID NO .: 1214)
Leu Pro Arg Arg Thr Leu Leu Trp(서열번호: 1215)Leu Pro Arg Arg Thr Leu Leu Trp (SEQ ID NO .: 1215)
Thr Ser Thr Leu Leu Trp Lys Trp(서열번호: 1216)Thr Ser Thr Leu Leu Trp Lys Trp (SEQ ID NO .: 1216)
Thr Ser Asp Met Lys Pro His Trp(서열번호: 1217)Thr Ser Asp Met Lys Pro His Trp (SEQ ID NO .: 1217)
Thr Ser Ser Tyr Leu Ala Lue Trp(서열번호: 1218)Thr Ser Ser Tyr Leu Ala Lue Trp (SEQ ID NO .: 1218)
Asn Leu Tyr Gly Pro His Asp Trp(서열번호: 1219)Asn Leu Tyr Gly Pro His Asp Trp (SEQ ID NO .: 1219)
Leu Glu Thr Tyr Thr Ala Ser Trp(서열번호: 1220)Leu Glu Thr Tyr Thr Ala Ser Trp (SEQ ID NO .: 1220)
Ala Tyr Lys Ser Leu Thr Gln Trp(서열번호: 1221)Ala Tyr Lys Ser Leu Thr Gln Trp (SEQ ID NO .: 1221)
Ser Thr Ser Val Tyr Ser Ser Trp(서열번호: 1222)Ser Thr Ser Val Tyr Ser Ser Trp (SEQ ID NO .: 1222)
Glu Gly Pro Leu Arg Ser Pro Trp(서열번호: 1223)Glu Gly Pro Leu Arg Ser Pro Trp (SEQ ID NO .: 1223)
Thr Thr Tyr Hisala Leu Gly Trp(서열번호: 1224)Thr Thr Tyr Hisala Leu Gly Trp (SEQ ID NO .: 1224)
Val Ser Ile Gly His Pro Ser Trp(서열번호: 1225)Val Ser Ile Gly His Pro Ser Trp (SEQ ID NO .: 1225)
Thr His Ser His Arg Pro Ser Trp(서열번호: 1226)Thr His Ser His Arg Pro Ser Trp (SEQ ID NO .: 1226)
Ile Thr Asn Pro Leu Thr Thr Trp(서열번호: 1227)Ile Thr Asn Pro Leu Thr Thr Trp (SEQ ID NO .: 1227)
Ser Ile Gln Ala His His Ser Trp(서열번호: 1228)Ser Ile Gln Ala His His Ser Trp (SEQ ID NO .: 1228)
Leu Asn Trp Pro Arg Val Leu Trp(서열번호: 1229)Leu Asn Trp Pro Arg Val Leu Trp (SEQ ID NO .: 1229)
Tyr Tyr Tyr Ala Pro Pro Pro Trp(서열번호: 1230)Tyr Tyr Tyr Ala Pro Pro Pro Trp (SEQ ID NO .: 1230)
Ser Leu Trp Thr Arg Leu Pro Trp(서열번호: 1231)Ser Leu Trp Thr Arg Leu Pro Trp (SEQ ID NO .: 1231)
Asn Val Tyr His Ser Ser Leu Trp(서열번호: 1232)Asn Val Tyr His Ser Ser Leu Trp (SEQ ID NO .: 1232)
Asn Ser Pro His Pro Pro Thr Trp(서열번호: 1233)Asn Ser Pro His Pro Pro Thr Trp (SEQ ID NO .: 1233)
Val Pro Ala Lys Pro Arg His Trp(서열번호: 1234)Val Pro Ala Lys Pro Arg His Trp (SEQ ID NO: 1234)
His Asn Leu His Pro Asn Arg Trp(서열번호: 1235)His Asn Leu His Pro Asn Arg Trp (SEQ ID NO .: 1235)
Tyr Thr Thr His Arg Trp Leu Trp(서열번호: 1236)Tyr Thr Thr His Arg Trp Leu Trp (SEQ ID NO .: 1236)
Ala Val Thr Ala Ala Ile Val Trp(서열번호: 1237)Ala Val Thr Ala Ala Ile Val Trp (SEQ ID NO .: 1237)
Thr Leu Met His Asp Arg Val Trp(서열번호: 1238)Thr Leu Met His Asp Arg Val Trp (SEQ ID NO .: 1238)
Thr Pro Leu Lys Val Pro Tyr Trp(서열번호: 1239)Thr Pro Leu Lys Val Pro Tyr Trp (SEQ ID NO .: 1239)
Phe Thr Asn Gln Gln Tyr His Trp(서열번호: 1240)Phe Thr Asn Gln Gln Tyr His Trp (SEQ ID NO .: 1240)
Ser His Val Pro Ser Met Ala Trp(서열번호: 1241)Ser His Val Pro Ser Met Ala Trp (SEQ ID NO .: 1241)
His Thr Thr Val Tyr Gly Ala Trp(서열번호: 1242);His Thr Thr Val Tyr Gly Ala Trp (SEQ ID NO: 1242);
Thr Glu Thr Pro Tyr Pro Thr Trp(서열번호: 1243);Thr Glu Thr Pro Tyr Pro Thr Trp (SEQ ID NO .: 1243);
Leu Thr Thr Pro Phe Ser Ser Trp(서열번호: 1244);Leu Thr Thr Pro Phe Ser Ser Trp (SEQ ID NO .: 1244);
Gly Val Pro Leu Thr Met Asp Trp(서열번호: 1245);Gly Val Pro Leu Thr Met Asp Trp (SEQ ID NO: 1245);
Lys Leu Pro Thr Val Leu Arg Trp(서열번호: 1246);Lys Leu Pro Thr Val Leu Arg Trp (SEQ ID NO .: 1246);
Cys Arg Phe His Gly Asn Arg Trp(서열번호: 1247);Cys Arg Phe His Gly Asn Arg Trp (SEQ ID NO: 1247);
Tyr Thr Arg Asp Phe Glu Ala Trp(서열번호: 1248);Tyr Thr Arg Asp Phe Glu Ala Trp (SEQ ID NO .: 1248);
Ser Ser Ala Ala Gly Pro Arg Trp(서열번호: 1249);Ser Ser Ala Ala Gly Pro Arg Trp (SEQ ID NO: 1249);
Ser Leu IleGln Tyr Ser Arg Trp(서열번호: 1250);Ser Leu Ile Gln Tyr Ser Arg Trp (SEQ ID NO: 1250);
Asp Ala Leu Met Trp Pro XAA XAA(서열번호: 1251);Asp Ala Leu Met Trp Pro XAA XAA (SEQ ID NO: 1251);
Ser Ser XAA Ser Leu Tyr Ile Trp(서열번호: 1252);Ser Ser XAA Ser Leu Tyr Ile Trp (SEQ ID NO: 1252);
Phe Asn Thr Ser Thr Arg Thr Trp(서열번호: 1253);Phe Asn Thr Ser Thr Arg Thr Trp (SEQ ID NO: 1253);
Thr Val Gln His Val Ala Phe Trp(서열번호: 1254);Thr Val Gln His Val Ala Phe Trp (SEQ ID NO: 1254);
Asp Tyr Ser Phe Pro Pro Leu Trp(서열번호: 1255);Asp Tyr Ser Phe Pro Pro Leu Trp (SEQ ID NO .: 1255);
Val Gly Ser Met Glu Ser Leu Trp(서열번호: 1256);Val Gly Ser Met Glu Ser Leu Trp (SEQ ID NO: 1256);
Phe XAA Pro Met Ile XAA Ser Trp(서열번호: 1257);Phe XAA Pro Met Ile XAA Ser Trp (SEQ ID NO: 1257);
Ala Pro Pro Arg Val Thr Met Trp(서열번호: 1258);Ala Pro Pro Arg Val Thr Met Trp (SEQ ID NO: 1258);
Ile Ala Thr Lys Thr Pro Lys Trp(서열번호: 1259);Ile Ala Thr Lys Thr Pro Lys Trp (SEQ ID NO: 1259);
Lys Pro Pro Leu Phe Gln Ile Trp(서열번호: 1260);Lys Pro Pro Leu Phe Gln Ile Trp (SEQ ID NO: 1260);
Tyr His Thr Ala His Asn Met Trp(서열번호: 1261);Tyr His Thr Ala His Asn Met Trp (SEQ ID NO: 1261);
Ser Tyr Ile Gln Ala Thr His Trp(서열번호: 1262);Ser Tyr Ile Gln Ala Thr His Trp (SEQ ID NO: 1262);
Ser Ser Phe Ala Thr Phe Leu Trp(서열번호: 1263);Ser Ser Phe Ala Thr Phe Leu Trp (SEQ ID NO: 1263);
Thr Thr Pro Pro Asn Phe Ala Trp(서열번호: 1264);Thr Thr Pro Pro Asn Phe Ala Trp (SEQ ID NO .: 1264);
Ile Ser Leu Asp Pro Arg Met Trp(서열번호: 1265);Ile Ser Leu Asp Pro Arg Met Trp (SEQ ID NO: 1265);
Ser Leu Pro Leu Phe Gly Ala Trp(서열번호: 1266);Ser Leu Pro Leu Phe Gly Ala Trp (SEQ ID NO: 1266);
Asn Leu Leu Lys Thr Thr Leu Trp(서열번호: 1267);Asn Leu Leu Lys Thr Thr Leu Trp (SEQ ID NO .: 1267);
Asp Gln Asn Leu Pro Arg Arg Trp(서열번호: 1268);Asp Gln Asn Leu Pro Arg Arg Trp (SEQ ID NO: 1268);
Ser His Phe Glu Gln Leu Leu Trp(서열번호: 1269);Ser His Phe Glu Gln Leu Leu Trp (SEQ ID NO .: 1269);
Thr Pro Gln Leu His His Gly Trp(서열번호: 1270);Thr Pro Gln Leu His His Gly Trp (SEQ ID NO: 1270);
Ala Pro Leu Asp Arg He Thr Trp(서열번호: 1271);Ala Pro Leu Asp Arg He Thr Trp (SEQ ID NO: 1271);
Phe Ala Pro Leu Ile Ala His Trp(서열번호: 1272);Phe Ala Pro Leu Ile Ala His Trp (SEQ ID NO: 1272);
Ser Trp Ile Gln Thr Phe Met Trp(서열번호: 1273);Ser Trp Ill Gln Thr Phe Met Trp (SEQ ID NO: 1273);
Asn Thr Trp Pro His Met Tyr Trp(서열번호: 1274)Asn Thr Trp Pro His Met Tyr Trp (SEQ ID NO .: 1274)
Glu Pro Lue Pro Thr Thr Leu Trp(서열번호: 1275)Glu Pro Lue Pro Thr Thr Leu Trp (SEQ ID NO .: 1275)
His Gly Pro His Leu Phe Asn Trp(서열번호: 1276)His Gly Pro His Leu Phe Asn Trp (SEQ ID NO .: 1276)
Tyr Leu Asn Ser Thr Leu Ala Trp(서열번호: 1277)Tyr Leu Asn Ser Thr Leu Ala Trp (SEQ ID NO .: 1277)
His Leu His Ser Pro Ser Gly Trp(서열번호: 1278)His Leu His Ser Pro Ser Gly Trp (SEQ ID NO .: 1278)
Thr Leu Pro His Arg Leu Asn Trp(서열번호: 1279)Thr Leu Pro His Arg Leu Asn Trp (SEQ ID NO .: 1279)
Ser Ser Pro Arg Glu Val His Trp(서열번호: 1280)Ser Ser Pro Arg Glu Val His Trp (SEQ ID NO .: 1280)
Asn Gln Val Asp Thr Ala Arg Trp(서열번호: 1281)Asn Gln Val Asp Thr Ala Arg Trp (SEQ ID NO .: 1281)
Tyr Pro Thr Pro Leu Leu Thr Trp(서열번호: 1282)Tyr Pro Thr Pro Leu Leu Thr Trp (SEQ ID NO .: 1282)
His Pro Ala Ala Phe Pro Trp Trp(서열번호: 1283)His Pro Ala Ala Phe Pro Trp Trp (SEQ ID NO .: 1283)
Leu Leu Pro His Ser Ser Ala Trp(서열번호: 1284)Leu Leu Pro His Ser Ser Ala Trp (SEQ ID NO .: 1284)
Leu Glu Thr Tyr Thr Ala Ser Trp(서열번호: 1285)Leu Glu Thr Tyr Thr Ala Ser Trp (SEQ ID NO .: 1285)
Lys Tyr Val Pro Leu Pro Pro Trp(서열번호: 1286)Lys Tyr Val Pro Leu Pro Pro Trp (SEQ ID NO .: 1286)
Ala Pro Leu Ala Leu His Ala Trp(서열번호: 1287)Ala Pro Leu Ala Leu His Ala Trp (SEQ ID NO .: 1287)
Tyr Glu Ser Leu Leu Thr Lys Trp(서열번호: 1288)Tyr Glu Ser Leu Leu Thr Lys Trp (SEQ ID NO .: 1288)
Ser His Ala Ala Ser Gly Thr Trp(서열번호: 1289)Ser His Ala Ala Ser Gly Thr Trp (SEQ ID NO .: 1289)
Gly Leu Ala Thr Val Lys Ser Trp(서열번호: 1290)Gly Leu Ala Thr Val Lys Ser Trp (SEQ ID NO .: 1290)
Gly Ala Thr Ser Phe Gly Leu Trp(서열번호: 1291)Gly Ala Thr Ser Phe Gly Leu Trp (SEQ ID NO .: 1291)
Lys Pro Pro Gly Pro Val Ser Trp(서열번호: 1292)Lys Pro Pro Gly Pro Val Ser Trp (SEQ ID NO .: 1292)
Thr Leu Tyr Val Ser Gly Asn Trp(서열번호: 1293)Thr Leu Tyr Val Ser Gly Asn Trp (SEQ ID NO .: 1293)
His Ala Pro Phe Lys Ser Gln Trp(서열번호: 1294)His Ala Pro Phe Lys Ser Gln Trp (SEQ ID NO .: 1294)
Val Ala Phe Thr Arg Leu Pro Trp(서열번호: 1295)Val Ala Phe Thr Arg Leu Pro Trp (SEQ ID NO .: 1295)
Leu Pro Thr Arg Thr Pro Ala Trp(서열번호: 1296)Leu Pro Thr Arg Thr Pro Ala Trp (SEQ ID NO .: 1296)
Ala Ser Phe Asp Leu Leu Ile Trp(서열번호: 1297)Ala Ser Phe Asp Leu Leu Ile Trp (SEQ ID NO .: 1297)
Arg Met Asn Thr Glu Pro Pro Trp(서열번호: 1298)Arg Met Asn Thr Glu Pro Pro Trp (SEQ ID NO .: 1298)
Lys Met Thr Pro Leu Thr Thr Trp(서열번호: 1299)Lys Met Thr Pro Leu Thr Thr Trp (SEQ ID NO .: 1299)
Ala Asn Ala Thr Pro Leu Leu Trp(서열번호: 1300)Ala Asn Ala Thr Pro Leu Leu Trp (SEQ ID NO .: 1300)
Thr Ile Trp Pro Pro Pro Val Trp(서열번호: 1301)Thr Ile Trp Pro Pro Pro Val Trp (SEQ ID NO: 1301)
Gln Thr Lys Val Met Thr Thr Trp(서열번호: 1302)Gln Thr Lys Val Met Thr Thr Trp (SEQ ID NO: 1302)
Asn His Ala Val Phe Ala Ser Trp(서열번호: 1303)Asn His Ala Val Phe Ala Ser Trp (SEQ ID NO .: 1303)
Leu His Ala Ala Zaa Thr Ser Trp(서열번호: 1304)Leu His Ala Ala Zaa Thr Ser Trp (SEQ ID NO .: 1304)
Thr Trp Gln Pro Tyr Phe His Trp(서열번호: 1305)Thr Trp Gln Pro Tyr Phe His Trp (SEQ ID NO .: 1305)
Ala Pro Leu Ala Leu His Ala Trp(서열번호: 1306)Ala Pro Leu Ala Leu His Ala Trp (SEQ ID NO .: 1306)
Thr Ala His Asp Leu Thr Val Trp(서열번호: 1307)Thr Ala His Asp Leu Thr Val Trp (SEQ ID NO .: 1307)
Asn Met Thr Asn Met Leu Thr Trp(서열번호: 1308)Asn Met Thr Asn Met Leu Thr Trp (SEQ ID NO .: 1308)
Gly Ser Gly Leu Ser Gln Asp Trp(서열번호: 1309)Gly Ser Gly Leu Ser Gln Asp Trp (SEQ ID NO .: 1309)
Thr Pro Ile Lys Thr Ile Tyr Trp(서열번호: 1310)Thr Pro Ile Lys Thr Ile Tyr Trp (SEQ ID NO .: 1310)
Ser His Leu Tyr Arg Ser Ser Trp(서열번호: 1311) 및Ser His Leu Tyr Arg Ser Ser Trp (SEQ ID NO .: 1311) and
His Gly Gln Ala Trp Gln Phe Trp(서열번호: 1312).His Gly Gln Ala Trp Gln Phe Trp (SEQ ID NO .: 1312).
상기 모든 열충격 단백질 결합 펩타이드 중에서, 열충격 단백질 결합 영역인 Asn Leu Leu Arg Leu Thr Gly Trp(서열번호: 350)가 본 발명의 하이브리드 항원에서 가장 바람직하다. 그러나, 상술한 열충격 단백질 결합 영역은 펩타이드 또는 비-펩타이드 열충격 단백질 결합 분자 중에서 본 발명의 실시에서 사용될 수 있는 다양한 잔기를 단순히 예시한 것이다.Of all the heat shock protein binding peptides, the heat shock protein binding region Asn Leu Leu Arg Leu Thr Gly Trp (SEQ ID NO: 350) is most preferred in the hybrid antigen of the present invention. However, the above-described heat shock protein binding regions merely exemplify various residues that can be used in the practice of the present invention among peptide or non-peptide heat shock protein binding molecules.
본 발명의 상기 하이브리드 항원은 하나 이상의 항원성(면역성) 영역 및 하나 이상의 열충격 단백질 결합 영역을 포함하고 있으며, 이들은 본원에서 개시된 바와 같이 하나 이상의 펩타이드 링커(peptide linker)에 의해 분리되어 있다. 본 발명의 하이브리드 항원은 화학 펩타이드 합성법을 이용하여 합성될 수 있거나, 항원성 영역 및 열충격 단백질 결합 영역을 암호화하는 결합된 서열을 포함하는 핵산 컨스트럭트를 발현함으로써 합성될 수 있다. 한가지 적합한 기법은 초기 별개의 PCT 증폭 반응을 이용하여 2개의 영역을 암호화하는 별개의 DNA 절편을 생성하며, 각각의 절편은 하나의 말단에 부착된 링커 절편을 갖고, 이어 추가의 PCR 단계에서 2개의 증폭된 생성물을 융합한다. 이러한 기법은 링커 테일링(linker tailing)으로서 지칭된다. 적합한 제한부위는 또한 목표로 하는 부위에 조작될 수 있으며, 그 후에 제한 절단 및 연결을 이용하여 목적하는 하이브리드 항원-암호화 서열을 생성한다.The hybrid antigens of the present invention comprise one or more antigenic (immunogenic) regions and one or more heat shock protein binding regions, which are separated by one or more peptide linkers as disclosed herein. Hybrid antigens of the invention can be synthesized using chemical peptide synthesis, or by expressing a nucleic acid construct comprising a bound sequence encoding an antigenic region and a heat shock protein binding region. One suitable technique uses initial separate PCT amplification reactions to generate separate DNA fragments encoding the two regions, each fragment having a linker fragment attached to one end, followed by two further PCR steps. Fuse the amplified product. This technique is referred to as linker tailing. Suitable restriction sites can also be engineered at the target site, after which restriction cleavage and ligation are used to generate the desired hybrid antigen-encoding sequence.
상술한 바와 같이, 본 발명의 하이브리드 항원을 암호화하는 핵산은 또한 개체에 투여함으로써 치료용으로 적합하며, 생체 내 발현에 의해 면역반응을 유도할 수 있는 능력을 갖는 하이브리드 항원을 생성한다.As noted above, nucleic acids encoding hybrid antigens of the present invention are also suitable for treatment by administration to a subject and produce a hybrid antigen having the ability to induce an immune response by expression in vivo.
열충격Thermal shock 단백질 protein
본원에서 사용된 바와 같은 "열충격 단백질"이란 용어는 세포가 스트레스를 받았을 때 세포에서 발현이 증가되는 임의의 단백질을 지칭한다. 바람직한 비-제한적인 실시예에서, 상기 열충격 단백질은 원래 진핵세포로부터 유래되며; 더욱 바람직한 실시예에서, 상기 열충격 단백질은 원래 포유동물 세포에서 유래한다. 예를 들어, 본 발명에 따라 사용될 수 있는 열충격 단백질로는 BiP(grp78로도 지칭됨), hsp70, hsc70, gp96(grp94), hsp60, hsp40 및hsp90, 및 이들 부류의 일원을 들 수 있지만 이에 한정되지 않는다. 특히 바람직한 열충격 단백질은 하기에서 예시된 바와 같은 BiP, gp96, 및 hsp70이다. hsp70 부류의 일원이 가장 바람직하다. 자연적으로 발생하거나 재조합에 의해 유래된 열충격 단백질의 변이체는 또한 본 발명에 따라 사용될 수 있다. 예를 들어, 본 발명은 세포에서 이들의 분비를 촉진하기 위해 돌연변이된 열충격 단백질(예를 들어, 소포체 재포획을 조장하는 요소, 예를 들어 KDEL 또는 이의 유사체의 돌연변이 또는 결실을 갖는 열충격 단백질; 이 같은 변이체는 PCT 출원 제 PCT/US96/13233 (WO 97/06685)에 개시되어 있으며, 이들은 본원에서 참고로 인용됨)의 용도를 제공하지만, 이에 한정되는 것은 아니다. The term “thermal shock protein” as used herein refers to any protein whose expression is increased in a cell when the cell is under stress. In a preferred non-limiting embodiment, the heat shock protein is originally derived from eukaryotic cells; In a more preferred embodiment, the heat shock protein is originally derived from mammalian cells. For example, heat shock proteins that may be used in accordance with the present invention include, but are not limited to, BiP (also referred to as grp78), hsp70, hsc70, gp96 (grp94), hsp60, hsp40 and hsp90, and members of these classes. Do not. Particularly preferred heat shock proteins are BiP, gp96, and hsp70 as exemplified below. Most preferred is a member of the hsp70 family. Variants of naturally occurring or recombinantly derived heat shock proteins can also be used in accordance with the present invention. For example, the present invention relates to mutated heat shock proteins (eg, heat shock proteins with mutations or deletions of elements that promote vesicle recapture, such as KDEL or analogues thereof, for promoting their secretion in cells; Such variants provide, but are not limited to, the use of PCT Application No. PCT / US96 / 13233 (WO 97/06685, which is incorporated herein by reference).
열충격 단백질 및 하이브리드 항원이 단백질/펩타이드 복합체의 형태로 개체에 직접 투여되는 본 발명의 실시예에 있어서, 상기 열충격 단백질은 표준 기법을 사용하여, 예를 들어, 문헌[Flynn et al., Science 245: 385-390 (1989)]에 개시된 바와 같은 천연 공급원으로부터 제조될 수 있거나, 박테리아, 효모 또는 포유동물 세포와 같은 적합한 숙주세포에서 열충격-암호화 벡터를 발현하는 것과 같은 재조합 기법을 이용하여 제조될 수 있다. 숙주 유기체로부터 펩타이드로 열충격 단백질을 예비-적재하는 것이 관심 분야이며, 상기 열충격 단백질은 ATP와 함께 배양된 후에 재정제될 수 있다. 재조합 열충격 단백질을 제조하는 방법의 비-제한적인 예는 하기에 개시되어 있다.In an embodiment of the invention in which heat shock proteins and hybrid antigens are administered directly to a subject in the form of a protein / peptide complex, the heat shock proteins can be prepared using standard techniques, for example, in Flynn et al., Science 245: 385-390 (1989), or may be prepared from natural sources, or using recombinant techniques such as expressing a heat shock-encoding vector in a suitable host cell, such as a bacterial, yeast or mammalian cell. . It is of interest to pre-load a heat shock protein with a peptide from the host organism, which heat shock protein can be repurified after incubation with ATP. Non-limiting examples of methods for making recombinant heat shock proteins are disclosed below.
열충격 단백질을 암호화하는 핵산은 발현에 필요하거나 적합한 요소와 작동가능하게 결합될 수 있고, 이어 단백질 백신 또는 대안적으로 핵산 백신에 사용하기 위한 열충격 단백질을 제조하기 위한 하나의 수단으로서 목적하는 열충격 단백질을 발현하는데 사용될 수 있다. 발현에 필요하거나 바람직한 요소로는 프로모터/인핸서 요소, 전사 개시 및 종결 서열, 폴리아테닐화 신화, 번역 개시 및 종결 서열, 리보좀 결합 부위, 신호서열 등을 들 수 있지만, 이에 한정되지 않는다. 예를 들어, 다양한 열충격 단백질의 유전자가 클로닝되었지만, 이에 한정되지 않으며, 이들 서열로는 gp96 (인간: Genebank Accession No. X15187; 문헌[Maki et al., Proc. Natl. Acad. Sci. U.S.A. 87: 5658-5562 (1990)]; 생쥐: Genebank Accession No. M16370; 문헌[Srivastava et al., Proc. Natl. Acad Sci. U.S.A. 84: 3807-3811(1987)]), BiP(생쥐: Genebank Accession No. U16277; 문헌[Haas et al. , Proc. Natl. Acad. Sci. U.S.A. 85: 2250-2254(1988)]; 인간: Genebank Accession No. M19645; 문헌[Ting et al., DNA 7: 275-286(1988)]), hsp70(생쥐: Genebank Accession No. M35021; 문헌[Hunt et al., Gene 87: 199-204 (1990)]; 인간: Genebank Accession No. M24743; 문헌[Hunt et al, Proc. Natl. Acad. Sci. U.S.A. 82 :6455-6489 (1995)]), 및 hsp40(인간: Genebank Accession No. D49547; 문헌[Ohtsuka K., Biochem. Biophys. Res. Commun. 197: 235-240 (1993)])을 들 수 있지만, 이에 한정되지 않는다.Nucleic acids encoding heat shock proteins can be operatively associated with the elements necessary or suitable for expression, and then the desired heat shock protein can be used as a means to prepare heat shock proteins for use in protein vaccines or alternatively nucleic acid vaccines. Can be used to express. Required or preferred elements for expression include, but are not limited to, promoter / enhancer elements, transcription initiation and termination sequences, polyathenylation myths, translation initiation and termination sequences, ribosomal binding sites, signal sequences, and the like. For example, genes of various heat shock proteins have been cloned, but are not limited to these sequences, including, but not limited to, gp96 (human: Genebank Accession No. X15187; Maki et al., Proc. Natl. Acad. Sci. USA 87): 5658-5562 (1990); Mice: Genebank Accession No. M16370; Srivastava et al., Proc. Natl. Acad Sci. USA 84: 3807-3811 (1987)), BiP (Mouse: Genebank Accession No. U16277; Haas et al., Proc. Natl. Acad. Sci. USA 85: 2250-2254 (1988); humans: Genebank Accession No. M19645; Ting et al., DNA 7: 275-286 ( 1988))), hsp70 (mouse: Genebank Accession No. M35021; Hunt et al., Gene 87: 199-204 (1990); humans: Genebank Accession No. M24743; Hunt et al, Proc. Natl Acad. Sci. USA 82: 6455-6489 (1995)], and hsp40 (human: Genebank Accession No. D49547; Ohtsuka K., Biochem. Biophys. Res. Commun. 197: 235-240 (1993) ]), But it is not limited to this.
투여방법Dosing method
본 발명의 하이브리드 항원 또는 하이브리드 항원의 복합체 및 열충격 단백질은 개체에서 치료학적 면역반응을 유도하기에 효과적인 복합체의 양을 기체에서 생성하기 위해 펩타이드계, 단백질계 또는 핵산 백신 중 하나를 이용하여 개체에 투여될 수 있다.Hybrid antigens or complexes of hybrid antigens and heat shock proteins of the present invention are administered to a subject using one of a peptide-based, protein-based or nucleic acid vaccine to produce in the gas an amount of complex effective to induce a therapeutic immune response in the subject. Can be.
상기 개체는 인간 또는 비-인간 개체일 수 있다.The subject can be a human or non-human subject.
본원에서 사용된 바와 같은 "치료학적 면역 반응"이란 용어는, 하이브리드 항원과 관련된 표준 기법에 의해 측정된 바와 같이, 액성 및/또는 세포성 면역에서의 증가를 지칭한다. 바람직하게는, 하이브리드 항원과 관련된 액성 면역의 유도 정도는, 이에 한정되지는 않지만, 본 발명의 조성물을 개체에 투여하기 전에 항원에 대한 액성 면역의 정도 보다 4배 이상, 바람직하게는 16배 이상이다. 또한, 면역반응은 시험관내 또는 생체내 분석에 적합한 수단에 의해 정량적으로 측정될 수 있으며, 이때 개체에서 종양 질환 또는 감염성 질환의 진행의 중단 또는 완화는 치료학적 면역반응의 유도를 나타내는 것으로 고려된다.The term "therapeutic immune response" as used herein refers to an increase in humoral and / or cellular immunity, as measured by standard techniques associated with hybrid antigens. Preferably, the degree of induction of humoral immunity associated with the hybrid antigen is, but is not limited to, at least four times, preferably at least 16 times, the degree of humoral immunity to the antigen prior to administration of the composition of the invention to a subject. . In addition, the immune response can be measured quantitatively by means suitable for in vitro or in vivo analysis, wherein interruption or alleviation of the progression of tumor disease or infectious disease in the subject is considered to indicate the induction of a therapeutic immune response.
열충격 단백질/하이브리드 항원의 특정 투여량은 특정 백신 조성물의 면역성, 개체의 면역능, 개체의 크기 및 투여 경로를 비롯한 많은 인자에 따라 달라질 수 있다. 임의의 주어진 조성물을 투여하기에 적합한 양을 결정하는 것이 일반적인 선별의 문제이다.The specific dosage of the heat shock protein / hybrid antigen may vary depending on many factors including the immunity of the particular vaccine composition, the immunity of the individual, the size of the individual and the route of administration. Determining an amount suitable for administering any given composition is a matter of general selection.
또한, 유의한 면역학적 효능은 상기 하이브리드 항원이 단독으로, 예를 들어 열충격 단백질없이 투여된 연구에서 확인되었다. 본 출원인은 본 발명이 작동하는 원리를 개시할 의무가 없고, 이에 연관되어 있지 않을 지라도, 이들 연구의 결과에서는 상기 하이브리드 항원이 개체에 주사되었을 때 내생성 열충격 단백질과 결합하고, 따라서 효능을 나타내기 위해 동시에 열충격 단백질을 투여할 필요가 없다는 것이 제시된다. 본 발명은 본 발명의 하이브리드 항원의 이 같은 용도까지 포함하고, 또한 내생성 열충격 단백질을 전신에서, 또는 본 발명의 하이브리드 항원의 의도된 투여 부위에서 증가시키는 부수적인 치료까지 포함한다. 이 같은 부수적인 치료로는 국부 조직에서 열충격 단백질의 발현을 증가시키는 열, 또는 국부 또는 전신 치료제의 국부적인 적용을 들 수 있지만, 이에 한정되지 않는다. 이 같은 치료제로는 당해 기술분야에 공지되어 있다.In addition, significant immunological efficacy was confirmed in studies in which the hybrid antigen was administered alone, for example without a heat shock protein. The Applicant is not obliged to disclose the principle by which the invention works and, although not related to it, the results of these studies show that the hybrid antigen binds to an endogenous heat shock protein when injected into a subject and thus exhibits efficacy. It is suggested that there is no need to administer heat shock proteins at the same time. The present invention encompasses such uses of the hybrid antigens of the present invention and also includes ancillary treatment of increasing the endogenous heat shock protein systemically or at the intended site of administration of the hybrid antigens of the present invention. Such incidental treatments include, but are not limited to, fever that increases the expression of heat shock proteins in local tissues, or local application of local or systemic therapeutic agents. Such therapeutic agents are known in the art.
하나 이상의 항원성 영역 및 하나 이상의 열충격 단백질 결합 영역을 포함하는 열충격 단백질의 동시-투여없이(예를 들어, 열충격 단백질과 복합체로 투여되지 않음) 투여되는 하이브리드 항원은 본원에서 언급한 펩타이드 링커 중 하나를 포함한다.A hybrid antigen administered without co-administration of a heat shock protein comprising at least one antigenic region and at least one heat shock protein binding region (eg, not administered in complex with the heat shock protein) may be modified by one of the peptide linkers mentioned herein. Include.
본 발명의 특정 비-제한적인 실시예에서, 면역반응을 최적화하기 위해 1종 이상의 열충격 단백질 및/또는 하나 이상의 하이브리드 항원을 포함하는 것이 바람할 수 있다. 이 같은 기법은 면역반응을 피하는 돌연변이를 신속하게 진행하는 것으로 특징지어 지는 암 또는 감염의 치료에 특히 효과적일 수 있다. 또한, 본 발명의 하이브리드 하원은 하나 이상의 면역성 영역 또는 하나 이상의 에피토프(epitope)를 포함할 수 있다.In certain non-limiting embodiments of the invention, it may be desirable to include one or more heat shock proteins and / or one or more hybrid antigens to optimize the immune response. Such techniques can be particularly effective in the treatment of cancer or infections characterized by rapid progression of mutations that avoid immune responses. In addition, the hybrid house of the invention may comprise one or more immune regions or one or more epitopes.
상술한 바와 같이, 하이브리드 항원/열충격 단백질을 포함하거나, 하이브리드 항원을 단독으로 포함하는 조성물은 본원에서 "백신"으로서 지칭된다. "백신"이란 용어는, 본 발명의 조성물이 예방학적 또는 치료학적 면역반응을 유도하기 위해 사용될 수 있음을 나타내기 위해 사용된다. 본 발명의 백신은 단일 항원성 영역 또는 에피토프를 갖는 하이브리드 항원, 또는 복수의 항원성 영역 또는 에피토프를 갖는 하이브리드 항원을 포함할 수 있다. 또한, 백신은 단일 또는 복수의 항원성 영역 또는 에피토프, 및 이들의 조합을 갖는 하이브리드 항원의 혼합물을 포함할 수 있다. 상기에서 언급한 바와 같이, 상기 하이브리드 항원 또는 이들의 혼합물은 투여전에 하나 이상의 열충격 단백질과 복합체를 형성할 수 있거나, 열충격 단백질없이 투여될 수 있다.As mentioned above, a composition comprising a hybrid antigen / heat shock protein or comprising a hybrid antigen alone is referred to herein as a “vaccine”. The term "vaccine" is used to indicate that the compositions of the present invention can be used to induce a prophylactic or therapeutic immune response. Vaccines of the invention may comprise hybrid antigens having a single antigenic region or epitope, or hybrid antigens having a plurality of antigenic regions or epitopes. In addition, the vaccine may comprise a mixture of hybrid antigens having single or multiple antigenic regions or epitopes, and combinations thereof. As mentioned above, the hybrid antigen or mixtures thereof may be complexed with one or more heat shock proteins prior to administration, or may be administered without heat shock proteins.
본 발명에 따라 하나 이상의 열충격 단백질과 선택적으로 복합체를 형성하는 하나 이상의 하이브리드 항원을 포함하는 백신 조성물은 경피, 피하, 피내, 정맥내, 근육내, 비경구, 폐내, 질내, 직장내, 비내, 또는 국부 투여될 수 있다. 상기 백신 조성물은 주사, 입자 분사법(particle bombardment), 경구 또는 에어로졸에 의해 전달될 수 있다.Vaccine compositions comprising one or more hybrid antigens optionally complexed with one or more heat shock proteins according to the present invention may be transdermal, subcutaneous, intradermal, intravenous, intramuscular, parenteral, pulmonary, intravaginal, rectal, intranasal, or Topical administration. The vaccine composition may be delivered by injection, particle bombardment, oral or aerosol.
하이브리드 항원을 갖는 용액에서 열충격 단백질의 배양은 대부분의 경우에 열충격 단백질에 상기 항원을 적재하기에 충분하다. 그러나, 몇몇 경우에는 항원의 적재를 도와줄 수 있는 약제를 첨가하는 것이 바람직할 수 있다.Incubation of the heat shock protein in a solution with a hybrid antigen is sufficient in most cases to load the antigen on the heat shock protein. In some cases, however, it may be desirable to add a medicament that may aid in loading the antigen.
상기 하이브리드 항원과 함께 열충격 단백질을 가열함으로써 배양하면, 일반적으로 항원이 열충격 단백질에 적재될 것이다. 그러나, 몇몇 경우에는 상기 적재를 보조하기 위해 부가적인 약제를 첨가하는 것이 바람직할 수 있다. 예를 들어, hsp40은 펩타이드를 hsp70 상에 적재하는 것을 조장할 수 있다(문헌[Minami et al., J. Biol. Chem. 271: 19617-19624(1996)]). 구아니디늄-HCl 또는 우레아와 같은 변성제는 상기 펩타이드 결합주머니가 항원에 더욱 접근가능하게 하는 열충격 단백질을 부분적으로 및 가역적으로 불안정화시키는데 사용될 수 있다.When incubated with a heat shock protein with the hybrid antigen, the antigen will generally be loaded onto the heat shock protein. In some cases, however, it may be desirable to add additional agents to aid in the loading. For example, hsp40 can encourage the loading of peptides on hsp70 (Minami et al., J. Biol. Chem. 271: 19617-19624 (1996)). A denaturant such as guanidinium-HCl or urea can be used to partially and reversibly destabilize the heat shock protein that makes the peptide binding bag more accessible to the antigen.
특히, 열충격 단백질을 포함하는 본 발명의 백신은 또한 바람직하게는 열충격 단백질과 상기 열충격 단백질 결합 영역의 복합체가 이의 목적지에 도달하기 전에 이들 사이의 결합을 조장하기 위해 아데노신 디포스페이트(ADP)를 포함한다. 유사한 능력을 갖는 다른 화합물이 단독으로 또는 ADP와 함께 사용될 수 있다.In particular, the vaccine of the present invention comprising a heat shock protein also preferably comprises adenosine diphosphate (ADP) to encourage binding between the heat shock protein and the complex of said heat shock protein binding region before reaching its destination. . Other compounds with similar abilities can be used alone or in combination with ADP.
본 발명에 따른 백신 조성물은 약학적으로 허용가능한 담체와 같은 다양한 부가적인 물질을 추가로 포함할 수 있다. 적합한 담체로는 포스페이트 완충 염용액, 물과 같은 임의의 약학적으로 허용가능한 표준 담체, 오일/물 유제 또는 트리글리세리드 유제와 같은 유제, 다양한 유형의 습윤제, 정제, 피복 정제 및 캡슐제를 들 수 있다. 화합물을 정맥내 및 복강내 투여하기에 유용한 허용가능한 트리글리세리드 유제의 예로는 Intralipid®로서 시판되고 있는 트리글리세리드 유제가 있다. 전형적으로, 이 같은 담체는 전분, 우유, 설탕, 검, 글리콜과 같은 부형제, 또는 기타 공지된 부형제를 포함한다. 이 같은 담체는 또한 방향제, 색첨가제 또는 기타 성분을 포함할 수 있다.The vaccine composition according to the present invention may further comprise various additional substances such as pharmaceutically acceptable carriers. Suitable carriers include phosphate buffered saline solutions, any pharmaceutically acceptable standard carrier such as water, emulsions such as oil / water emulsions or triglyceride emulsions, various types of wetting agents, tablets, coated tablets and capsules. An example of an acceptable triglyceride emulsion useful for intravenous and intraperitoneal administration of the compound is a triglyceride emulsion commercially available as Intralipid®. Typically, such carriers include excipients such as starch, milk, sugar, gums, glycols, or other known excipients. Such carriers may also include perfumes, color additives or other ingredients.
본 발명의 백신 조성물은 또한 적합한 희석제, 방부제, 가용제, 유제, 보조제 및/또는 담체를 포함할 수도 있다. 이 같은 조성물은 액체 형태이거나, 동결 건조된 제제, 또는 그렇지 않는 경우에는 건조 제제일 수 있고, 다양한 완충제 함량(예를 들어, 트리-HCl, 아세테이트, 포스페이트), pH 및 이온 강도 희석제, 표면 흡수를 차단하기 위한 알부핀 또는 젤라틴과 같은 첨가제, 세제(예를 들어, Tween 20, Tween 80, Pluronic F68, 담즙산 염), 가용화제(예를 들어, 글리세롤, 폴리에틸렌 글리세롤), 산화방지제(예를 들어, 아스코르브산, 소듐 메타비설파이트), 방부제(예를 들어, 티머살(Thimerosal), 벤질알콜, 파라벤류), 증량제 또는 독성개질제(예를 들어, 락토즈, 만니톨), 폴리에틸렌 글리콜과 같은 중합체의 금속 이온과 복합체를 형성하는 단백질에의 공유결합 부착점, 또는 상기 물질의 폴리아세트산, 폴리글리콜산, 하이드로겔류 등과 같은 중합체성 화합물의 입자성 제제 상의 혼입부위 또는 리포좀, 마이크로이멀젼, 마이셀, 단일막 또는 다층막 소포, 적혈구 고스트(erythrocyte ghost) 또는 스페로플라스트 상의 혼입부위를 포함할 수 있다. 이 같은 조성물은 물리적 상태, 용해도, 안정성, 생체내 방출속도 및 생체네 제거 속도에 영향을 미칠 것이다. 조성물의 선택은 상기 백신의 물리 화학적 특정에 의존할 것이다. 예를 들어, 막-결합 형태의 단백질로부터 유래한 생성물은 세제를 함유하는 제제를 필요로 할 수 있다. 제어 또는 서방형 조성물은 친유성 저장소(예를 들어, 지방산, 왁스, 오일) 내에 제제를 포함한다. 또한, 중합체(예를 들어, 폴록사머류 또는 폴록사민류)로 코팅된 입자 조성물 및 조직-특이적 수용체, 리간드 또는 항원에 대한 항체와 결합된 조성물, 또는 조직-특이적 수용체에 결합된 조성물이 또한 본 발명에 의해 고려된다. 본 발명의 조성물의 다른 실시예는 근육내, 비경구, 폐, 비강 및 경구 투여을 비롯한 다양한 투여 경로를 위한 입자성 보호 코팅제, 프로테아제 억제제 또는 투과 증점제를 포함한다.Vaccine compositions of the invention may also comprise suitable diluents, preservatives, solubles, emulsions, adjuvants and / or carriers. Such compositions may be in liquid form, or lyophilized formulations, or otherwise dry formulations, and may contain various buffer contents (eg, tri-HCl, acetate, phosphate), pH and ionic strength diluents, surface absorption. Additives such as albupine or gelatin to block, detergents (e.g. Tween 20, Tween 80, Pluronic F68, bile salts), solubilizers (e.g. glycerol, polyethylene glycerol), antioxidants (e.g. Metals of polymers such as ascorbic acid, sodium metabisulfite), preservatives (eg thimersal, benzyl alcohol, parabens), extenders or toxic modifiers (eg lactose, mannitol), polyethylene glycol Covalent attachment points to proteins that form complexes with ions, or on particulate formulations of polymeric compounds such as polyacetic acid, polyglycolic acid, hydrogels, and the like. It may comprise a mouth part or liposomes, mayikeuroyi emulsion, micelle, a single film or a multi-layered film package, red blood cell ghost (ghost erythrocyte) or Spanish incorporated ropeul sites on the last. Such compositions will affect the physical state, solubility, stability, rate of in vivo release and rate of in vivo removal. The choice of composition will depend on the physicochemical characterization of the vaccine. For example, products derived from proteins in membrane-bound form may require formulations containing detergents. Controlled or sustained release compositions include the formulation in a lipophilic reservoir (eg, fatty acid, wax, oil). In addition, particle compositions coated with polymers (eg, poloxamers or poloxamines) and compositions bound to tissue-specific receptors, antibodies to ligands or antigens, or compositions bound to tissue-specific receptors It is also contemplated by the present invention. Other embodiments of the compositions of the present invention include particulate protective coatings, protease inhibitors or permeation thickeners for various routes of administration, including intramuscular, parenteral, pulmonary, nasal and oral administration.
열충격 단백질과 선택적으로 복합체를 형성하는 상기 하이브리드 항원을 직접 투여하는 방법의 대안으로서, 선택적으로 열충격 단백질과 함께 상기 하이브리드 항원을 발현가능한 형태로 암호화하는 하나 이상의 폴리뉴클레오타이드 컨스트럭트가 투여될 수 있다. 발현가능한 폴리뉴클레오타이드 컨스트럭트를 생체외 또는 생체내 방법을 이용하여 개체의 세포에 도입된다. 적합한 방법으로는 조직 및 종양에의 직접 주사, 리포좀을 이용한 형질도입(문헌[Fraley et al., Nature 370: 111-117 (1980)]), 수용체-매개 엔도사이토시스(문헌[Zatloukal et al., Ann. NY Acad. Sci. 660: 136-153 (1992)]), 입사 분사법-매개 유전자 전달(문헌[Eisenbraun et al., DNA & Cell Biol. 12:792-797(1993)]) 및 펩타이드-제시 박테리오파지를 이용한 형질도입(문헌[Barry et al., Nature Medicine 2:299-305(1996)])을 들 수 있다. 상기 폴리펩타이드 백신은 또한 시험관내에서 적절한 세포로 도입될 수 있으며, 이어 개체에 도입할 수 있다.As an alternative to the method of directly administering the hybrid antigen, which optionally forms a complex with the heat shock protein, optionally one or more polynucleotide constructs encoding the hybrid antigen in an expressible form can be administered with the heat shock protein. An expressible polynucleotide construct is introduced into a cell of an individual using ex vivo or in vivo methods. Suitable methods include direct injection into tissues and tumors, transduction with liposomes (Fraley et al., Nature 370: 111-117 (1980)), receptor-mediated endocytosis (Zatloukal et al. , Ann. NY Acad. Sci. 660: 136-153 (1992)), incident injection-mediated gene transfer (Eisenbraun et al., DNA & Cell Biol. 12: 792-797 (1993)) and Transduction using peptide-presenting bacteriophages (Barry et al., Nature Medicine 2: 299-305 (1996)). The polypeptide vaccine can also be introduced into appropriate cells in vitro and then introduced into a subject.
발현가능한 폴리뉴클레오타이드를 컨스트럭트하기 위해, 상기 열충격 단백질 및/또는 하이브리드 항원을 암호화하는 영역을 상술한 바와 같이 제조하고, SV40 프로모터, 사이토메갈로바이러스(CMV) 프로모터 또는 라오스 육종 바이러스(RSV) 프로모터와 같은 적합한 프로모터에 작동가능하게 결합된 포유동물 발현벡터에 삽입된다. 얻어진 컨스트럭트는 유전적 면역화를 위해 백신으로서 사용될 수 있다. 핵산 중합체(들)는 바이러스성 벡터에 클로닝될 수도 있다. 적합한 벡터로는 레트로바이러스 벡터, 아데노바이러스 벡터, 백시니아 벡터, 천연두 바이러스 벡터 및 아데노바이러스-결합 바이러스를 들 수 있지만, 이에 한정되지 않는다. 본 발명에서 사용하기에 적합한 특정 벡터는 pCDNA3(In Vitrogen), 플라스미드 AH5(이는 SV40 오리진(origin)과 아데노바이러스 주요 말기 프로모터를 포함함), pRC/CMV(In Vitrogen), pCMU II(문헌[Paabo et al., EMBO J. 5: 1921-1927(1986)]), pZip-N대 SV(문헌[Cepko et al., Cell 37:1053-1062(1984)]) 및 pSRα(DNAX, Palo Alto, CA)를 들 수 있지만, 이에 한정되지 않는다.In order to construct an expressible polynucleotide, a region encoding the heat shock protein and / or hybrid antigen was prepared as described above, and the SV40 promoter, cytomegalovirus (CMV) promoter or Laos sarcoma virus (RSV) promoter It is inserted into a mammalian expression vector operably linked to the same suitable promoter. The resulting construct can be used as a vaccine for genetic immunization. The nucleic acid polymer (s) may be cloned into a viral vector. Suitable vectors include, but are not limited to, retrovirus vectors, adenovirus vectors, vaccinia vectors, smallpox virus vectors, and adenovirus-binding viruses. Specific vectors suitable for use in the present invention include pCDNA3 (In Vitrogen), plasmid AH5 (which includes SV40 origin and adenovirus major terminal promoters), pRC / CMV (In Vitrogen), pCMU II (Paabo et al., EMBO J. 5: 1921-1927 (1986)], pZip-N vs. SV (Cepko et al., Cell 37: 1053-1062 (1984)) and pSRα (DNAX, Palo Alto, CA), but it is not limited to this.
열충격 단백질 및 하이브리드 항원을 제조하기 위한 다양한 방법은 국제공개공보 WO9706821 호 및 WO9922761 호에 개시되어 있으며, 이는 본원에 전체가 참고로 인용된다.Various methods for preparing heat shock proteins and hybrid antigens are disclosed in WO9706821 and WO9922761, which are incorporated herein by reference in their entirety.
하기 실시예 및 명세서 전체에서, 아미노산은 단일 문자를 사용하여 하기와 같이 나타낼 수 있다:In the following examples and throughout the specification, amino acids may be represented as follows using single letters:
A: 알라닌 C: 시토신A: Alanine C: Cytosine
D:아스타르트산 E: 글루탐산D: Aspartic Acid E: Glutamic Acid
F: 페닐알라닌 G: 글리신F: Phenylalanine G: Glycine
H: 히스티딘 I: 이소루신H: histidine I: isoleucine
K: 리신 L:류신K: Lysine L: Leucine
M: 메티오닌 N: 아스파라긴산M: Methionine N: Aspartic Acid
P: 프롤린 Q: 글루타민P: Proline Q: Glutamine
R: 아르기닌 S: 세린R: Arginine S: Serine
T: 트레오닌 V: 발린T: threonine V: valine
W: 트립토판 Y: 티로신W: Tryptophan Y: Tyrosine
본 발명은 본 발명의 예로서 제공되는 하기 비-제한적인 실시예를 참고하여 더욱 잘 이해될 수 있다. 하기 실시예는 본 발명의 실시예를 더욱 상세하게 설명하기 위해 제시된다. 그러나, 본 발명의 실시예는 본 발명의 광범위한 범위에서 벗어나지 않는 것으로 이해되어야 한다.The invention may be better understood with reference to the following non-limiting examples which serve as examples of the invention. The following examples are presented to illustrate the examples of the invention in more detail. However, it is to be understood that the embodiments of the invention do not depart from the broad scope of the invention.
실시예Example 1 One
다양한 하이브리드 항원을 제조하였으며, 상기 항원 각각은 열충격 단백질 결합 영역, 및 암 항원 에피토프 또는 난백알부민으로부터 모델 I형 H2-Kb 에피토프 SIINFEKL을 포함한다. 펩타이드 링커를 상기 두 개의 영역 사이에 포함시킨다. 이들 실험에 사용된 상기 열충격 단백질 결합영역은 다음과 같다: HWDFAWPW, NLLRLTGW, FYQLALTW 및 RKLFFNLRW. 링터도 상술한 것들 중 하나이다.Various hybrid antigens were prepared, each of which comprises a heat shock protein binding region and a model I type H2-Kb epitope SIINFEKL from cancer antigen epitopes or egg white albumin. A peptide linker is included between the two regions. The heat shock protein binding regions used in these experiments are as follows: HWDFAWPW, NLLRLTGW, FYQLALTW and RKLFFNLRW. Linker is one of those described above.
암 및 모델 에피토프는 하기 표에 기재된 것들 중 하나이다.Cancer and model epitopes are one of those listed in the table below.
표 table XXXX
F-moc 화학 방법론을 이용하는 표준 고체상 펩타이드 합성을 이용하여, 열충격 단백질 결합 영역, 암 에피토프 및 이들 사이의 링커를 포함하는 하이브리드 항원을 다양한 방향으로 합성하였다.Using standard solid-phase peptide synthesis using F-moc chemistry methodology, hybrid antigens including heat shock protein binding regions, cancer epitopes and linkers between them were synthesized in various directions.
실시예Example 2 2
재조합 인간 또는 생쥐 열충격 단백질 70(hsp70)과, 다양한 열충격 단백질 결합 영역 및 상술한 항원성 펩타이드 사이의 결합친화도뿐만 아니라, 항원성 펩타이드를 포함하는 하이브리드 항원과 상술한 열충격 단백질 결합 영역 사이의 결합 친화도는 표준의 라벨링된 하이브리드 항원(삼중수소화되거나 형광화된 ALFDIESKVGSGHWDFAWPW)의 Scatchard 분석(Kd: 각각 22.64μM 및 10.75μM)에 의해 측정된 hsp70에 대한 결합 친화도에 대해 결합 억제 분석(Hill 플롯)으로 측정되었다. 결합 연구는 39% PBS; 20mM THAM, pH 8; 37mM NaCl, 5mM MgCl2; 및 1mM ADP하에서 수행되었다.Binding affinity between recombinant human or mouse heat shock protein 70 (hsp70) and various heat shock protein binding regions and antigenic peptides described above, as well as the binding affinity between hybrid antigens comprising antigenic peptides and the heat shock protein binding regions described above Or in a binding inhibition assay (Hill plot) for binding affinity for hsp70 measured by Scatchard assay (Kd: 22.64 μM and 10.75 μM, respectively) of standard labeled hybrid antigen (tritiated or fluorescent ALFDIESKVGSGHWDFAWPW). Was measured. Binding studies consisted of 39% PBS; 20 mM THAM, pH 8; 37 mM NaCl, 5 mM MgCl 2 ; And 1 mM ADP.
실시예Example 3 3
생쥐의 면역학적 연구에 있어서, 난백단백질로부터의 생쥐 MHC H2-K(b) 에피토프인 SIINFEKL(아미노산 257-264), 및 수포성 입안염 바이러스(vesicular stomatitis virus, VSV)의 핵단백질로부터의 H2-K(b) 펩타이드인 RGYVYQGL(아미노산 52-59)은 하이브리드 항원 제조용으로 사용하였다. 하기 표에는 에피토프 단독 및 하이브리드 하원에서의 서열 및 hsp70에 대한 친화도를 나열하고 있다.In the immunological studies of mice, the mouse MHC H2-K (b) epitope, SIINFEKL (amino acids 257-264), and the vesicular stomatitis virus (VSV) from nucleoproteins from egg protein, K (b) peptide RGYVYQGL (amino acids 52-59) was used for the preparation of hybrid antigens. The table below lists the affinity for hsp70 and the sequences in epitope alone and hybrid houses.
표 table XXXX
hsp70 단독, SIINFEKL와 복합체를 형성한 hsp70, 및 HSP70 유무에 따른 하이브리드 SIINFEKL 펩타이드를 사용하여 생쥐의 꼬리 아랫부분에서 피하주사로 생쥐를 면역화시켰다. 투여량은 hsp70을 제외하고 각각의 면역에 동일한 량의 SIINFEKL을 포함하도록 조절하였다. 몇 일 후에, 비장을 수확하고, CD8+ T 세포에 대해 농축하였고, 이들은 생체외 IFN-γ ELISPOT 분석에 사용되었다. SIINFEKL로 펄스 후의 반응("SIINFEKL")을 하기 표에 기록하였으며, 하기 표에서는 투여량, 및 그룹 당 3마리 이상의 생쥐를 이용한 4회 이상의 실험에서 4 x 105 CD8 T 세포 당 스팟(spot)의 수(평균±표준오차)가 나타나 있다. 대조군에서는 매질 단독("매질 대조군"), 비-펄스 T 세포("비-펄스 대조군"), VSV로부터 유래한 비-면역화 펩타이드 RGYVYQGL로 펄스된 T 세포("VSV 대조군") 및 양성 대조군으로서 콘카나발린 A에 노출("Con A 양성 대조군")이 나타나 있다. 동일한 실험에서, 상술한 바와 같은 51Cr-방출 분석을 SIINFEKL-펄스 표적세포를 이용하여 수행하였다. 효과기:표적세포의 200:1의 비에서, 수득된 사멸율(%)의 결과는 하기 표의 가장 오른쪽 컬럼에 나타나 있다.Mice were immunized subcutaneously in the lower tail of mice using hsp70 alone, hsp70 complexed with SIINFEKL, and hybrid SIINFEKL peptides with or without HSP70. Dosage was adjusted to include the same amount of SIINFEKL for each immunity except hsp70. After a few days, the spleens were harvested and concentrated on CD8 + T cells, which were used for in vitro IFN-γ ELISPOT analysis. Post-pulse response with SIINFEKL (“SIINFEKL”) is reported in the table below, which shows the dose per spot of 4 × 10 5 CD8 T cells in four or more experiments with doses and three or more mice per group. Numbers (mean ± standard error) are shown. In control, medium alone (“medium control”), non-pulse T cells (“non-pulse control”), T cells pulsed with non-immunized peptide RGYVYQGL derived from VSV (“VSV control”) and cone as positive control. Exposure to cannavaline A (“Con A positive control”) is shown. In the same experiment, a 51 Cr-release assay as described above was performed using SIINFEKL-pulse target cells. At a ratio of 200: 1 effector: target cells, the results of% death obtained are shown in the rightmost column of the table below.
(200-10)(200-10)
실시예Example 5 5
상술한 바와 동일하게 실험을 실시하였으며, 상기 실험에서는 hsp70이 없는 하이브리드 항원이 또한 포함되어 있다.Experiments were carried out as described above, where the hybrid antigen without hsp70 was also included.
(200-11)(200-11)
실시예Example 6 6
상술한 실험과 유사하게 추가의 시험을 실시하였다.Additional tests were conducted similar to the experiments described above.
(200-12)(200-12)
실시practice 예Yes 7 7
이전 생체내 실험에서와 같이, 피하주사로 B6 생쥐를 면역화시켜, FFRK, RK, AKVL, QLK 및 FR(단일 문자 아미노산 코드를 이용함)을 포함하는 기타 짧은 펩타이드 링커를 이용하여 제조된 하이브리드 항원과 hsp70과의 복합체를 상이한 투여량으로 평가하였다. 생체외 IFN-γ ELISPOT 분석은 상술한 바와 같이 수행하였다. 대조군 값을 포함하는 결과는 하기와 같다.As in previous in vivo experiments, h670 was hybridized with hybrid antigens prepared using other short peptide linkers, including FFRK, RK, AKVL, QLK, and FR (using single letter amino acid codes) by immunizing B6 mice subcutaneously. Complexes with were evaluated at different doses. In vitro IFN-γ ELISPOT analysis was performed as described above. The results including control values are as follows.
(200-13)(200-13)
200-21200-21
200-23200-23
실시예Example 8 8
상술한 바와 유사한 B6 생쥐에서의 생체내 연구가 hsp70을 첨가하지 않은 제제를 사용하여 수행되었다. 그 결과는 하기와 같다.In vivo studies in B6 mice similar to those described above were performed using the formulation without hsp70. The result is as follows.
(200-17)(200-17)
실시예Example 9 9
상술한 방법과 유사한 B6 생쥐에서의 생체내 연구는 hsp70의 유무에 따른 제제를 이용하여 수행되었다. 또한, 하이브리드 항원을 유리 열충격 단백질-결합 영역 펩타이드(NLLRLTGW)와 공-투여한 하나의 연구가 수행되었다. 그 결과는 하기와 같다.In vivo studies in B6 mice similar to the methods described above were performed using preparations with or without hsp70. In addition, one study was conducted in which the hybrid antigen was co-administered with the free heat shock protein-binding region peptide (NLLRLTGW). The result is as follows.
(VSV-72-02) (VSV-72-02)
실시예Example 10 10
많은 상기 실험에서 대조군으로서 사용된 VSV 에피토프 RGYVYQGL을 본 발명의 추가의 하이브리드 항원을 제조하는 경우에 에피토프로서 사용하였고, 상술한 바와 유사한 실험으로 면역반응의 유도에 대해 평가하였다.The VSV epitope RGYVYQGL, used as a control in many of these experiments, was used as an epitope in the preparation of additional hybrid antigens of the present invention and evaluated for induction of immune responses in a similar experiment as described above.
(VSV-72-02) (VSV-72-02)
실시예Example 11 11
상기 하이브리드 항원, 및 hsp70과의 복합체의 질환 치료에 대한 효능을 측정하기 위해, 난백단백질을 발현하도록 변형된 200,000개의 E7 종양세포(E.G7로 명명됨)가 B6 생쥐에서 피하 주입된 모델을 이용하였다. 각 처리군에는 10마리의 생쥐를 사용하였다. 이러한 모델은, 예를 들어 문헌[Moroi et al., 2000, Proc. Nat. Acad. Sci. USA 97: 3485-3490]에 개시되어 있다. 시간의 경과에 따른 종양을 갖는 생쥐 수에 대한 결과는 도 1에 도시되어 있다. 31일 후, hsp70:NLLRLTGWFFRKSIINFEKL로 면역된 10마리의 생쥐 중 한 마리도 종양으로 진행되지 않았고, 또한 Titermax 보조제에서 유화된 SIINFEKL로 면역화된 생쥐에서도 종양으로 진행되지 않았다. NLLRLTGWFFRKSIINFEKL 단독(no hsp70)으로 백신처리된 10마리의 생쥐 중 3마리가 종양으로 진행되었다. hsp70:SIINFEKL으로 백신처리된 10마리의 생쥐 중 5마리가 종양으로 진행되었고, Titermax 및 완충액 단독으로 면역화된 10마리의 생쥐 중 9마리가 종양으로 진행되었다.In order to measure the efficacy of the hybrid antigen, and the complex with hsp70 for the treatment of diseases, a model in which 200,000 E7 tumor cells (named E.G7) modified to express egg protein are subcutaneously injected in B6 mice is used. It was. Ten mice were used for each treatment group. Such models are described, for example, in Moroi et al., 2000, Proc. Nat. Acad. Sci. USA 97: 3485-3490. Results for the number of mice with tumors over time are shown in FIG. 1. After 31 days, none of the 10 mice immunized with hsp70: NLLRLTGWFFRKSIINFEKL progressed into tumors, nor did they progress into tumors in mice immunized with SIINFEKL emulsified in Titermax adjuvant. Three of 10 mice vaccinated with NLLRLTGWFFRKSIINFEKL alone (no hsp70) progressed to tumors. Five of 10 mice vaccinated with hsp70: SIINFEKL advanced to tumors, and nine of 10 mice immunized with Titermax and buffer alone progressed to tumors.
실시예Example 12 12
상술한 시험관내 항원제시분석은 본 발명의 제제를 평가하기 위해 추가로 이용되었다. 상기 하이브리드 항원 및 더욱 구체적으로는 hsp70의 항원을 상기 항원제시경로로의 진입을 위해 제제의 형태로 공급되는지, 또는 내생적으로 이용가능한지에 대한 hsp70에 대한 본 발명의 하이브리드 항원의 요건을 증명하기 위해, 하기 제제로 분석을 수행하였으며, 그 결과는 하기에 나타낸 바와 같다.The in vitro antigen presentation assay described above was further used to evaluate the formulations of the present invention. To demonstrate the requirement of the hybrid antigen of the present invention for hsp70 whether the hybrid antigen and more specifically the antigen of hsp70 is supplied in the form of an agent for entry into the antigen presentation pathway or is endogenously available. The analysis was performed with the following formulations, and the results are shown below.
(200-MF-41)(200-MF-41)
실시예Example 13 13
문헌[Firat et al., 1999, "H-2 class I knockout, HLA-A2.1-transgenic mice: a versatile animal model for preclinical evaluation of antitumor immunotherapeutic strategies," Eur Immunol. 29: 3112-21]에 개시된 인간 HLA-A2 복합체를 갖는 HHD II 생쥐모델을 하기 실험에서 사용하여 본 발명의 하이브리드 항원에서 인간 HLA-A2 에피토프를 평가하였다. 인간 흑색종 항원 gp100으로부터의 "IMD" 펩타이드 에피토프 IMDQVPFSV를 HHD II 모델에서 소량 및 다량의 투여량의 본 발명의 하이브리드 항원에서 측정하였다. 상술한 방법과 유사한 방법이 ELISPOT 분석에 사용되었는데, 시험 펩타이드는 IMD 펩타이드이고, 대조군은 흑색종 항원 티로시나제로부터의 펩타이드 YMDGTMSQV("YMD")가 사용되었다. 그 결과는 하기 표에 나타나 있다.Firat et al., 1999, "H-2 class I knockout, HLA-A2.1-transgenic mice: a versatile animal model for preclinical evaluation of antitumor immunotherapeutic strategies," Eur Immunol. 29: 3112-21, the HHD II mouse model with the human HLA-A2 complex disclosed in the following experiment was used to evaluate human HLA-A2 epitope in the hybrid antigen of the present invention. The "IMD" peptide epitope IMDQVPFSV from the human melanoma antigen gp100 was measured in small and large doses of the hybrid antigens of the present invention in the HHD II model. A similar method to that described above was used for ELISPOT analysis, in which the test peptide was an IMD peptide and the control peptide YMDGTMSQV (“YMD”) from melanoma antigen tyrosinase was used. The results are shown in the table below.
(HHD II 200-72-02)(HHD II 200-72-02)
상기 하이브리드 항원에서 에피토프로서 YMD를 사용하여 수행된 HHD II 생쥐에서의 유사한 실험을 hsp70과의 복합체에서 수행하였으며, 그 결과는 하기와 같다.Similar experiments in HHD II mice carried out using YMD as epitope in the hybrid antigen were performed in complex with hsp70 and the results are as follows.
(200-72-01)(200-72-01)
실시예Example 14 14
센다이 바이러스(Sendai virus, SdV)의 에피토프(epitope)인 FAPGNYPAL은 상기와 비슷한 B6 쥐에서 본 발명의 하이브리드 항원으로 평가되었다. 결과는 다음과 같다. FAPGNYPAL, an epitope of Sendai virus (SdV), was evaluated as a hybrid antigen of the present invention in B6 mice similar to the above. The result is as follows.
(200-18)(200-18)
실시예Example 15 15
B6 쥐에 hsp70과 함께 본 발명의 둘의 하이브리드 항원의 공동-투여하는 in-vivo 실험은 실시되었다. 오부알부민의 SIINFEKL 및 VSV의 RGYVYQGL을 함유하는 하이브리드 항원은 혼합되고 hsp70으로 면역화되었다. 결과는 다음과 같다. Co-administration of two hybrid antigens of the present invention with hsp70 in B6 mice was performed in-vivo experiments. Hybrid antigens containing SIINFEKL of obbualbumin and RGYVYQGL of VSV were mixed and immunized with hsp70. The result is as follows.
(OVA-VSV-72-01)(OVA-VSV-72-01)
실시예Example 16 16
상기 기재된 바와 같이 본 발명의 측면에서, 여러 항원 에피토프를 함유하는 복수 개의 하이브리드 항원을 포함하는 제제는 질병을 치료하거나 예방하기 위한 효과적인 면역 반응을 유도하기 위해서 인간에서 면역화를 위해 하나 이상의 열충격 단백질과 함께 제제화될 수 있다. 예를 들어, 인간 흑색종을 치료하기 위해, 8개의 다른 흑색종 에피토프를 함유하는 제제가 하이브리드 항원으로서 제조될 수 있고, 예를 들어 hsp70으로 제제화될 수 있다. 이런 특정한 제제에서, 상기 N-말단에 열 충격 단백질 영역 NLLRLTGW은 모든 에피토프에 사용되고, 펩티드 링커인 FFRK를 사용하여 C-말단에서 에피토프에 연결된다. 다른 결합 영역 및 링커는 여기에 포함된다. 이런 특정한 제제는 HLA-A2 일배체형을 갖는 환자를 치료하기 위해 유용하다. 제제는 hsp70을 갖는 다음의 하이브리드 항원을 포함한다:In aspects of the invention as described above, an agent comprising a plurality of hybrid antigens containing multiple antigen epitopes may be combined with one or more heat shock proteins for immunization in humans to induce an effective immune response for treating or preventing a disease. It may be formulated. For example, to treat human melanoma, a formulation containing eight different melanoma epitopes can be prepared as a hybrid antigen, for example formulated with hsp70. In this particular formulation, the N-terminal heat shock protein region NLLRLTGW is used for all epitopes and is linked to the epitope at the C-terminus using the peptide linker FFRK. Other binding regions and linkers are included here. Such specific agents are useful for treating patients with HLA-A2 haplotypes. The formulation comprises the following hybrid antigens with hsp70:
일 실시예에서, 전술한 대략 동일한 양의 8개의 하이브리드 항원은 hsp70과 함께 혼합될 수 있고, 식염수에서 투여될 수 있다. 다른 실시예에서, 제제는 나열된 처음 5개의 하이브리드 항원을 포함한다. 식염수에 있는 열충격 단백질을 함유하는 전술된 제제들은 상기 언급된 부형제, 희석제 및 운반체와 같은 다른 성분들뿐만 아니라 상기 복합체들을 안정화시키기 위해 ADP를 함유한다. 다른 실시예에서, 전술한 8개의 하이브리드 항원의 혼합물 또는 나열된 처음 5개는 열충격 단백질 없이 투여를 위해 식염수에서 제제화된다. In one embodiment, approximately the same amounts of the eight hybrid antigens described above can be mixed with hsp70 and administered in saline. In another embodiment, the formulation comprises the first five hybrid antigens listed. The aforementioned formulations containing heat shock proteins in saline contain ADP to stabilize the complexes as well as other components such as the excipients, diluents and carriers mentioned above. In another embodiment, a mixture of the eight hybrid antigens described above or the first five listed are formulated in saline for administration without a heat shock protein.
실시예Example 17 17
최초의 후원 프로토콜은 본 실험에서 평가되었다. NLLRLTGWFFRKSIINFEKL 하이브리드 항원을 사용하거나 또는 공동-투여된 hsp70 없이 사용하는 5개 프로토콜은 다음과 같다: 1) 0일 투여, 7일 분석; 2) 0 및 7일 투여, 21일 분석; 3) 0일 투여, 21일 분석; 4) 0 및 14일 투여, 28일 분석; 및 5) 0일 투여 및 28일 분석. 400,000 세포당 스팟(spot) 수에서의 결과는 다음과 같다. The first sponsored protocol was evaluated in this experiment. The five protocols using NLLRLTGWFFRKSIINFEKL hybrid antigen or without co-administered hsp70 are as follows: 1) 0 day administration, 7 day analysis; 2) 0 and 7 day administration, 21 day analysis; 3) 0 day dosing, 21 day analysis; 4) 0 and 14 day administration, 28 day analysis; And 5) day 0 administration and 28 day analysis. The results at spots per 400,000 cells are as follows.
(200-28-72-Ola,-Olb,-Olc) (200-28-72-Ola, -Olb, -Olc)
실시예Example 18 18
또 다른 실험들은 상기와 같이 항원 성분에 대한 면역 반응의 유도를 설명하기 위해 하이브리드 항원의 혼합물로 수행되었다. 본 실험에서, SIINFEKL 및 VSV 펩티드 RGYVYQGL을 함유하는 하이브리드 항원이 사용되었다. Still other experiments were performed with a mixture of hybrid antigens to account for the induction of an immune response to the antigenic components as described above. In this experiment, a hybrid antigen containing SIINFEKL and VSV peptide RGYVYQGL was used.
(VSV/OVA-72-02) (VSV / OVA-72-02)
실시예Example 19 19
영역 NLLRLTGW인 항원 영역 (오부알부민의)SIINFEKL 또는 (VSV 단백질의) RGYVYQGL을 연결하는 열충격 단백질을 함유하는 하이브리드 항원들을 위한 결합 친화력 및 실시예 32에 4개 설정된 다양한 링커들은 실시예 17에서 설명된 바와 같이 수행되었다. 항원 영역들은 홀로 235μM 및 82μM의 hsp70 결합을 위해 각각 Kd를 가졌다. 결과는 하기와 같다.The binding affinity for hybrid antigens containing the antigenic region (ofbualbumin) SIINFEKL or of the heat shock protein (linking the RGYVYQGL) of region NLLRLTGW and the various linkers set up in Example 32 as described in Example 17 are as described in Example 17. It was done together. Antigen regions alone had Kd for hsp70 binding of 235 μM and 82 μM, respectively. The results are as follows.
실시예Example 20 20
또 다른 연구들은 hsp70의 공동-투여 없이 B6 쥐에 단독으로 투여될 때, 하이브리드 항원의 면역원성을 평가하기 위해 수행되었다. IFN-γ ELISPOT을 사용하는 평가방법은 전술한 상기와 같다. Further studies were conducted to assess the immunogenicity of hybrid antigens when administered alone to B6 mice without co-administration of hsp70. The evaluation method using IFN-γ ELISPOT is as described above.
(대조군 200-24 및 200-30) (Controls 200-24 and 200-30)
실시예Example 21 21
하이브리드 항원은 항원 둘을 포함하는 것으로 준비되었고, 하이브리드 항원이 다음의 일반 구조를 갖는 것과 같이 상기 전술된 링커에 의해 분리되었다. Hybrid antigens were prepared to comprise two antigens, and the hybrid antigens were separated by the linkers described above as having the following general structure.
(열충격 단백질 결합 영역) - (링커) - (항원 1) - (링커) - (항원 2)(Thermal shock protein binding region)-(linker)-(antigen 1)-(linker)-(antigen 2)
본 실시예에서, 상기 열충격 단백질 결합 영역은 상기 하이브리드 항원의 N-말단 부분에 있는 반면, 상기 경우가 필수적인 것은 아니며, C-말단 또는 두 항원 영역 사이에서 열충격 단백질 연결 영역을 갖는 하이브리드 항원은 본 발명에 의해 포함된다. 또한, 본 아래의 실시예에서 링커 펩티드가 상기 항원 영역 사이 및 열충격 단백질 결합 영역과 가까운 항원 영역 사이에서 사용될지라도, 이러한 것은 필수적인 것은 아니며, 다른 링커 펩티드가 사용될 수도 있다. 게다가, 하나 또는 양 위치에서 상기 링커의 존재는 선택적이다. 또한, 셋 이상의 항원 펩티드는 사용될 수 있다. 간단하게, 그러한 둘 이상의 항원 영역이 있는 하이브리드 항원은 일렬(tandem) 하이브리드 항원으로 불린다. 그런 일렬 하이브리드 항원 조성물들, 하나 이상의 일렬 하이브리드 항원 및 열충격 단백질의 복합체, 및 하나 이상의 일렬 하이브리드 항원 또는 최소 하나의 열충격 단백질 및 최소 하나의 일렬 하이브리드 항원이 복합체를 투여함으로써 면역 반응을 유도하거나 질병을 예방하거나 치료하는 방법들은 전체적으로 본 명세서에 포함된다. 다음의 실험들은 두 하이브리드 항원의 혼합물 및 같은 항원을 함유하는 일렬 하이브리드 항원의 면역원성 및 투여량 반응 연구를 비교한다. 일 실시예에서, 열충격 단백질 결합 영역이 없는 두 개의 링커 및 에피토프를 포함하는 펩티드는 포함되었다. In this embodiment, the heat shock protein binding region is in the N-terminal portion of the hybrid antigen, whereas the case is not essential, and hybrid antigens having a heat shock protein connection region between the C-terminal or two antigenic regions are provided in the present invention. Included by. In addition, although the linker peptide is used between the antigenic region and between the heat shock protein binding region and the close antigenic region in the examples below, this is not essential, and other linker peptides may be used. In addition, the presence of the linker in one or both positions is optional. In addition, three or more antigenic peptides may be used. Briefly, hybrid antigens having two or more such antigenic regions are called tandem hybrid antigens. Such single-strand hybrid antigen compositions, complexes of one or more single-strand hybrid antigens and heat shock proteins, and one or more single-strand hybrid antigens or at least one heat shock protein and at least one single-line hybrid antigen are administered to induce an immune response or prevent disease Methods for treating or treating are encompassed herein in their entirety. The following experiments compare immunogenicity and dose response studies of mixtures of two hybrid antigens and single-line hybrid antigens containing the same antigen. In one embodiment, a peptide comprising two linkers and epitopes without a heat shock protein binding region was included.
(대조군-200-72-01) (Control-200-72-01)
(S200-72-02)(S200-72-02)
(S200-72-12)(S200-72-12)
이번 및 다른 실시예에서, 상기 열충격 단백질 결합 영역에 근접한 에피토프는 가장 강한 면역 반응을 보여주었고, 따라서 본 발명의 백신 제제을 위해 선택된 에피토프의 위치결정은 열충격 단백질 없는 조건 하에서 투여되거나 열충격 단백질을 갖는 복합체들로서 투여되었던간에 상기 제제의 전체적인 면역성에 최대한 기여하기 위하여 위치될 수 있다. In this and other examples, the epitopes proximate to the heat shock protein binding region showed the strongest immune response, so the positioning of epitopes selected for the vaccine formulations of the present invention was administered as complexes having heat shock proteins or administered under conditions without heat shock proteins. Whatever was administered may be placed to maximize the overall immunity of the agent.
실시예Example 22 22
다음의 실험들에서, 일렬 하이브리드 항원의 혼합물은 면역원성을 위해 측정되었다. 오부알부민(SIINFEKL) 및 VSV(RGYVYQGL)로부터의 H2-Kb 클래스 I 펩티드에 덧붙여, 상기 H2-Kb β-카세인 펩티드 IAYFYPEL 및 상기 센다이 바이러스 펩티드 FAPGNYPAL 또한 사용되었다. 다른 실시예에서, 대안 배열(alternate configuration)에서 같은 항원 펩티드를 갖는 둘의 일렬 하이브리드 항원들은 혼합되었다. 4개의 에피토프에 대한 강한 면역 반응은 유도되었다. 모든 제제들은 본 명세서에서 1mM ADP를 포함하였다. 일 실시예는 아래와 같이 설명하였다.In the following experiments, mixtures of single-line hybrid antigens were measured for immunogenicity. In addition to the H2-K b class I peptides from obbualbumin (SIINFEKL) and VSV (RGYVYQGL), the H2-K b β-casein peptide IAYFYPEL and the Sendai virus peptide FAPGNYPAL were also used. In another embodiment, two single line hybrid antigens with the same antigenic peptide in an alternate configuration were mixed. A strong immune response to four epitopes was induced. All formulations included 1 mM ADP herein. One embodiment has been described as follows.
(200-72-04)(200-72-04)
5 S200-72-135 S200-72-13
S200-72-13S200-72-13
S200-72-13, no ADPS200-72-13, no ADP
실시예Example 23 23
다음의 실험에서, 두 일렬 하이브리드 항원의 혼합물 및 단일 하이브리드 항원을 B6 쥐에 투여될 때, 5개의 항원 펩티드까지 전달되고 공동-투여된 HSP70 없이 면역원성을 유도한다. 상기 일렬 하이브리드 항원들은 한쪽에 VSV 및 오부알부민 펩티드를 포함하였고, 다른 한쪽에 β-카세인 및 센다이 바이러스 펩티드를 포함하였다. 단일 하이브리드 항원은 NS2-114 인플렌자 펩티드(RTFSFQLI)를 함유하였다. In the following experiments, when a mixture of two-line hybrid antigens and a single hybrid antigen are administered to B6 mice, up to five antigenic peptides are delivered and induce immunogenicity without co-administered HSP70. The single-line hybrid antigens included VSV and obbualbumin peptides on one side and β-casein and Sendai virus peptides on the other. Single hybrid antigen contained NS2-114 influenza peptide (RTFSFQLI).
S200-72-15S200-72-15
실시예Example 24 24
열충격 단백질 없이 투여된 앞서 말한 단일 하이브리드 항원의 면역원성은 하이브리드 항원 존재시 헬퍼 T 세포 에피토프과 함께 병행하여 측정되었다. 대부분의 실험에서, 오부알부민의 H2-Kb 클래스 Ⅱ 에피토프, 아미노산 323-339, TEWTSSNVMEERKIKV는 사용되었다(예를 들어, 상기 하이브리드 항원은 서열 NLLRLTGWFFRKTEWTSSNVMEERKIKV를 가졌다). 클래스Ⅱ 펩티드-포함 하이브리드 항원의 포함물은 평균 약 7번 접힘에서 클래스I 에피토프에 대한 반응을 증가시켰다.The immunogenicity of the aforementioned single hybrid antigen administered without a heat shock protein was measured in parallel with the helper T cell epitope in the presence of the hybrid antigen. In most experiments, the H2-K b class II epitope of aminobubumin, amino acids 323-339, TEWTSSNVMEERKIKV was used (e.g., the hybrid antigen had the sequence NLLRLTGWFFRKTEWTSSNVMEERKIKV). Inclusion of a class II peptide-containing hybrid antigen increased the response to class I epitopes at an average of about seven foldings.
(250-72-08)(250-72-08)
실시예Example 25 25
열충격 단백질 존재시, H2-Kb 클래스Ⅱ 펩티드를 함유하는 다양한 하이브리드 항원과 함께 공동-투여된 하이브리드 항원의 면역원성에 대한 효과는 측정되었다. 클래스I 펩티드는 SSWDFITV 또는 DAPIYTNV이다; 클래스Ⅱ 펩티드는 상기 언급된 오부알부민 펩티드, 파상풍 변성독소로부터의 클래스Ⅱ 펩티드 NNFTVSFWLRVPKVSASHL(예를 들어, 상기 하이브리드 항원은 서열 NLLRLTGWFFRKNNFTVSFWLRVPKVSASHL을 갖는다.) 또는 HBV(아미노산 128-140)펩티드, TPPAYRPPNAPIL를 포함하였다. In the presence of heat shock proteins, the effect on the immunogenicity of hybrid antigens co-administered with various hybrid antigens containing H2-Kb class II peptides was measured. Class I peptides are SSWDFITV or DAPIYTNV; Class II peptides included the above-mentioned Obualbumin peptide, class II peptide NNFTVSFWLRVPKVSASHL (eg, the hybrid antigen has the sequence NLLRLTGWFFRKNNFTVSFWLRVPKVSASHL) or HBV (amino acids 128-140) peptide, TPPAYRPPNAPIL from the tetanus albumin peptide, tetanus toxin.
250-72-13250-72-13
따라서, 보조 T 세포 에피토프는 에피토프 만으로서 하이브리드 항원에서 포함고 클래스I 에피토프를 함유하는 다른 하이브리드 항원과의 혼합물로서 투여될 수 있고, 또는 보조 T 세포 에피토프는 에피토프들 중 하나로서 일렬 하이브리드 항원에서 포함될 수 있다. 이러한 것들은 본 발명의 하이브리드 항원 조성물에 따라 전형적인 많은 변이들에 불가하다. Thus, helper T cell epitopes can be administered in a hybrid antigen as epitope only and as a mixture with other hybrid antigens containing Class I epitopes, or helper T cell epitopes can be included in a single-line hybrid antigen as one of the epitopes. have. These are not possible with many of the variants typical of the hybrid antigen composition of the present invention.
실시예Example 26 26
앞서 설명된 실험과 비슷한 방법으로, 일렬 하이브리드 항원의 면역원성은 오부알부민 클래스Ⅱ 펩티드를 함유하는 하이브리드 항원의 공동-투여와 함께 및 공동-투여 없이 측정되었다. In a manner similar to the experiment described above, the immunogenicity of single-line hybrid antigens was measured with and without co-administration of hybrid antigens containing Obualbumin class II peptides.
S250-72-12S250-72-12
250-72-15250-72-15
실시예Example 27 27
열충격 단백질의 공동-투여의 존재시 최소 하나의 일렬 하이브리드 항원과 함께 공동 투여된 보조 T 세포 에피토프를 포함하는 하이브리드 항원를 가지고 한 비슷한 실험들은 또한 수행되었다.Similar experiments were also performed with hybrid antigens comprising adjuvant T cell epitopes co-administered with at least one single-line hybrid antigen in the presence of co-administration of heat shock proteins.
250-72-12250-72-12
실시예 28Example 28
인간 클래스I(HLA-A2) 에피토프를 포함하는 하이브리드 항원을 사용한 면역화 연구는 상기 전술된 HHDⅡ 쥐에서 수행되었다. 동물들은 5㎍ hsp70 및 33㎍ NLLRLTGWFFRKYMDGTMSQV로 만든 복합물로 면역화되었다. 300,000당 세포에서 상기 ELISPOT 결과들은: 배지, 1.33±0.58; 비세포 1±0; 비세포 + YMDGTMSQV 123±13: 및 비세포 + IMDQVPFSV 4±1이다.Immunization studies with hybrid antigens comprising human class I (HLA-A2) epitopes were performed in the HHDII mice described above. Animals were immunized with complexes made with 5 μg hsp70 and 33 μg NLLRLTGWFFRKYMDGTMSQV. The ELISPOT results in cells per 300,000 were: medium, 1.33 ± 0.58; Splenocytes 1 ± 0; Splenocytes + YMDGTMSQV 123 ± 13: and Splenocytes + IMDQVPFSV 4 ± 1.
실시예Example 29 29
HHDⅡ 쥐를 사용한 다른 실험에서, Trp-2로부터의 면역원성 HLA-A2 에피토프는 사용되었다(SVYDFFVWL). 이러한 에피토프는 또한 H2-Kb 에피토프이고 HHDⅡ 쥐가 B6 쥐(H2-Kb) 배경이기 때문에, Trp-2 펩티드에 대해 유도된 면역 반응은 쥐 모델에서 자가-에피토프에 대한 내성 파괴를 나타낸다. 본 실험의 결과들은 이러한 자가-에피토프에 대한 내성이 파괴되는 것을 설명하였고, 본 발명은 상기 하이브리드 항원 및 본 발명의 복합물을 투여함으로써 내성을 파괴하는 방법에 또한 연관된다. In another experiment with HHDII mice, immunogenic HLA-A2 epitopes from Trp-2 were used (SVYDFFVWL). Since these epitopes are also H2-Kb epitopes and HHDII mice are B6 mice (H2-Kb) background, the immune response induced against Trp-2 peptides indicates a breakdown of resistance to self-epitopes in the mouse model. The results of this experiment demonstrated that resistance to such self-epitopes was destroyed, and the present invention also relates to a method of destroying resistance by administering the hybrid antigen and the complex of the present invention.
HHDⅡ-200-72-03HHDⅡ-200-72-03
실시예Example 30 30
HHDⅡ 쥐는 hsp70 및 실시예 27 네번째 세트인 특정한 HIV 바이러스 성분 에피토프를 포함하는 세 개의 하이브리드 항원의 면역원성을 측정하기 위해 사용되었다. HHDII mice were used to determine the immunogenicity of three hybrid antigens comprising hsp70 and the fourth set of Example 27 specific HIV viral component epitopes.
HHDⅡ-200-72-07HHDⅡ-200-72-07
실시예Example 31 31
hsp70과 함께 혼합된 H2-Kb 에피토프를 함유하는 하이브리드 항원의 혼합물은 상기 설명된 바와 같이 B6 쥐에서 면역원성을 위해 측정되었다. A mixture of hybrid antigens containing H2-Kb epitope mixed with hsp70 was measured for immunogenicity in B6 mice as described above.
OBS-/2-01OBS- / 2-01
실시예Example 32 32
hsp70으로 혼합된 일렬 하이브리드 항원의 면역원성은 B6 쥐에서 연구되었다. The immunogenicity of single-line hybrid antigens mixed with hsp70 was studied in B6 mice.
S200-72-01S200-72-01
본 발명의 많은 변형과 변화들은 본 발명의 사상과 범위로부터 벗어남 없이 만들어질 수 있으며, 그것은 본 발명이 속한 분야에서 통상의 지식을 가진 자에게 명백하다. 본 명세서에서 설명된 구체적인 실시예는 예시적인 방법으로만 제공되고, 본 발명은 첨부된 청구범위와 함께 그러한 청구항들이 부여한 균등물의 완전한 범위에만 한정된다.Many modifications and variations of the present invention can be made without departing from the spirit and scope of the invention, which is apparent to those of ordinary skill in the art. The specific embodiments described herein are provided by way of example only, and the invention is limited only in the full scope of the equivalents to which such claims are entitled, along with the appended claims.
다양한 공개는 본 명세서에 인용되고 그것의 내용은 전체적으로 참고문헌에 의해 본 명세서에 포함된다.Various publications are cited herein and the contents of which are incorporated herein by reference in their entirety.
본 발명은 대상에서 면역 반응을 유도하는 방법 및 조성물에 관한 것이고, 여기서 대상은 유효량의 적어도 하나 이상의 정해진 하이브리드 항원 및 선택적으로 하나 이상의 열 충격 단백질들과 결합하여 투여된다. 이 방법들 및 조성물들은 감염성 질환 및 종양의 치료에 사용될 수 있다.The present invention relates to methods and compositions for inducing an immune response in a subject, wherein the subject is administered in combination with an effective amount of at least one defined hybrid antigen and optionally one or more heat shock proteins. These methods and compositions can be used to treat infectious diseases and tumors.
Claims (21)
Applications Claiming Priority (12)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US46246903P | 2003-04-11 | 2003-04-11 | |
US60/462,469 | 2003-04-11 | ||
US46374603P | 2003-04-18 | 2003-04-18 | |
US60/463,746 | 2003-04-18 | ||
US50341703P | 2003-09-16 | 2003-09-16 | |
US60/503,417 | 2003-09-16 | ||
US10/776,521 | 2004-02-12 | ||
US10/776,521 US7420037B2 (en) | 2003-02-13 | 2004-02-12 | Heat shock protein-based vaccines and immunotherapies |
PCT/US2004/004340 WO2004071457A2 (en) | 2003-02-13 | 2004-02-13 | Improved heat shock protein-based vaccines and immunotherapies |
WOPCT/US04/04340 | 2004-02-13 | ||
US10/820,067 | 2004-04-08 | ||
US10/820,067 US7309491B2 (en) | 2003-04-11 | 2004-04-08 | Heat shock protein-based vaccines and immunotherapies |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20050121721A true KR20050121721A (en) | 2005-12-27 |
Family
ID=35539709
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020057019351A KR20050121721A (en) | 2003-04-11 | 2004-04-09 | Improved heat shock protein-based vaccines and immunotherapies |
Country Status (8)
Country | Link |
---|---|
EP (1) | EP1617804A4 (en) |
JP (1) | JP2007525448A (en) |
KR (1) | KR20050121721A (en) |
AU (1) | AU2004229458B2 (en) |
BR (1) | BRPI0409321A (en) |
CA (1) | CA2521809A1 (en) |
MX (1) | MXPA05010881A (en) |
WO (1) | WO2004091493A2 (en) |
Families Citing this family (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1670507A4 (en) * | 2003-09-12 | 2007-10-17 | Antigenics Inc | Vaccine for treatment and prevention of herpes simplex virus infection |
EP2407178A2 (en) | 2005-04-19 | 2012-01-18 | Eli Lilly and Company | Monovalent and polyvalent synthetic polysaccharide antigens for immunological intervention in disease |
CY1112212T1 (en) * | 2008-04-24 | 2015-12-09 | Immatics Biotechnologies Gmbh | NEW VEGETABLE FORMATS OF VOLUME CONNECTED WITH PARTICULARS OF ANTI-HUMAN LEVEL CELLS (HLA) CLASS I OR II |
DK2113253T3 (en) * | 2008-04-30 | 2010-07-19 | Immatics Biotechnologies Gmbh | New Composition of Tumor-Associated Peptides Binding to Human Leukocyte Antigen (HLA) Class I or II Molecules for Vaccine Use |
EP2734231A1 (en) * | 2011-07-21 | 2014-05-28 | Biotech Tools S.A. | Dosage of dnak |
EA201792501A1 (en) | 2015-05-13 | 2018-10-31 | Эйдженус Инк. | VACCINES FOR THE TREATMENT AND PREVENTION OF CANCER |
EP3784688A2 (en) | 2018-04-26 | 2021-03-03 | Agenus Inc. | Heat shock protein-binding peptide compositions and methods of use thereof |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9202219D0 (en) * | 1992-02-03 | 1992-03-18 | Connaught Lab | A synthetic heamophilus influenzae conjugate vaccine |
IL123218A0 (en) * | 1995-08-18 | 1998-09-24 | Sloan Kettering Inst Cancer | Heat shock protein-based vaccines and immunotherapies |
IL135860A0 (en) * | 1997-10-31 | 2001-05-20 | Sloan Kettering Inst Cancer | Conjugate heat shock protein-binding peptides |
JP2003533445A (en) * | 2000-04-17 | 2003-11-11 | イー. ロスマン,ジェイムズ | Javelinization of protein antigens against heat shock proteins |
US20040071656A1 (en) * | 2001-12-26 | 2004-04-15 | Felix Wieland | Modulation of heat-shock-protein-based immunotherapies |
US7420037B2 (en) * | 2003-02-13 | 2008-09-02 | Antigenics Inc. | Heat shock protein-based vaccines and immunotherapies |
-
2004
- 2004-04-09 AU AU2004229458A patent/AU2004229458B2/en not_active Expired - Fee Related
- 2004-04-09 EP EP04759338A patent/EP1617804A4/en not_active Withdrawn
- 2004-04-09 JP JP2006509858A patent/JP2007525448A/en active Pending
- 2004-04-09 MX MXPA05010881A patent/MXPA05010881A/en not_active Application Discontinuation
- 2004-04-09 CA CA002521809A patent/CA2521809A1/en not_active Abandoned
- 2004-04-09 KR KR1020057019351A patent/KR20050121721A/en not_active Application Discontinuation
- 2004-04-09 WO PCT/US2004/010983 patent/WO2004091493A2/en active Application Filing
- 2004-04-09 BR BRPI0409321-6A patent/BRPI0409321A/en not_active IP Right Cessation
Also Published As
Publication number | Publication date |
---|---|
MXPA05010881A (en) | 2006-05-31 |
WO2004091493A2 (en) | 2004-10-28 |
BRPI0409321A (en) | 2006-05-23 |
AU2004229458B2 (en) | 2009-11-19 |
CA2521809A1 (en) | 2004-10-28 |
EP1617804A4 (en) | 2007-07-25 |
JP2007525448A (en) | 2007-09-06 |
WO2004091493A3 (en) | 2006-04-20 |
EP1617804A2 (en) | 2006-01-25 |
AU2004229458A1 (en) | 2004-10-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6663868B1 (en) | Heat shock protein-based vaccines and immunotherapies | |
Krupka et al. | Endotoxin-minimized HIV-1 p24 fused to murine hsp70 activates dendritic cells, facilitates endocytosis and p24-specific Th1 response in mice | |
AU2004212003B2 (en) | Improved heat shock protein-based vaccines and immunotherapies | |
Berger et al. | A lymphocyte cell surface heat shock protein homologous to the endoplasmic reticulum chaperone, immunoglobulin heavy chain binding protein BIP | |
US7618637B2 (en) | Heat shock protein-based vaccines and immunotherapies | |
US6719974B1 (en) | Heat shock protein-based vaccines and immunotherapies | |
AU2004229458B2 (en) | Improved heat shock protein-based vaccines and immunotherapies | |
US7309491B2 (en) | Heat shock protein-based vaccines and immunotherapies | |
KR20210005646A (en) | Heat shock protein-binding peptide composition and method for use thereof | |
Binder et al. | Naturally formed or artificially reconstituted non-covalent alpha2-macroglobulin-peptide complexes elicit CD91-dependent cellular immunity | |
US6773707B1 (en) | Heat shock protein-based vaccines and immunotherapies | |
Vatner et al. | The tailless complex polypeptide-1 ring complex of the heat shock protein 60 family facilitates cross-priming of CD8 responses specific for chaperoned peptides |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WITN | Application deemed withdrawn, e.g. because no request for examination was filed or no examination fee was paid |