KR102401595B1 - Anti-HER2 scFv Fragment and Anti-HER2 antibody and Anti-c-Met/Anti-HER2 Bispecific Antibodies Comprising the Same - Google Patents

Abstract

Provided are an anti-HER2 scFv fragment, an anti-HER2 antibody and an anti-c-Met/anti-HER2 bispecific antibody comprising the same, and a pharmaceutical composition for preventing and/or treating cancer comprising the same.

Description

Anti-HER2 scFv fragment and anti-c-Met/anti-HER2 bispecific antibody comprising same

Provided are an anti-HER2 scFv fragment, an anti-HER2 antibody and an anti-c-Met/anti-HER2 bispecific antibody comprising the same, and a pharmaceutical composition for preventing and/or treating cancer comprising the same.

c-Met and Her2 (or HER family) interact with each other and are involved in several mechanisms related to tumors. Since these two targets are representative RTK (Receptor Tyrosine Kinase) present on the cell surface, they induce cancer cell proliferation, cancer cell invasion, and angiogenesis. In addition, by interacting with each other, these proteins may participate in each other's signal transduction system to induce resistance to each therapeutic agent.

On the other hand, dual antibodies targeting two or more antigens are being developed in a wide variety of types and forms, and are expected as new antibody drugs with superior therapeutic effects than monoclonal antibodies. Until now, most of the double antibodies have been developed in the direction of increasing the therapeutic effect of cancer by simultaneously recognizing the antigen of cytotoxic cells and the antigen of cancer cells so that the cancer cells are killed by the cytotoxic cells. However, considering the research results that cancer cells themselves can be mutated, proliferated, and invaded by various other antigens or ligands in the same cancer cell, a double antibody that recognizes not only the antigen of a cytotoxic cell but also another antigen of the cancer cell expected to be able to treat

Therefore, there is a need for the development of a bispecific antibody that is predicted to achieve a more effective cancer treatment effect by simultaneously recognizing two or more antigens in cancer cells.

One example provides a polypeptide comprising one or a combination of two or more selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 131. The polypeptide can be used as a complementarity determining region (CDR) of an anti-HER2 antibody.

Another example is a CDR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 111, a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 112 to SEQ ID NO: 114, and SEQ ID NO: 115 to one or more heavy chain complementarity determining regions selected from the group consisting of CDR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 119; A CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 120 to SEQ ID NO: 123, a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 124 to SEQ ID NO: 126, and SEQ ID NO: 127 to SEQ ID NO: 131 at least one light chain complementarity determining region selected from the group consisting of CDR-L3 comprising an amino acid sequence selected from the group consisting of; Or an anti-HER2 antibody or antigen-binding fragment thereof comprising a combination thereof is provided.

Another example provides an anti-c-Met/anti-HER2 bispecific antibody comprising an anti-c-Met antibody or antigen-binding fragment thereof, and an anti-HER2 antibody or antigen-binding fragment thereof.

Another example provides a composition for preventing and/or treating cancer comprising the anti-c-Met/anti-HER2 bispecific antibody as an active ingredient.

Another example provides a method for preventing and/or treating cancer, comprising administering to a patient in need thereof a pharmaceutically effective amount of an anti-c-Met/anti-HER2 bispecific antibody.

Existing targeted therapy, which recognizes only HER2, a representative target that is frequently expressed in cancer cells, reduces the therapeutic effect by overexpressing and activating c-Met and causing cancer cells to acquire resistance to the drug. The dual antibody that recognizes c-Met and HER2 simultaneously blocks the signal transduction of cancer cells by c-Met, the cause of drug resistance, in advance, preventing the development of resistance, and suppressing excellent cancer cells even in resistant cancer cells It was confirmed that the effect was shown.

In addition, although various diabodies are being developed, their efficacy has not been proven in clinical trials or various side effects have been observed, so there are many cases in which they do not receive FDA approval and do not appear on the market as antibody therapeutics. One of the biggest reasons that diabodies of various forms and mechanisms have not been developed to the commercial stage despite the fact that they are being developed is due to problems in the stability and productivity of the antibody. Early diabodies in the form of IgG had a problem in mass production because it was very difficult to isolate and purify one type of diabodies as random combinations of the antibody light and heavy chains were made during the production process. In addition, in the case of a non-IgG antibody, stability as a drug has not been verified in parts such as protein folding and pharmacokinetics. The present inventors have found that a diabody in which an antibody recognizing HER2, a secondary target, or an antigen-binding fragment thereof (eg, scFv) is fused to an anti-c-Met antibody can improve the stability problem, which was the biggest problem of the existing diabody. confirmed that there is.

One embodiment of the present invention provides a polypeptide having a novel sequence. The polypeptide may have a function as a CDR of an anti-HER2 antibody. More specifically, the polypeptide may include one or a combination of two or more selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 131. The polypeptide having the amino acid sequence of SEQ ID NO: 109 to SEQ ID NO: 131 may have a function as a CDR of an anti-HER2 antibody as shown in Tables 1 and 2, respectively:

CDR-H1 CDR-H2 CDR-H3 SYWIG (SEQ ID NO: 109)
DYAMS (SEQ ID NO: 110)
SYAIS (SEQ ID NO: 111) IIYPGDSDTRYSPSFQG (SEQ ID NO: 112)
FIRSKAYGGTTEYAASVKG (SEQ ID NO: 113)
GIIPIFGTANYAQKFQG (SEQ ID NO: 114) RHYYDSSGYSYFPDY (SEQ ID NO: 115)
RLSVAAAGTGGYNWFDP (SEQ ID NO: 116)
RDLYPAMAEY (SEQ ID NO: 117)
RDSGYSYGYPMNYYYYYMDV (SEQ ID NO: 118)
RLVVGANPPTYYFDY (SEQ ID NO: 119)

CDR-L1 CDR-L2 CDR-L3 GLSSGSVSTSYYPS (SEQ ID NO: 120)
GLTSGSVSTSYYPS (SEQ ID NO: 121)
TRSSGSIDSNFVQ (SEQ ID NO: 122)
GLSSGSVSPTYYPS (SEQ ID NO: 123) STNTRSSGVPD (SEQ ID NO: 124)
DDNQRPSGVPD (SEQ ID NO: 125)
RTNIRSSGVPD (SEQ ID NO: 126) VLYMGSGIWV (SEQ ID NO: 127)
MLYLGGGISV (SEQ ID NO: 128)
QSYDSNNQV (SEQ ID NO: 129)
LLYMGSGVSL (SEQ ID NO: 130)
VLYMGSGISL (SEQ ID NO: 131)

In one embodiment, two or more of the polypeptides may be combined and used as the heavy chain variable region or light chain variable region of the anti-HER2 antibody.

For example, the polypeptide comprises a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 111 (usable as CDR-H1), an amino acid sequence selected from the group consisting of SEQ ID NO: 112 to SEQ ID NO: 114 (available as CDR-H2), and a polypeptide (available as CDR-H3) comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 115 to 119, such polypeptides As an example, a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136 may be mentioned. The polypeptide may function as, for example, a heavy chain variable region of an anti-HER2 antibody.

In another example, the polypeptide comprises a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 120 to SEQ ID NO: 123 (available as CDR-L1), an amino acid sequence selected from the group consisting of SEQ ID NO: 124 to SEQ ID NO: 126 It may include a polypeptide (usable as CDR-L2) comprising Examples of the polypeptide include a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 137 to SEQ ID NO: 141. The polypeptide may function as, for example, a light chain variable region of an anti-HER2 antibody.

In another example, the polypeptide comprises a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 111 (usable as CDR-H1), an amino acid selected from the group consisting of SEQ ID NO: 112 to SEQ ID NO: 114 a polypeptide comprising a sequence (available as CDR-H2), and a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 115 to 119 (available as CDR-H3); And a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 120 to SEQ ID NO: 123 (usable as CDR-L1), a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 124 to SEQ ID NO: 126 (CDR -L2), and a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 127 to SEQ ID NO: 131 (usable as CDR-L3) may include a combination of polypeptides, such as Poly containing a combination of a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136 and a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 137 to SEQ ID NO: 141 as an example of a polypeptide peptides. The polypeptide may be used, for example, as an anti-HER2 antibody or an antigen-binding fragment of an anti-HER2 antibody comprising a heavy chain variable region and a light chain variable region.

The polypeptide may be non-naturally occurring. For example, the polypeptide may be produced by a recombinant method, a synthetic method, and/or digestion of a protein (recombinant protein or artificially synthesized protein) containing the polypeptide.

The polypeptide may serve as a precursor or constituent part of an antagonist to HER2, such as an anti-HER2 antibody, an antigen-binding fragment of the antibody, or an anti-HER2 antibody analog (eg, peptibody, Nanobody, etc.).

Accordingly, another example provides an antagonist to HER2 comprising said polypeptide. The antagonist acts to inhibit the function of HER2, and is at least one selected from the group consisting of an anti-HER2 antibody, an antigen-binding fragment of the antibody, and an anti-HER2 antibody analog (eg, peptibody, nanobody, etc.). can

The "HER2 (Human epidermal growth factor receptor 2)" is encoded by the ERBB2 gene, and is a member of the epidermal growth factor receptor (EGFR/ErbB). HER2 is known to play an essential role in regulating cell proliferation and differentiation. Specifically, when extracellular growth factors are bound, they have a strong tendency to assemble into homo- and/or heterodimers with other HER receptors, which leads to activation of various types of signaling pathways, leading to apoptosis, survival, or cell proliferation. induce For example, the HER2 protein may be human HER2 (eg, GenBank Accession Nos. NP_004439.2, NP_001005862, etc.), mouse HER2 (eg, GenBank Accession No. NP_001003817), etc., which are GenBank Accession Numbers NM 004448.2, NM NM_001005862, respectively. 1, NM_001003817, etc. may be encoded by a nucleotide sequence (mRNA).

The term “antagonist” is to be interpreted as encompassing any molecule that partially or completely blocks, inhibits or neutralizes one or more of the biological activities of a target (eg, HER2). For example, an “antagonist” antibody refers to an antibody that inhibits or reduces the biological activity of an antigen to which the antibody binds (eg, HER2). Antagonists may act by binding to a receptor for a ligand (target), reducing receptor phosphorylation, incapacitating cells that have been activated by the ligand, or killing them. In addition, antagonists block the receptor-ligand interaction completely, bind the receptor competitively with the ligand, or block the receptor-ligand interaction by altering or down-regulating the tertiary structure of the receptor. can be substantially reduced.

The term “peptide + antibody” refers to a fusion protein in which all or part of a constant region such as a peptide and an antibody Fc region is fused, wherein the peptide is an antigen-binding region (heavy chain and/or light chain CER or variable region). By acting, it refers to a protein having a framework and function similar to that of an antibody.

The term "nanobody" is also referred to as a single-domain antibody, and refers to an antibody fragment comprising a single variable domain of an antibody in a monomeric form, and similarly to an antibody with a complete structure, it selectively binds to a specific antigen has the characteristics of The molecular weight of Nanobodies is generally about 12 kDa to about 15 kDa, which is very small compared to the general molecular weight (about 150 kDa to about 160 kDa) of a complete antibody (including two heavy chains and two light chains), in some cases is smaller than the Fab fragment or scFv fragment.

In an embodiment, the polypeptide may serve as a precursor or component of an anti-HER2 antibody.

Another example provides an anti-HER2 antibody or antigen-binding fragment thereof comprising the polypeptide. The antigen-binding fragment may be selected from the group consisting of scFv, (scFv)2, scFv-Fc, Fab, Fab' and F(ab')2.

Specifically, the anti-HER2 antibody or antigen-binding fragment thereof,

A CDR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 111, a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 112 to SEQ ID NO: 114, and SEQ ID NO: 115 to SEQ ID NO: 119 at least one heavy chain complementarity determining region selected from the group consisting of CDR-H3 comprising an amino acid sequence selected from the group consisting of, or a heavy chain variable region comprising the at least one heavy chain complementarity determining region;

A CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 120 to SEQ ID NO: 123, a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 124 to SEQ ID NO: 126, and SEQ ID NO: 127 to SEQ ID NO: 131 at least one light chain complementarity determining region selected from the group consisting of CDR-L3 comprising an amino acid sequence selected from the group consisting of, or a light chain variable region comprising the at least one light chain complementarity determining region;

a combination of said at least one heavy chain complementarity determining region and said at least one light chain complementarity determining region; or

Combination of the heavy chain variable region and the light chain variable region

may include.

For example, the anti-HER2 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136, and an amino acid sequence selected from the group consisting of SEQ ID NO: 137 to SEQ ID NO: 141 It may include a light chain variable region, or a combination thereof.

In one embodiment, the anti-HER2 antibody or antigen-binding fragment thereof is a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136, and SEQ ID NO: 137 to SEQ ID NO: 141 selected from the group consisting of It may be an anti-HER2 scFv comprising a light chain variable region comprising an amino acid sequence.

In the antigen-binding fragment of the anti-HER2 antibody, such as the anti-HER2 scFv, the heavy chain variable region and the light chain variable region may be linked through or without a linker, such as a peptide linker. The peptide linker may be a polypeptide consisting of 1 to 100 or 2 to 50 arbitrary amino acids, and the type of amino acids included is not limited. The peptide linker may include, for example, Gly, Asn and/or Ser residues, and may also include neutral amino acids such as Thr and/or Ala. Suitable amino acid sequences for peptide linkers are known in the art. On the other hand, the length of the linker can be variously determined within the limit that does not affect the function of the bispecific antibody. For example, the peptide linker may include a total of 1 to 100, 2 to 50, or 5 to 25 of one or more selected from the group consisting of Gly, Asn, Ser, Thr, and Ala. In one example, the peptide linker may be expressed as (G4S)n (n is the number of repetitions of (G4S)), which is an integer of 1 to 10, such as an integer of 2 to 5).

As used herein, the term “antibody” refers to a substance produced by stimulation of an antigen in the immune system, and the type thereof is not particularly limited. In the present invention, the antibody includes an animal antibody, a chimeric antibody, a humanized antibody, or a human antibody. In addition, the antibody or antigen-binding fragment may be isolated from a living body or may not exist naturally. The antibody or antigen-binding fragment may be recombinantly or synthetically produced.

In the present invention, the term "antibody" also includes an antigen-binding fragment of an antibody having antigen-binding ability. Meanwhile, the term "complementarity-determining regions (CDR)" refers to a region conferring antigen-binding specificity among variable regions of an antibody. The antigen-binding fragment of the antibody described above is an antibody fragment comprising one or more of the complementarity determining regions, for example, scFv, (scFv)2, scFv-Fc, Fab, Fab' and F(ab')2 selected from the group consisting of it could be

In the anti-HER2 antibody or antigen-binding fragment thereof, the regions other than the heavy and light chain CDR regions as defined above, or the heavy and light chain variable regions, are immunoglobulins of all subtypes (eg, IgA, IgD, IgE, IgG (IgG1). , IgG2, IgG3, or IgG4), IgM, etc.), for example, it may be derived from the light chain constant region and/or the heavy chain constant region of all of the above subtypes of immunoglobulins.

Since the anti-HER2 antibody or antigen-binding fragment thereof specifically binds to HER2, it is possible to detect HER2 using the anti-HER2 antibody or to determine whether HER2 is activated and/or overproduced (overexpressed).

Accordingly, another example of the present invention provides a composition for detecting HER2 comprising the anti-HER2 antibody or antigen-binding fragment thereof. Another example comprises the steps of treating a biological sample with the anti-HER2 antibody or antigen-binding fragment thereof; And it provides a HER2 detection method comprising the step of determining whether the antigen-antibody reaction (binding). In the detection method, when an antigen-antibody reaction is detected, it may be determined that HER2 is present in the biological sample. Another example provides the use of the anti-HER2 antibody or antigen-binding fragment thereof for detecting HER2. The biological sample may be selected from the group consisting of cells, tissues, and body fluids (eg, blood, serum, etc.) obtained from mammals such as rodents including humans and monkeys, mice, and rodents. may be separated from The detection of HER2 refers to confirming the presence or absence of HER2 expression, or the presence or expression level of HER2.

Another example provides a pharmaceutical composition for diagnosing a disease related to HER2 activation and/or overproduction and/or HER2 activation and/or overproduction, including the anti-HER2 antibody or antigen-binding fragment thereof. In another example, treating the anti-HER2 antibody or antigen-binding fragment thereof to a biological sample obtained from a patient; And it provides a method of providing information to the diagnosis (diagnosis) of a disease related to activation and/or overproduction of HER2, or activation and/or overproduction of HER2, comprising the step of determining whether an antigen-antibody reaction is present. In the method, when the degree of antigen-antibody reaction in the biological sample is higher than the degree of antigen-antibody reaction in the normal sample, the biological sample or the patient from which the biological sample was obtained is treated with HER2 activation and/or overproduction symptoms. is present, or it can be judged to have a disease related to activation and/or overproduction of HER2. Accordingly, the method comprises the steps of treating a normal sample with the anti-HER2 antibody or antigen-binding fragment thereof; And it may further include the step of determining whether the antigen-antibody reaction. Another example provides the use of the anti-HER2 antibody or antigen-binding fragment thereof for diagnosing a disease associated with HER2 activation and/or overproduction and/or HER2 activation and/or overproduction.

The biological sample may be selected from the group consisting of cells, tissues, and body fluids (eg, blood, serum, lymph fluid, etc.) obtained from a patient to be diagnosed, and may be isolated from the living body. The normal sample is selected from the group consisting of cells, tissues, body fluids (eg, blood, serum, lymphatic fluid, etc.) obtained from a patient not having a disease associated with HER2 activation and/or overproduction and/or HER2 activation and/or overproduction. It may be a selected one, or it may be one isolated from a living body. The patient may be selected from mammals including humans and primates including monkeys and rodents including mice and rats.

The step of confirming the antigen-antibody reaction may be performed through various methods known in the art. For example, it may be measured through a conventional enzymatic reaction, fluorescence, luminescence and/or radiation detection, and specifically, immunochromatography, immunohistochemistry, enzyme-linked immunosorbent assay. assay: ELISA), radioimmunoassay (RIA), enzyme immunoassay (EIA), fluoresence immunoassay (FIA), luminescence immunoassay (LIA), Western blotting ), microarray, surface plasmon resonance (SPR), etc. may be measured by a method selected from the group consisting of, but is not limited thereto.

Another example provides an anti-c-Met/anti-HER2 bispecific antibody comprising an anti-c-Met antibody or antigen-binding fragment thereof, and an anti-HER2 antibody or antigen-binding fragment thereof. The antigen-binding fragment may be selected from the group consisting of scFv, (scFv)2, scFvFc, Fab, Fab' and F(ab')2.

The "c-Met protein" refers to a receptor tyrosine kinase that binds to hepatocyte growth factor. The c-Met protein may be derived from any species, for example, from a primate such as human c-Met (eg, NP_000236), monkey c-Met (eg, Macaca mulatta, NP_001162100), or mouse c- Met (eg NP_032617.2), rat c-Met (eg NP_113705.1), etc. from rodents, and the like. The protein comprises, for example, a polypeptide encoded by a nucleotide sequence provided in GenBank Accession Number NM_000245, or a protein encoded by a polypeptide sequence provided in GenBank Accession Number NM_000236, or an extracellular domain thereof. Receptor tyrosine kinase c-Met is involved in several mechanisms such as, for example, cancer development, cancer metastasis, cancer cell migration, cancer cell invasion, and angiogenesis processes.

In one embodiment, the anti-c-Met/anti-HER2 bispecific antibody is an anti-c-Met antibody or antigen-binding fragment thereof, and the C-terminus or N-terminus, such as the C-terminus, of the anti-c-Met antibody or antigen-binding fragment thereof. It may include a linked anti-HER2 antibody or antigen-binding fragment thereof.

In the anti-c-Met/anti-HER2 bispecific antibody, the anti-c-Met antibody plays a role in mediating the movement and degradation of the c-Met protein into cells, so it has a complete antibody structure to fully fulfill this role. It may be advantageous, and since the anti-HER2 antibody is important for specific recognition and binding to HER2, it may include an antigen-binding fragment that recognizes HER2. Accordingly, the anti-c-Met/anti-HER2 bispecific antibody comprises a complete antibody to anti-c-Met (eg, an IgG-type antibody) and an antigen-binding fragment (eg, scFv, (scFv) of the anti-HER2 antibody linked to the C-terminus of the antibody. )2, scFv-Fc, Fab, Fab' and F(ab')2) may be included.

In the anti-c-Met/anti-HER2 bispecific antibody, the anti-c-Met antibody or antigen-binding fragment thereof and the anti-HER2 antibody or antigen-binding fragment thereof may be linked through or without a linker, such as a peptide linker. Also, the heavy chain portion and the light chain portion in the antigen-binding fragment, such as the heavy chain variable region and the light chain variable region in the scFv fragment, may be linked via or without a peptide linker. The peptide linker connecting the anti-c-Met antibody or antigen-binding fragment thereof and the anti-HER2 antibody or antigen-binding fragment thereof and the peptide linker connecting the heavy chain portion and the light chain portion in the antigen-binding fragment may be the same or different. The peptide linker may be a polypeptide consisting of 1 to 100 or 2 to 50 arbitrary amino acids, and the type of amino acids included is not limited. The peptide linker may include, for example, Gly, Asn and/or Ser residues, and may also include neutral amino acids such as Thr and/or Ala. Suitable amino acid sequences for peptide linkers are known in the art. On the other hand, the length of the linker can be variously determined within the limit that does not affect the function of the bispecific antibody. For example, the peptide linker may include a total of 1 to 100, 2 to 50, or 5 to 25 of one or more selected from the group consisting of Gly, Asn, Ser, Thr, and Ala. In one example, the peptide linker may be expressed as (G4S)n (n is the repeating number of (GGGGS)), an integer of 1 to 10, such as an integer of 2 to 5).

In an embodiment, the anti-HER2 antibody or antigen-binding fragment thereof comprises:

A CDR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 111, a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 112 to SEQ ID NO: 114, and SEQ ID NO: 115 to SEQ ID NO: 119 at least one heavy chain complementarity determining region selected from the group consisting of CDR-H3 comprising an amino acid sequence selected from the group consisting of, or a heavy chain variable region comprising the at least one heavy chain complementarity determining region;

A CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 120 to SEQ ID NO: 123, a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 124 to SEQ ID NO: 126, and SEQ ID NO: 127 to SEQ ID NO: 131 at least one light chain complementarity determining region selected from the group consisting of CDR-L3 comprising an amino acid sequence selected from the group consisting of, or a light chain variable region comprising the at least one light chain complementarity determining region;

a combination of said at least one heavy chain complementarity determining region and said at least one light chain complementarity determining region; or

Combination of the heavy chain variable region and the light chain variable region

may include.

For example, the anti-HER2 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136, and an amino acid sequence selected from the group consisting of SEQ ID NO: 137 to SEQ ID NO: 141 It may include a light chain variable region, or a combination thereof.

In one embodiment, the anti-HER2 antibody or antigen-binding fragment thereof is a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136, and SEQ ID NO: 137 to SEQ ID NO: 141 selected from the group consisting of It may be an anti-HER2 scFv comprising a light chain variable region comprising an amino acid sequence.

The "antigen-binding fragment" refers to a fragment of the entire immunoglobulin structure, and refers to a portion of a polypeptide including a portion capable of binding an antigen. For example, it may be scFv, (scFv) ₂ , scFvFc, Fab, Fab' or F(ab') ₂ , but is not limited thereto. The antigen-binding fragment of the antibody in the present invention is an antibody fragment comprising one or more of the complementarity determining regions, such as scFv, (scFv)2, scFv-Fc, Fab, Fab' and F(ab')2 from the group consisting of may be selected.

Among the antigen-binding fragments, Fab has a structure having a light chain and heavy chain variable regions, a light chain constant region and a heavy chain first constant region (C _H1 ), and has one antigen-binding site.

Fab' differs from Fab in that it has a hinge region comprising one or more cysteine residues at the C-terminus of the heavy chain C _H1 domain. The F(ab') ₂ antibody is produced by forming a disulfide bond with a cysteine residue in the hinge region of Fab'.

Fv is a minimal antibody fragment having only a heavy chain variable region and a light chain variable region, and a recombinant technique for generating an Fv fragment is well known in the art. In a double-chain Fv (two-chain Fv), the heavy chain variable region and the light chain variable region are connected by a non-covalent bond, and single-chain Fv (scFv) is generally a heavy chain variable region and a single chain variable region through a peptide linker. The regions may be linked by a covalent bond or linked directly at the C-terminus to form a dimer-like structure like a double-stranded Fv. The peptide linker may be as described above, for example, 1 to 100, for example, 2 to 50, or 5 to 25 amino acids in length, and the type of amino acids included therein is not limited.

The antigen-binding fragment can be obtained using a proteolytic enzyme (for example, by restriction digestion of the entire antibody with papain to obtain Fab, and by digestion with pepsin to obtain a F(ab') ₂ fragment), It can be produced through genetic recombination technology.

In an embodiment, the anti-c-Met/anti-HER2 bispecific antibody comprises an anti-c-Met antibody and a scFv, (scFv) ₂ , scFv-Fc, Fab of the anti-HER2 antibody linked to the C terminus of the anti-c-Met antibody. , Fab' or F(ab') ₂ , such as scFv. For example, scFv, (scFv) ₂ , scFv-Fc, Fab, Fab' or F(ab') ₂ of the anti-HER2 antibody is

- a CDR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 111, a CDR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 112 to SEQ ID NO: 114, and SEQ ID NO: 115 to SEQ ID NO: at least one heavy chain complementarity determining region selected from the group consisting of CDR-H3 comprising an amino acid sequence selected from the group consisting of 119, or a heavy chain variable region comprising the at least one heavy chain complementarity determining region; and

- a CDR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 120 to SEQ ID NO: 123, a CDR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 124 to SEQ ID NO: 126, and SEQ ID NO: 127 to SEQ ID NO: At least one light chain complementarity determining region selected from the group consisting of CDR-L3 comprising an amino acid sequence selected from the group consisting of 131, or a light chain variable region comprising the at least one light chain complementarity determining region

may include. For example, scFv, (scFv) ₂ , scFv-Fc, Fab, Fab' or F(ab') ₂ of the anti-HER2 antibody is a heavy chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 132 to 136 and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 137 to SEQ ID NO: 141.

Accordingly, in one embodiment, the anti-c-Met/anti-HER2 bispecific antibody is an anti-c-Met antibody, and an amino acid selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136 linked to the C-terminus of the anti-c-Met antibody scFv, (scFv) ₂ , scFv-Fc, Fab, Fab' of an anti-HER2 antibody comprising a heavy chain variable region comprising a sequence and a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 137 to 141 Or F(ab') ₂ may be included.

The anti-c-Met antibody may recognize a specific site of c-Met, for example, a specific site within the SEMA domain as an epitope, and all antibodies that act on c-Met to induce internalization and degradation. or an antigen-binding fragment thereof.

c-Met, a receptor for hepatocyte growth factor (HGF), is divided into three parts: an extracellular region, a transmembrane region, and an intracellular region. In a linked form, the HGF-binding domain consists of a SEMA domain, a PSI domain (plexin-semaphorins-integrin homology domain), and an IPT domain (immunoglobulin-like fold shared by plexins and transcriptional factors domain). The SEMA domain of the c-Met protein may have the amino acid sequence of SEQ ID NO: 79, and is a domain present in the extracellular region of c-Met and corresponds to a site to which HGF binds. A specific site in the SEMA domain, for example, the region having the amino acid sequence of SEQ ID NO: 71 corresponding to positions 106 to 124 is a loop between propeller domains 2 and 3 among epitopes in the SEMA domain of c-Met protein. Corresponding to the region, it can act as an epitope of the anti-c-Met antibody proposed in the present invention.

The term “epitope” is interpreted to mean a portion of an antigen recognized by an antibody, as an antigenic determinant. According to one embodiment, the epitope is a region comprising 5 or more consecutive amino acids in the SEMA domain of c-Met protein (SEQ ID NO: 79), for example, the 106th position in the SEMA domain of c-Met protein (SEQ ID NO: 79) It may include consecutive 5 to 19 amino acids located within SEQ ID NO: 71 corresponding to the 124th. For example, the epitope may consist of 5 to 19 consecutive amino acids including SEQ ID NO: 73 (EEPSQ) among the amino acid sequence of SEQ ID NO: 71, for example, the amino acid sequence of SEQ ID NO: 71, SEQ ID NO: 72 or SEQ ID NO: 73 It may be a polypeptide having

The epitope having the amino acid sequence of SEQ ID NO: 72 corresponds to the outermost portion of the loop region between the second and third propeller structure domains in the SEMA domain of c-Met protein, and the amino acid sequence of SEQ ID NO: 73 is The epitope having is the site to which the antibody or antigen-binding fragment according to one embodiment most specifically binds.

Accordingly, the anti-c-Met antibody may specifically bind to an epitope comprising 5 to 19 consecutive amino acids including SEQ ID NO: 73 (EEPSQ) among the amino acid sequence of SEQ ID NO: 71, for example, the sequence It may be an antibody or antigen-binding fragment that specifically binds to an epitope having the amino acid sequence of 71, SEQ ID NO: 72, or SEQ ID NO: 73.

According to one embodiment, the anti-c-Met antibody is

CDR-H1 comprising the amino acid sequence of SEQ ID NO: 4, the amino acid sequence of SEQ ID NO: 5, the amino acid sequence of SEQ ID NO: 2, or consecutive 8 to 10 amino acids comprising the amino acid sequence of SEQ ID NO: 2 CDR-H2 comprising an amino acid sequence consisting of 19 amino acids, and a sequence comprising the amino acid sequence of SEQ ID NO: 6, the amino acid sequence of SEQ ID NO: 85, or the first to sixth amino acids in the amino acid sequence of SEQ ID NO: 85 at least one heavy chain complementarity determining region (CDR) selected from the group consisting of CDR-H3 comprising an amino acid sequence consisting of 6 to 13 amino acids, or a heavy chain variable region comprising the at least one heavy chain complementarity determining region;

A CDR-L1 comprising the amino acid sequence of the amino acid sequence of SEQ ID NO: 7, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 8, and the amino acid sequence of SEQ ID NO: 9, the amino acid sequence of SEQ ID NO: 15, the amino acid sequence of SEQ ID NO: 86 , or one or more light chain complementarity determining regions selected from the group consisting of CDR-L3 comprising an amino acid sequence consisting of 9 to 17 amino acids comprising the first to ninth amino acids in the amino acid sequence of SEQ ID NO: 89, or one of the above a light chain variable region comprising at least one light chain complementarity determining region;

a combination of said at least one heavy chain complementarity determining region and said at least one light chain complementarity determining region; or

Combination of the heavy chain variable region and the light chain variable region

including,

SEQ ID NO: 4 to SEQ ID NO: 9 may be an antibody or antigen-binding fragment having an amino acid sequence represented by the following general formulas I to VI, respectively:

general formula I

Xaa ₁ -Xaa ₂ -Tyr-Tyr-Met-Ser (SEQ ID NO: 4),

general formula II

Arg-Asn-Xaa ₃ -Xaa ₄ -Asn-Gly-Xaa ₅ -Thr (SEQ ID NO: 5),

general formula III

Asp-Asn-Trp-Leu-Xaa ₆ -Tyr (SEQ ID NO: 6),

general formula IV

Lys-Ser-Ser-Xaa ₇ -Ser-Leu-Leu-Ala-Xaa ₈ -Gly-Asn-Xaa ₉ -Xaa ₁₀ -Asn-Tyr-Leu-Ala (SEQ ID NO: 7)

general formula V

Trp-Xaa ₁₁ -Ser-Xaa ₁₂ -Arg-Val-Xaa ₁₃ (SEQ ID NO: 8)

general formula VI

Xaa ₁₄ -Gln-Ser-Tyr-Ser-Xaa ₁₅ -Pro-Xaa ₁₆ -Thr (SEQ ID NO: 9)

In the general formula I, Xaa ₁ is absent or is Pro or Ser, Xaa ₂ is Glu or Asp,

In Formula II, Xaa ₃ is Asn or Lys, Xaa ₄ is Ala or Val, Xaa ₅ is Asn or Thr,

In the general formula III, Xaa ₆ is Ser or Thr,

In formula IV, Xaa ₇ is His, Arg, Gln or Lys, Xaa ₈ is Ser or Trp, Xaa ₉ is His or Gln, Xaa ₁₀ is Lys or Asn,

In the above general formula V, Xaa ₁₁ is Ala or Gly, Xaa ₁₂ is Thr or Lys, Xaa ₁₃ is Ser or Pro,

In Formula VI, Xaa ₁₄ is Gly, Ala or Gin, Xaa ₁₅ is Arg, His, Ser, Ala, Gly or Lys, and Xaa ₁₆ is Leu, Tyr, Phe or Met.

In one embodiment, the CDR-H1 may include an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24. The CDR-H2 may include an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 25, and SEQ ID NO: 26. The CDR-H3 may include an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 27, SEQ ID NO: 28, and SEQ ID NO: 85.

The CDR-L1 may include an amino acid sequence selected from the group consisting of SEQ ID NO: 10, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 106. The CDR-L2 may include an amino acid sequence selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 34, SEQ ID NO: 35, and SEQ ID NO: 36. The CDR-L3 may include an amino acid sequence selected from the group consisting of SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 37, SEQ ID NO: 86, and SEQ ID NO: 89 .

In one embodiment, the antibody or antigen-binding fragment comprises a polypeptide (CDR-H1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 22, SEQ ID NO: 23 and SEQ ID NO: 24, SEQ ID NO: 2, sequence A polypeptide (CDR-H2) comprising an amino acid sequence selected from the group consisting of number 25, and SEQ ID NO: 26, and an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 27, SEQ ID NO: 28, and SEQ ID NO: 85 a heavy chain variable region comprising a polypeptide comprising (CDR-H3); and a polypeptide (CDR-L1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 10, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 106, SEQ ID NO: 11, A polypeptide (CDR-L2) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 34, SEQ ID NO: 35, and SEQ ID NO: 36, and SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16 , may include a light chain variable region comprising a polypeptide (CDR-L3) comprising an amino acid sequence selected from the group consisting of , SEQ ID NO: 37, SEQ ID NO: 86, and SEQ ID NO: 89.

An animal-derived antibody produced by immunizing an animal to be immunized with a desired antigen may cause an immune rejection reaction when administered to a human for therapeutic purposes. A chimeric antibody is one obtained by substituting a constant region of an animal-derived antibody that causes an anti-isotype reaction with that of a human antibody using a genetic engineering method. Chimeric antibodies have significantly improved anti-isotype response compared to animal-derived antibodies, but still have animal-derived amino acids in the variable region, potentially resulting in anti-idiotypic side effects. are doing A humanized antibody was developed to improve these side effects. This is produced by grafting complementarity determining regions (CDRs), which play an important role in antigen binding, into a human antibody framework among the variable regions of a chimeric antibody.

The most important thing in the CDR grafting technology for producing a humanized antibody is to select an optimized human antibody that can best accept the CDR region of an animal-derived antibody. structure analysis, molecular modeling technology, etc. are used. However, even when the CDR regions of an animal-derived antibody are transplanted into the optimized human antibody framework, there are cases in which amino acids that affect antigen binding are present while being located in the framework of the animal-derived antibody, so that antigen-binding ability is not preserved in many cases. Therefore, it can be said that the application of additional antibody engineering technology to restore antigen binding force is essential.

A complete antibody has a structure having two full-length light chains and two full-length heavy chains, and each light chain is linked to a heavy chain by a disulfide bond. The constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region has gamma (γ), mu (μ), alpha (α), delta (δ) and epsilon (ε) types, subclasses gamma 1 (γ1), gamma 2 (γ2), gamma 3 (γ3), gamma 4 (γ4), alpha 1 (α1) or alpha 2 (α2). The constant region of the light chain has the kappa (κ) or lambda (λ) type.

The term "heavy chain" refers to a variable region domain V _H comprising an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen and three constant region domains C _H1 , C _H2 and C _H3 and a hinge ( hinge) is interpreted as meaning including all the full-length heavy chains and fragments thereof. In addition, the term "light chain" refers to both a full-length light chain comprising a variable region domain _VL and a constant region domain _CL comprising an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen, and fragments thereof. interpreted as including

The term “complementarity determining region (CDR)” refers to amino acid sequences of hypervariable regions of heavy and light chains of immunoglobulin. The heavy and light chains may each comprise three CDRs (CDRH1, CDRH2, CDRH3 and CDRL1, CDRL2, CDRL3). The CDRs may provide key contact residues for the binding of an antibody to an antigen or epitope. Meanwhile, in the present specification, the terms "specifically binding" or "specifically recognized" have the same meaning as commonly known to those skilled in the art, and the antigen and the antibody specifically interact to produce an immunological reaction. means that

The term “hinge region” refers to a region included in the heavy chain of an antibody, which exists between the CH1 and CH2 regions, and functions to provide flexibility of the antigen-binding site in the antibody.

When the animal-derived antibody undergoes chimerization, the animal-derived IgG1 hinge is replaced with a human IgG1 hinge, but the animal-derived IgG1 hinge has a shorter length than that of the human IgG1 hinge, and a disulfide bond between the two heavy chains ( disulfide bond) is reduced from 3 to 2, so that the rigidity of the hinge has different effects. Thus, modification of the hinge region can increase the antigen binding efficiency of humanized antibodies. Methods for deletion, addition or substitution of amino acids for modifying the amino acid sequence of the hinge region are well known to those skilled in the art.

Accordingly, in one embodiment of the present invention, in order to enhance antigen-binding efficiency, the anti-c-Met antibody or antigen-binding fragment includes a hinge region in which one or more amino acids are deleted, added, or substituted and the amino acid sequence is modified. can For example, the antibody may include a hinge region having the amino acid sequence of SEQ ID NO: 100, SEQ ID NO: 101, SEQ ID NO: 102, SEQ ID NO: 103, SEQ ID NO: 104, or SEQ ID NO: 105. More specifically, the hinge region may have the amino acid sequence of SEQ ID NO: 100 or SEQ ID NO: 101.

According to one embodiment, the anti-c-Met antibody or antigen-binding fragment comprises the amino acid sequence of SEQ ID NO: 17, SEQ ID NO: 74, SEQ ID NO: 87, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93 or SEQ ID NO: 94 The heavy chain variable region comprising a; SEQ ID NO: 162, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 75, SEQ ID NO: 88, SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, SEQ ID NO: 98, SEQ ID NO: 99 or SEQ ID NO: The light chain variable region comprising the amino acid sequence of 107, or a combination of the heavy chain variable region and the light chain variable region may be included.

In one embodiment, the anti-c-Met antibody may be a monoclonal antibody that specifically binds to the extracellular region of the c-Met protein, which is produced in hybridoma cells with accession number KCLRF-BP-00220. Yes (refer to Korean Patent Publication No. 2011-0047698; this document is incorporated herein by reference).

The anti-c-Met antibody may include all of the antibodies defined in Korean Patent Publication No. 2011-0047698.

All subtypes of immunoglobulins (eg, IgA, IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), IgM, etc.), for example, a light chain constant region and a heavy chain constant region of the subtype immunoglobulin.

According to one embodiment, the anti-c-Met antibody is

The amino acid sequence of SEQ ID NO: 62 (the amino acid sequence of the 1st to the 17th is a signal peptide), the amino acid sequence of the 18th to the 462th of SEQ ID NO: 62, the amino acid sequence of SEQ ID NO: 64 (from the 1st The amino acid sequence up to the 17th is a signal peptide) or the amino acid sequence from the 18th to the 461st of SEQ ID NO: 64, the amino acid sequence of SEQ ID NO: 66 (the amino acid sequence from the 1st to the 17th is a signal peptide), And a heavy chain comprising an amino acid sequence selected from the group consisting of the amino acid sequence from the 18th to the 460th of SEQ ID NO: 66; and

The amino acid sequence of SEQ ID NO: 68 (the amino acid sequence from the 1st to the 20th is a signal peptide), the amino acid sequence from the 21st to the 240th of SEQ ID NO: 68, the amino acid sequence of SEQ ID NO: 70 (from the 1st The 20th amino acid sequence is a signal peptide), a light chain comprising an amino acid sequence selected from the group consisting of the 21st to 240th amino acid sequence of SEQ ID NO: 70, and the amino acid sequence of SEQ ID NO: 108

may include.

For example, the anti-c-Met antibody is

A heavy chain comprising the amino acid sequence of SEQ ID NO: 62 or the amino acid sequence from the 18th to the 462th of SEQ ID NO: 62 and a light chain comprising the amino acid sequence of SEQ ID NO: 68 or the amino acid sequence from the 21st to the 240th of SEQ ID NO: 68 antibodies comprising;

A heavy chain comprising the amino acid sequence of SEQ ID NO: 64 or the amino acid sequence from the 18th to the 461st of SEQ ID NO: 64 and the light chain comprising the amino acid sequence of SEQ ID NO: 68 or the amino acid sequence from the 21st to the 240th of SEQ ID NO: 68 antibodies comprising;

A heavy chain comprising the amino acid sequence of SEQ ID NO: 66 or the amino acid sequence from the 18th to the 460th of SEQ ID NO: 66 and the light chain comprising the amino acid sequence of SEQ ID NO: 68 or the amino acid sequence from the 21st to the 240th of SEQ ID NO: 68 antibodies comprising;

A heavy chain comprising the amino acid sequence of SEQ ID NO: 62 or the amino acid sequence from the 18th to the 462th of SEQ ID NO: 62 and the light chain comprising the amino acid sequence of SEQ ID NO: 70 or the amino acid sequence from the 21st to the 240th of SEQ ID NO: 70 antibodies comprising;

A heavy chain comprising the amino acid sequence of SEQ ID NO: 64 or the amino acid sequence from the 18th to the 461th of SEQ ID NO: 64 and the light chain comprising the amino acid sequence of SEQ ID NO: 70 or the amino acid sequence from the 21st to the 240th of SEQ ID NO: 70 antibodies comprising; or

A heavy chain comprising the amino acid sequence of SEQ ID NO: 66 or the amino acid sequence from the 18th to the 460th of SEQ ID NO: 66 and a light chain comprising the amino acid sequence of the amino acid sequence from the 21st to the 240th of SEQ ID NO: 70 or SEQ ID NO: 70 antibody comprising

an antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 62 or the amino acid sequence of positions 18 to 462 of SEQ ID NO: 62 and a light chain comprising the amino acid sequence of SEQ ID NO: 108;

an antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 64 or the amino acid sequence of positions 18 to 461 of SEQ ID NO: 64 and a light chain comprising the amino acid sequence of SEQ ID NO: 108; and

An antibody comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 66 or the amino acid sequence of positions 18 to 460 of SEQ ID NO: 66 and a light chain comprising the amino acid sequence of SEQ ID NO: 108

It may be selected from the group consisting of.

On the other hand, the polypeptide having the amino acid sequence of SEQ ID NO: 70 is a light chain consisting of a human kappa constant region, and the polypeptide having the amino acid sequence of SEQ ID NO: 68 is number 36 in the polypeptide having the amino acid sequence of SEQ ID NO: 70 (kabat numbering). Accordingly, the 62nd amino acid position in SEQ ID NO: 68) is a polypeptide in which histidine is substituted with tyrosine. Due to the substitution, the production of the antibody according to one embodiment may be increased. In addition, the polypeptide having the amino acid sequence of SEQ ID NO: 108 is at position 27e by kabat numbering in the polypeptide having the amino acid sequence from the 21st to the 240th except for the signal peptide from the 1st to the 20th among the amino acid sequence of SEQ ID NO: 68 (According to kabat numbering, position 32 in SEQ ID NO: 108; inside CDR-L1) is substituted with tryptophan (Trp) for serine (Ser), due to the substitution, the activity of the antibody according to one embodiment (eg, Binding affinity to c-Met, c-Met degradation activity, Akt phosphorylation inhibitory activity, etc.) may be further enhanced.

According to one embodiment, the antibody (anti-HER2 antibody, anti-c-Met antibody, and anti-c-Met/anti-HER2 bispecific antibody) may be a mouse-derived antibody, a mouse-human chimeric antibody, a humanized antibody, or a human antibody. have. The antibody may be produced by recombinant or artificial synthesis. The antibody may be a monoclonal antibody.

The anti-c-Met/anti-HER2 bispecific antibody inhibits c-Met and HER2 activity and degrades c-Met and HER2 by the cell internalization and degradation activity of the anti-c-Met antibody. By reducing the total amount, more radical blocking is possible. Therefore, the anti-c-Met/anti-HER2 bispecific antibody can obtain an effective effect even when applied to a patient who develops resistance to a conventional HER2 target therapeutic agent, for example, an anti-HER2 antibody.

Another example provides a pharmaceutical composition for preventing and/or treating cancer, comprising the anti-c-Met/anti-HER2 bispecific antibody or antigen-binding fragment thereof. Another example provides a pharmaceutical composition for preventing and/or treating cancer comprising an anti-c-Met/anti-HER2 bispecific antibody as an active ingredient.

Another example provides a method for preventing and/or treating cancer, comprising administering to a patient in need thereof a pharmaceutically effective amount of the anti-HER2 bispecific antibody or antigen-binding fragment thereof. Another example provides a method for preventing and/or treating cancer, comprising administering to a patient in need thereof a pharmaceutically effective amount of the anti-c-Met/anti-HER2 bispecific antibody. . The method for preventing and/or treating cancer may further include identifying a patient in need of prevention and/or treatment of cancer prior to the administering.

The cancer may be a cancer associated with overexpression and/or abnormal activation of c-Met and/or HER2. The cancer may be a solid cancer or a blood cancer, such as, but not limited to, squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell carcinoma of the lung, peritoneal cancer, skin cancer, skin or intraocular melanoma; Rectal cancer, perianal cancer, esophageal cancer, small intestine cancer, endocrine adenocarcinoma, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, chronic or acute leukemia, lymphocytic lymphoma, hepatocellular carcinoma, gastrointestinal cancer, gastric cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer It may be one or more selected from the group consisting of cancer, liver cancer, bladder cancer, breast cancer, colon cancer, colorectal cancer, endometrial or uterine cancer, salivary gland cancer, kidney cancer, prostate cancer, vulvar cancer, thyroid cancer, head and neck cancer, brain cancer, osteosarcoma, etc. In particular , The cancer may be a cancer that has developed resistance to an existing anticancer agent, such as an antagonist to HER2 (eg, an anti-HER2 antibody) and/or an anti-c-Met antagonist (eg, an anti-c-Met antibody). The cancer includes not only primary cancer but also metastatic cancer.

The anti-c-Met/anti-HER2 bispecific antibody simultaneously recognizes c-Met and HER2, which share all carcinogenic mechanisms such as cancer cell proliferation, cancer cell migration, cancer cell infiltration, angiogenesis, cancer metastasis, and apoptosis inhibition. It can exert an excellent anticancer effect. The anticancer effect includes not only inhibition of cancer cell proliferation, but also an inhibitory effect on cancer metastasis and/or cancer invasion.

In the pharmaceutical composition or method, the pharmaceutically effective amount of the anti-HER2 antibody or antigen-binding fragment thereof or the anti-c-Met/anti-HER2 bispecific antibody comprises a pharmaceutically acceptable carrier, diluent, and excipient. It may be provided together with one or more additives selected from the group.

The pharmaceutically acceptable carrier, as commonly used in the formulation of antibodies, lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline It may be at least one selected from the group consisting of cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, mineral oil, etc., but It is not limited. In addition to the above components, the pharmaceutical composition includes at least one selected from the group consisting of diluents, excipients, lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc. commonly used in preparing pharmaceutical compositions. can do.

The pharmaceutical composition, the anti-HER2 antibody or antigen-binding fragment thereof, or the anti-c-Met/anti-HER2 bispecific antibody may be administered orally or parenterally. In the case of parenteral administration, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, rectal administration, etc. can be administered. When administered orally, the protein or peptide is digestible and therefore oral compositions should be formulated to coat the active agent or to protect it from degradation in the stomach. In addition, the composition may be administered by any device capable of transporting the active agent to a target cell.

An appropriate dosage of the pharmaceutical composition, the anti-HER2 antibody or antigen-binding fragment thereof, or the anti-c-Met/anti-HER2 bispecific antibody may vary depending on the formulation method, administration mode, age, weight, sex, pathology, food, etc. of the patient. , administration time, administration route, excretion rate, and can be variously prescribed depending on factors such as response sensitivity. For example, the daily dose of the pharmaceutical composition, the anti-HER2 antibody or antigen-binding fragment thereof, or the anti-c-Met/anti-HER2 bispecific antibody is 0.001 to 1000 mg/kg, specifically 0.01 to 100 mg/kg , more specifically, may be in the range of 0.1 to 50 mg/kg, but is not limited thereto. The daily dosage may be formulated as one preparation in a unit dosage form, formulated in an appropriate amount, or prepared by internalizing in a multi-dose container. The term “pharmaceutically effective amount” means that the active ingredient (ie, the anti-HER2 antibody or antigen-binding fragment thereof, or the anti-c-Met/anti-HER2 bispecific antibody) has a desired effect, that is, preventing and/or treating cancer. It means an amount capable of showing an effect, and may be prescribed in various ways depending on factors such as formulation method, administration method, patient's age, weight, sex, pathological condition, food, administration time, administration route, excretion rate, and reaction sensitivity. can

The pharmaceutical composition may be prepared in a unit dose form by formulating using a pharmaceutically acceptable carrier and/or excipient according to a method readily practiced by those skilled in the art, or may be prepared by internalizing in a multi-dose container. . In this case, the formulation may be in the form of a solution, suspension, syrup, or emulsion in oil or an aqueous medium, or may be in the form of an extract, powder, powder, granule, tablet or capsule, and may additionally include a dispersant or stabilizer.

In addition, the pharmaceutical composition may be administered as an individual therapeutic agent or may be administered in combination with other therapeutic agents, and may be administered sequentially or simultaneously with a conventional therapeutic agent.

Meanwhile, since the pharmaceutical composition includes an antibody or antigen-binding fragment, it may be formulated as an immune liposome. Liposomes containing antibodies can be prepared according to methods well known in the art. The immune liposome is a lipid composition comprising phosphatidylcholine, cholesterol and polyethylene glycol-derivatized phosphatidylethanolamine, and may be prepared by reverse phase evaporation. For example, a Fab' fragment of an antibody can be conjugated to a liposome via a disulfide-replacement reaction. A chemotherapeutic agent such as doxorubicin may further be incorporated into the liposome.

The subject of the pharmaceutical composition or the subject of the prophylaxis and/or treatment method may be a mammal, such as a human or a primate such as a monkey, or a rodent such as a rat or mouse, but is not limited thereto, and a conventional anticancer agent; For example, it may be a cancer patient who has developed resistance to the antagonist of the target cell membrane protein (eg, HER2).

Another example of the present invention provides a polynucleotide encoding a polypeptide comprising one or a combination of two or more selected from the group consisting of SEQ ID NO: 109 to SEQ ID NO: 131 as described above. In one embodiment, the polynucleotide is a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 132 to SEQ ID NO: 136, a polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 137 to SEQ ID NO: 141, or It may be to encrypt a combination of these. In one example, the polynucleotide may include a nucleotide sequence selected from the group consisting of SEQ ID NO: 142 to SEQ ID NO: 151. Another example provides a recombinant vector comprising the polynucleotide. Another example provides a recombinant cell transformed with the recombinant vector.

The term “vector” refers to a means for expressing a gene of interest in a host cell. Viral vectors such as, for example, plasmid vectors, cosmid vectors and bacteriophage vectors, adenoviral vectors, retroviral vectors and adeno-associated viral vectors are included. Vectors that can be used as the recombinant vector include plasmids often used in the art (eg, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14. , pGEX series, pET series, and pUC19, etc.), phage (eg, λgt4λB, λ-Charon, λΔz1 and M13, etc.) or virus (eg, SV40, etc.), but is not limited thereto.

In the recombinant vector, the polynucleotide may be operably linked to a promoter. The term “operatively linked” refers to a functional linkage between a nucleotide expression control sequence (eg, a promoter sequence) and another nucleotide sequence. Such regulatory sequences may be "operatively linked" to control the transcription and/or translation of other nucleotide sequences.

The recombinant vector can typically be constructed as a vector for cloning or a vector for expression. The expression vector may be a conventional vector used to express a foreign protein in plants, animals or microorganisms in the art. The recombinant vector can be constructed through various methods known in the art.

The recombinant vector can be constructed using a prokaryotic cell or a eukaryotic cell as a host. For example, when the vector used is an expression vector and a prokaryotic cell is used as a host, a strong promoter capable of propagating transcription (eg, pL ^λ promoter, CMV promoter, trp promoter, lac promoter, tac promoter, T7 promoter, etc.), a ribosome binding site for initiation of translation, and a transcription/translation termination sequence. In the case of a eukaryotic cell as a host, the replication origin operating in the eukaryotic cell contained in the vector includes the f1 origin of replication, the SV40 origin of replication, the pMB1 origin of replication, the adeno origin of replication, the AAV origin of replication and the BBV origin of replication. It is not limited. In addition, a promoter derived from the genome of a mammalian cell (eg, a metallotionine promoter) or a promoter derived from a mammalian virus (eg, adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, tk of the cytomegalovirus promoter and HSV promoter) can be used, and generally has a polyadenylation sequence as a transcription termination sequence.

The recombinant cell may be obtained by introducing the recombinant vector into an appropriate host cell. As the host cell, any host cell known in the art may be used as a cell capable of stably and continuously cloning or expressing the recombinant vector, and as a prokaryotic cell, for example, E. coli JM109, E. coli Bacillus sp. strains such as BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, Bacillus subtilis, Bacillus thuringiensis, and Salmonella typhimurium, Sera There are Enterobacteriaceae and strains such as Tia marcescens and various Pseudomonas species, and in the case of transformation into eukaryotic cells, as a host cell, yeast ( Saccharomyces cerevisiae ), insect cells, plant cells and animal cells such as Sp2/0, Chinese hamster ovary (CHO) K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3 , RIN, MDCK cell lines, etc. may be used, but is not limited thereto.

Transport (introduction) of the polynucleotide or a recombinant vector containing the same into a host cell, a transport method well known in the art may be used. The transport method, for example, when the host cell is a prokaryotic cell, CaCl ₂ method or electroporation method, etc. can be used, and when the host cell is a eukaryotic cell, microinjection method, calcium phosphate precipitation method, electroporation method, Liposome-mediated transfection and gene bombardment may be used, but are not limited thereto.

The method of selecting the transformed host cell can be easily carried out according to a method well known in the art using the phenotype expressed by the selection marker. For example, when the selection marker is a specific antibiotic resistance gene, the transformant can be easily selected by culturing the transformant in a medium containing the antibiotic.

Herceptin, a representative targeted therapy that recognizes only HER2, a representative target that is frequently expressed in cancer cells, induces cMet overexpression and activation, thereby causing cancer cells to acquire resistance to the drug, thereby reducing the therapeutic effect. The present inventors have found that a dual antibody that recognizes cMet and HER2 simultaneously inhibits overexpression and/or activation of cMet, which is the cause of drug resistance, thereby blocking signal transduction in advance, thereby preventing the development of resistance, and preventing the development of resistance even in cancer cells that have developed resistance It was confirmed that it showed an excellent inhibitory effect on cancer cells. The anti-cMet/anti-HER2 dual antibody of the present invention simultaneously recognizes cMet and HER2, which share all carcinogenic mechanisms such as cancer cell proliferation, cancer cell migration, cancer cell invasion, angiogenesis, cancer metastasis, and inhibition of apoptosis, It is expected that it will be able to outperform the effect of the drug on the target and at the same time show the effect on carcinomas where existing drugs have not been effective.

1 is a schematic diagram showing the structure of an anti-c-Met/anti-HER2 bispecific antibody according to an embodiment.
FIG. 2 is a graph showing the degree of cancer cell (MKN45 gastric cancer cell line) proliferation when treated with anti-c-Met/anti-HER2 bispecific antibody according to an embodiment as a relative value compared to a control group (Medium; non-antibody-treated group).
3 shows a fluorescence microscope image of MKN45 gastric cancer cells, and shows whether c-Met and HER2 were internalized and co-localized with anti-c-Met/anti-HER2 bispecific antibody treatment. .

Hereinafter, the following examples will be described in more detail through the present invention. However, these examples are for illustrative purposes only, and the scope of the invention is not limited to these examples.

Reference example 1: term c- Met production of antibodies

1.1. c- Met mouse antibodies against' AbF46' production of

1.1.1. Immunization of mice

To obtain immunized mice necessary for the development of hybridoma cell lines, 100 μg of human c-Met/Fc fusion protein (R&D Systems) and complete Freund's adjuvant were administered to 5 mice each. was mixed and injected intraperitoneally into 4-6 week old BALB/c mice (Japan SLC, Inc.). Two weeks later, in the same manner as above, 50 μg, which is half of the previously injected amount of the human c-Met/Fc fusion protein used as the antigen, was mixed with the same amount of incomplete Freund's adjuvant, and the mouse was Injected intraperitoneally. After one week, the last boosting (boosting) was performed, and 3 days later, blood was collected from the tail of the mouse to obtain serum, and diluted 1/1000 in PBS to confirm that the titer of the c-Met-recognizing antibody was increased by ELISA. As a result of the above, mice having a sufficient amount of antibody were selected, and the following cell fusion process was performed.

1.1.2. cell fusion and of hybridoma Produce

3 days before the cell fusion experiment, a human c-Met/Fc fusion protein mixture in 50 μg PBS was injected intraperitoneally into BALB/c mice (Japan SLC, Inc.), and the immunized mice were anesthetized and then placed on the left side of the torso. The located spleen was excised. Cells were separated by grinding the extracted spleen with a mesh, and mixed with a culture medium (DMEM, GIBCO, Invitrogen) to make a spleen cell suspension. The suspension was centrifuged to recover the cell layer. The obtained splenocytes 1 x 10 ⁸ and myeloma cells (Sp2/0) 1 x 10 ⁸ were mixed, and then centrifuged to precipitate the cells. The centrifuged precipitate is slowly dispersed, treated with 45% polyethylene glycol (PEG) (1 ml) in a culture medium (DMEM), maintained at 37 ° C. for 1 minute, and culture medium (DMEM) 1 ml was added. Then, 10 ml of a culture medium (DMEM) was added for 1 minute, and the mixture was left in water at 37° C. for 5 minutes, adjusted to 50 ml, and centrifuged again. The cell precipitate was resuspended in a separation medium (HAT medium) to about 1 to 2x10 ⁵ /ml, and 0.1 ml each was dispensed to a 96-well plate, and then cultured in a carbon dioxide incubator at 37° C. to prepare a hybridoma cell group.

1.1.3. c- Met producing monoclonal antibodies to proteins hybridoma selection of cells

In order to select hybridoma cells that react specifically only to c-Met protein from the hybridoma cell group prepared in Reference Example 1.1.2, human c-Met/Fc fusion protein and human Fc protein were used as antigens. Screened by ELISA analysis method.

To a microtiter plate, 50 μl (2 ug/ml) of human c-Met/Fc fusion protein was added to each well and adhered to the plate surface, and unreacted antigens were removed by washing. Human Fc protein was attached to the plate surface in the same manner as above in order to select and exclude an antibody that binds to Fc rather than c-Met.

After adding 50 μl of the hybridoma cell culture solution obtained in Reference Example 1.1.2 to each well prepared above and reacting for 1 hour, wash thoroughly with phosphate buffer-Tween 20 (TBST) solution to remove unreacted culture solution. did To this, goat anti-mouse IgG-horseradish peroxidase (goat anti-mouse IgG-HRP) was added and reacted for 1 hour at room temperature, and then washed thoroughly with TBST solution. Then, a substrate solution (OPD) of peroxidase was added to react, and the degree of the reaction was confirmed by measuring the absorbance at 450 nm with an ELISA reader.

By confirming the reaction level as described above, hybridoma cell lines secreting an antibody having high binding affinity specifically for human c-Met protein without binding to human Fc were repeatedly selected. The hybridoma cell line obtained through repeated selection was subjected to limiting dilution to finally obtain one clone of the hybridoma cell line producing a monoclonal antibody. The final selected monoclonal antibody-producing hybridomas were deposited with the Korea Cell Line Research Foundation located in Yeongeon-dong, Jongno-gu, Seoul, Korea, an international depository under the Budapest Treaty as of October 6, 2009, and were given accession number KCLRF-BP-00220 (Korea). See Patent Publication No. 2011-0047698).

1.1.4. Production and purification of monoclonal antibodies

The hybridoma cells obtained in Reference Example 1.1.3 were cultured in a serum-free medium, and monoclonal antibodies were produced and purified from the culture medium.

First, the hybridoma cells cultured in 50 ml of a culture medium (DMEM) medium containing 10% (v/v) FBS were centrifuged, and the cell precipitate was washed twice or more with 20 ml PBS to remove FBS. , The cell precipitate was resuspended in 50 ml of a culture medium (DMEM) medium, and then cultured in a carbon dioxide incubator at 37° C. for 3 days.

Thereafter, by centrifugation, the antibody-producing cells were removed, and the culture medium in which the antibodies were secreted was separated, and stored at 4° C. or immediately collected and used for separation and purification of the antibody. After pure purification of the antibody from 50 ml to 300 ml of the prepared culture solution using an AKTA purification device (GE Healthcare) equipped with an affinity column (Protein G agarose column; Pharmacia, USA), a filter for protein aggregation (Amicon) was applied. The purified antibody was stored by replacing the supernatant with PBS, and used in subsequent Examples.

1.2. c- Met for chimeric antibody chAbF46 production of

In general, mouse antibodies are highly likely to exhibit immunogenicity when injected into humans for therapeutic purposes. A chimeric antibody chAbF46 was constructed in which the constant region excluding the variable region) was substituted with the sequence of a human IgG1 antibody.

The nucleotide sequence corresponding to the heavy chain is 'EcoRI-signal sequence-VH-NheI-CH-TGA-XhoI' (SEQ ID NO: 38), and the nucleotide sequence corresponding to the light chain is 'EcoRI-signal sequence-VL-BsiWI-CL-TGA -XhoI' (SEQ ID NO: 39) was designed so that each gene was synthesized. Then, a DNA fragment (SEQ ID NO: 38) having a nucleotide sequence corresponding to the heavy chain in the pOptiVEC ^TM -TOPO TA Cloning Kit included in Invitrogen's OptiCHO ^TM Antibody Express Kit (Cat no. 12762-019), pcDNA ^TM 3.3 -TOPO By cloning a DNA fragment (SEQ ID NO: 39) having a nucleotide sequence corresponding to the light chain in the TA Cloning Kit (Cat no. 8300-01) using EcoRI (NEB, R0101S) and XhoI (NEB, R0146S) restriction enzymes, respectively , a vector containing a heavy chain and a vector containing a light chain for expression of the chimeric antibody were constructed, respectively.

Each of the constructed vectors was amplified using the Qiagen Maxiprep kit (Cat no. 12662), and the transient expression was performed by Freestyle ^TM MAX 293 Expression System (invitrogen) was used. The cell line used is 293 F cell, FreeStyle ^TM 293 Expression Medium was used as a medium and cultured in a suspension culture method. One day before the transient expression, cells were prepared at a concentration of 5x10 ⁵ cells/ml, and after 24 hours, when the number of cells reached 1x10 ⁶ cells/ml, temporary expression was performed. Transfection was carried out using the liposomal reagent method using Freestyle ^TM MAX reagent (invitrogen). In a 15ml tube, prepare DNA in a ratio of heavy chain DNA: light chain DNA = 1:1, mix with 2ml of OptiPro ^TM SFM (invtrogen) and (A), in another 15ml tube, 100 μl of Freestyle ^TM MAX reagent and OptiPro ^TM After mixing (B) 2ml of SFM, (A) and (B) were mixed and incubated for 15 minutes, and the mixture was slowly mixed with the cells prepared the day before. After completion of transduction, incubation was carried out at 37 °C, 80% humidity, 8% CO _{2 ,} 130 rpm incubator for 5 days.

The cultured cells were centrifuged to take 100 ml of each supernatant, and purified using AKTA Prime (GE healthcare). A Protein A column (GE healthcare, 17-0405-03) was installed on AKTA Prime, and the culture medium was flowed at a flow rate of 5 ml/min, and eluted with an IgG elution buffer (Thermo Scientific, 21004). The resulting eluate was exchanged with PBS buffer to finally purify the chimeric antibody AbF46 (hereinafter referred to as chAbF46).

1.3. chimeric antibody chAbF46 Humanized Antibodies from huAbF46 production of

1.3.1. heavy chain humanization ( Heavy chain humanization )

For the design of two types of H1-heavy and H3-heavy, first, the VH gene of the mouse antibody AbF46 purified in Reference Example 1.2 through Ig Blast (http://www.ncbi.nlm.nih.gov/igblast/) and the human germline gene with the highest homology was analyzed. As a result, it was confirmed that VH3-71 had 83% homology at the amino acid level, and the CDR-H1, CDR-H2, and CDR-H3 of the mouse antibody AbF46 were defined by Kabat numbering, and the CDR portion of the mouse antibody AbF46 was It was designed to be introduced into the framework of VH3-71. At this time, amino acids No. 30 (S→T), No. 48 (V→L), No. 73 (D→N), and No. 78 (T→L) were back-mutated to the amino acid sequence of the original mouse AbF46 antibody. Thereafter, H1 was further mutated to amino acids 83 times (R→K) and 84 times (A→T) to finally construct H1-heavy (SEQ ID NO: 40) and H3-heavy (SEQ ID NO: 41).

As a result of finding the framework sequence of the human antibody for the design of H4-heavy, the sequence was very similar to the mouse framework sequence of the AbF46 antibody, and at the same time, it was defined by Kabat numbering using the VH3 subtype, which is known to be the most stable. CDR-H1, CDR-H2, and CDR-H3 of the mouse antibody AbF46 were introduced. Through this, H4-heavy (SEQ ID NO: 42) was constructed.

1.3.2. light chain humanization ( Light chain humanization )

For two designs, H1-light (SEQ ID NO: 43) and H2-light (SEQ ID NO: 44), mouse antibody AbF46 via Ig Blast (http://www.ncbi.nlm.nih.gov/igblast/) The human germline gene with the highest homology to the VL gene of As a result, it was confirmed that VK4-1 had 75% homology at the amino acid level, and the CDR-L1, CDR-L2, and CDR-L3 of the mouse antibody AbF46 were defined by Kabat numbering, and the CDR region of the mouse antibody AbF46 was It was designed to be introduced into the skeleton of VK4-1. At this time, H1-light back-mutated three amino acids 36 (Y → H), 46 (L → M), and 49 (Y → I), and H2-light was 49 amino acids (Y → I). Only one was constructed by back-mutation.

For the design of H3-light (SEQ ID NO: 45), a human germline gene most homologous to the VL gene of the mouse antibody AbF46 was generated through Blast (http://www.ncbi.nlm.nih.gov/igblast/). Among the analysis results, VK2-40 was selected in addition to VK4-1. It was confirmed that the mouse antibodies AbF46 VL and VK2-40 had 61% homology at the amino acid level, and the CDR-L1, CDR-L2, and CDR-L3 of the mouse antibody AbF46 were defined by Kabat numbering, and the CDRs of the mouse antibody AbF46 The portion was designed to be introduced into the skeleton of VK4-1. At this time, H3-light was constructed by back-mutation of 3 amino acids 36 times (Y→H), 46 times (L→M), and 49 times (Y→I).

As a result of finding the framework sequence of the human antibody for the design of H4-light (SEQ ID NO: 46), the CDR-L1 of the mouse antibody AbF46 defined by Kabat numbering using the Vk1 subtype known to be the most stable, CDR-L2 and CDR-L3 were introduced. At this time, H4-light was constructed by further back-mutation of 3 amino acids 36 times (Y→H), 46 times (L→M), and 49 times (Y→I).

Then, a DNA fragment (H1-heavy; SEQ ID NO: 47, H3) having a nucleotide sequence corresponding to the heavy chain in the pOptiVEC ^TM -TOPO TA Cloning Kit included in Invitrogen's OptiCHO ^TM Antibody Express Kit (Cat no. 12762-019) -heavy; SEQ ID NO: 48, H4-heavy; SEQ ID NO: 49) to pcDNA ^TM 3.3-TOPO DNA fragments (H1-light; SEQ ID NO: 50, H2-light; SEQ ID NO: 51, H3-light; SEQ ID NO: 52, H4-light; SEQ ID NO: 53) each having a nucleotide sequence corresponding to the light chain in the TA Cloning Kit Using EcoRI (NEB, R0101S) and XhoI (NEB, R0146S) restriction enzymes, a vector for expression of a humanized antibody was constructed by cloning.

Each of the constructed vectors was amplified using the Qiagen Maxiprep kit (Cat no. 12662), and the transient expression was performed by Freestyle ^TM MAX 293 Expression System (invitrogen) was used. The cell line used is 293 F cell, FreeStyle ^TM 293 Expression Medium was used as a medium and cultured in a suspension culture method. One day before the transient expression, cells were prepared at a concentration of 5x10 ⁵ cells/ml, and after 24 hours, when the number of cells reached 1x10 ⁶ cells/ml, temporary expression was performed. Transfection was carried out using the liposomal reagent method using Freestyle ^TM MAX reagent (invitrogen). In a 15ml tube, prepare DNA in a ratio of heavy chain DNA: light chain DNA = 1:1, mix with 2ml of OptiPro ^TM SFM (invtrogen) and (A), in another 15ml tube, 100 μl of Freestyle ^TM MAX reagent and OptiPro ^TM After mixing (B) 2ml of SFM, (A) and (B) were mixed and incubated for 15 minutes, and the mixture was slowly mixed with the cells prepared the day before. After completion of transduction, incubation was carried out at 37°C, 80% humidity, 8% CO _{2 , and} 130 rpm incubator for 5 days.

The cultured cells were centrifuged to take 100 ml of each supernatant, and purified using AKTA Prime (GE healthcare). A Protein A column (GE healthcare, 17-0405-03) was installed on AKTA Prime, and the culture medium was flowed at a flow rate of 5 ml/min, and eluted with an IgG elution buffer (Thermo Scientific, 21004). This was exchanged with PBS buffer to finally purify the humanized antibody AbF46 (hereinafter referred to as huAbF46). On the other hand, the combination of the heavy chain and light chain of the humanized antibody huAbF46 used in the following Examples is H4-heavy (SEQ ID NO: 42) and H4-light (SEQ ID NO: 46).

1.4. huAbF46 antibody scFv library creation

A gene for constructing an scFv of the huAbF46 antibody was designed using the heavy chain variable region and the light chain variable region of the huAbF46 antibody. Each heavy chain variable region and light chain variable region was designed to be in the form of 'VH-linker-VL', and the linker was designed to have an amino acid sequence of 'GLGGLGGGGSGGGGSGGSSGVGS' (SEQ ID NO: 54). The polynucleotide (SEQ ID NO: 55) encoding the scFv of the designed huAbF46 antibody was synthesized by requesting Bioneer, and a vector for expressing it was shown in SEQ ID NO: 56.

Then, expressed from the vector By analyzing the result, it was confirmed that c-Met-specific binding ability was shown.

1.5. affinity maturation ( affinity maturation ) of library genes for

1.5.1. target CDR selection and primer produce

For affinity maturation of the huAbF46 antibody, six complementary determining regions (CDRs) were defined from the prepared mouse antibody AbF46 by 'Kabat numbering', and each CDR is shown in Table 3 below. .

CDR amino acid sequence CDR-H1 DYYMS (SEQ ID NO: 1) CDR-H2 FIRNKANGYTTEYSASVKG (SEQ ID NO: 2) CDR-H3 DNWFAY (SEQ ID NO: 3) CDR-L1 KSSQSLLASGNQNNYLA (SEQ ID NO: 10) CDR-L2 WASTRVS (SEQ ID NO: 11) CDR-L3 QQSYSAPLT (SEQ ID NO: 12)

Primers were prepared as follows to introduce random sequences of antibody CDRs. The conventional random sequence introduction method used the N codon to introduce the same ratio of bases (25% A, 25% G, 25% C, 25% T) to the site to be mutated, but in this example, the huAbF46 antibody To introduce random bases into the CDRs of Among wild-type nucleotides, 85% of the first and second nucleotides were preserved as they were, and the remaining three bases were introduced by 5% each. In addition, the primer was designed so that the third nucleotide was introduced identically (33% G, 33% C, 33% T).

1.5.2. huAbF46 Library construction of antibodies and c- Met check the binding force to

The construction of the antibody library gene through the random sequence introduction of CDRs was performed using the primers prepared in the same manner as in Reference Example 1.5.1. Using a polynucleotide containing the scFv of huAbF46 antibody as a template, two PCR fragments were prepared as in the method shown in FIG. Libraries targeting each of the six CDRs were constructed by securing the scFv library gene of the mutated huAbF46 antibody.

For the library thus prepared, the binding ability of the wild-type and each library to c-Met was confirmed. Each library showed a tendency to have lower binding affinity to c-Met compared to the wild-type, but the binding ability to some c-Met was lower. Retained mutations were identified.

1.6. from the created library. friendliness Selection of improved antibodies

After improving the binding ability of the library to c-Met from the constructed library, the gene sequence of scFv was analyzed from each individual clone. The secured gene sequences are shown in Table 4, respectively, and they were converted into IgG form. Among the clones below, four types of antibodies produced from L3-1, L3-2, L3-3, and L3-5 were selected and subsequent experiments were performed .

clone name derived library CDR sequence H11-4 CDR-H1 PEYYMS (SEQ ID NO: 22) YC151 CDR-H1 PDYYMS (SEQ ID NO:23) YC193 CDR-H1 SDYYMS (SEQ ID NO: 24) YC244 CDR-H2 RNNANGNT (SEQ ID NO: 25) YC321 CDR-H2 RNKVNGYT (SEQ ID NO: 26) YC354 CDR-H3 DNWLSY (SEQ ID NO: 27) YC374 CDR-H3 DNWLTY (SEQ ID NO: 28) L1-1 CDR-L1 KSSHSLLASGNQNNYLA (SEQ ID NO: 29) L1-3 CDR-L1 KSSRSLLSSGNHKNYLA (SEQ ID NO: 30) L1-4 CDR-L1 KSSKSLLASGNQNNYLA (SEQ ID NO: 31) L1-12 CDR-L1 KSSRSLLASGNQNNYLA (SEQ ID NO: 32) L1-22 CDR-L1 KSSHSLLASGNQNNYLA (SEQ ID NO: 33) L2-9 CDR-L2 WASKRVS (SEQ ID NO: 34) L2-12 CDR-L2 WGSTRVS (SEQ ID NO: 35) L2-16 CDR-L2 WGSTRVP (SEQ ID NO: 36) L3-1 CDR-L3 QQSYSRPYT (SEQ ID NO: 13) L3-2 CDR-L3 GQSYSRPLT (SEQ ID NO: 14) L3-3 CDR-L3 AQSYSHPFS (SEQ ID NO: 15) L3-5 CDR-L3 QQSYSRPFT (SEQ ID NO: 16) L3-32 CDR-L3 QQSYSKPFT (SEQ ID NO: 37)

1.7. of the selected antibody IgG conversion to

The polynucleotide encoding the heavy chains of the four selected antibodies is composed of 'EcoRI-signal sequence-VH-NheI-CH-XhoI' (SEQ ID NO: 38), and in the case of heavy chains, the amino acid of the antibody is not changed after affinity maturation. Therefore, the heavy chain of the huAbF46 antibody was used as it was. However, the hinge region was substituted with the U6-HC7 hinge (SEQ ID NO: 57), not the hinge of human IgG1. The light chain was designed to consist of 'EcoRI-signal sequence-VL-BsiWI-CL-XhoI' and genes were synthesized, and a polynucleotide (sequence No. 58 to SEQ ID NO: 61) were synthesized by requesting Bioneer. Then, a DNA fragment (SEQ ID NO: 38) having a nucleotide sequence corresponding to the heavy chain in the pOptiVEC ^TM -TOPO TA Cloning Kit included in Invitrogen's OptiCHO ^TM Antibody Express Kit (Cat no. 12762-019), pcDNA ^TM 3.3 -TOPO A DNA fragment having a nucleotide sequence corresponding to the light chain in the TA Cloning Kit (Cat no. 8300-01) (DNA fragment including CDR-L3 derived from L3-1: SEQ ID NO: 58, CDR-L3 derived from L3-2 included DNA fragment comprising: SEQ ID NO: 59, a DNA fragment comprising CDR-L3 derived from L3-3: DNA fragment comprising SEQ ID NO: 60, CDR-L3 derived from L3-5: SEQ ID NO: 61) to EcoRI (NEB, R0101S), respectively and XhoI (NEB, R0146S) restriction enzymes were used to construct a vector for expression of the antibody matured by cloning.

Each of the constructed vectors was amplified using the Qiagen Maxiprep kit (Cat no. 12662), and the transient expression was performed by Freestyle ^TM MAX 293 Expression System (invitrogen) was used. The cell line used was 293 F cell, and was cultured in a suspension culture method using FreeStyle ^TM 293 Expression Medium as a medium. One day before the transient expression, cells were prepared at a concentration of 5x10 ⁵ cells/ml, and after 24 hours, when the number of cells reached 1x10 ⁶ cells/ml, temporary expression was performed. Transfection was carried out using the liposomal reagent method using Freestyle ^TM MAX reagent (invitrogen). In a 15ml tube, prepare DNA in a ratio of heavy chain DNA: light chain DNA = 1:1, mix with 2ml of OptiPro ^TM SFM (invtrogen) and (A), in another 15ml tube, 100 μl of Freestyle ^TM MAX reagent and OptiPro ^TM After mixing (B) 2ml of SFM, (A) and (B) were mixed and incubated for 15 minutes, and the mixture was slowly mixed with the cells prepared the day before. After completion of transduction, incubation was carried out at 37 °C, 80% humidity, 8% CO _{2 ,} 130 rpm incubator for 5 days.

The cultured cells were centrifuged to take 100 ml of each supernatant, and purified using AKTA Prime (GE healthcare). A Protein A column (GE healthcare, 17-0405-03) was installed on AKTA Prime, and the culture medium was flowed at a flow rate of 5 ml/min, and eluted with an IgG elution buffer (Thermo Scientific, 21004). These were exchanged with PBS buffer and finally affinity matured 4 antibodies (hereinafter, huAbF46-H4-A1 (derived from L3-1), huAbF46-H4-A2 (derived from L3-2), huAbF46-H4-A3 (L3- 3), and named huAbF46-H4-A5 (derived from L3-5)) were purified.

1.8. constant region and/or the hinge area substituted huAbF46 - H4 Preparation of -A1

Among the four antibodies selected in Reference Example 1.7, huAbF46-H4-A1, which had the highest c-Met binding affinity and the lowest degree of Akt phosphorylation and c-Met differentiation, was tested in the hinge region. Alternatively, an antibody in which the constant region and the hinge region are substituted was prepared.

An antibody consisting of a heavy chain consisting of a heavy chain variable region of huAbF46-H4-A1, a U6-HC7 hinge, and a human IgG1 constant region, and a light chain consisting of a light chain variable region of huAbF46-H4-A1 and a human kappa constant region, was prepared using the huAbF46 antibody. as -H4-A1(U6-HC7); An antibody consisting of a heavy chain consisting of a heavy chain variable region of huAbF46-H4-A1, a human IgG2 hinge and a human IgG1 constant region, and a light chain consisting of a light chain variable region of huAbF46-H4-A1 and a human kappa constant region were prepared using huAbF46-H4- with A1 (IgG2 hinge); An antibody consisting of a heavy chain consisting of a heavy chain variable region of huAbF46-H4-A1, a human IgG2 hinge and a human IgG2 constant region, and a light chain consisting of a light chain variable region of huAbF46-H4-A1 and a human kappa constant region was prepared using huAbF46-H4- Each was named A1 (IgG2 Fc). On the other hand, in the three types of antibodies, all of histidine 36 of the light chain consisting of the human kappa constant region was substituted with tyrosine to increase production.

In order to construct the above three types of antibodies, a polynucleotide (SEQ ID NO: 63) encoding a polypeptide (SEQ ID NO: 62) consisting of a heavy chain variable region of huAbF46-H4-A1, a U6-HC7 hinge and a human IgG1 constant region (SEQ ID NO: 63), huAbF46- Polynucleotide (SEQ ID NO: 65) encoding a polypeptide (SEQ ID NO: 64) comprising a heavy chain variable region of H4-A1, a human IgG2 hinge and a human IgG1 constant region, heavy chain variable region of huAbF46-H4-A1, human IgG2 A polynucleotide (SEQ ID NO: 67) encoding a polypeptide (SEQ ID NO: 66) consisting of a hinge and a human IgG2 constant region, a light chain variable region of huAbF46-H4-A1 in which histine 36 is substituted with tyrosine, and a human kappa constant region A polynucleotide (SEQ ID NO: 69) encoding a polypeptide consisting of (SEQ ID NO: 68) was synthesized by requesting Bioneer. Then, a DNA fragment having a nucleotide sequence corresponding to the heavy chain was added to the pOptiVEC ^TM -TOPO TA Cloning Kit included in Invitrogen's OptiCHO ^TM Antibody Express Kit (Cat no. 12762-019), pcDNA ^TM 3.3-TOPO A vector for expression of the antibody was constructed by inserting a DNA fragment having a nucleotide sequence corresponding to the light chain into the TA Cloning Kit (Cat no. 8300-01).

Each of the constructed vectors was amplified using the Qiagen Maxiprep kit (Cat no. 12662), and the transient expression was performed by Freestyle ^TM MAX 293 Expression System (invitrogen) was used. The cell line used is 293 F cell, FreeStyle ^TM 293 Expression Medium was used as a medium and cultured in a suspension culture method. One day before the transient expression, cells were prepared at a concentration of 5x10 ⁵ cells/ml, and after 24 hours, when the number of cells reached 1x10 ⁶ cells/ml, temporary expression was performed. Transfection was carried out using the liposomal reagent method using Freestyle ^TM MAX reagent (invitrogen). In a 15ml tube, prepare DNA in a ratio of heavy chain DNA: light chain DNA = 1:1, mix with 2ml of OptiPro ^TM SFM (invtrogen) and (A), in another 15ml tube, 100 μl of Freestyle ^TM MAX reagent and OptiPro ^TM After mixing (B) 2ml of SFM, (A) and (B) were mixed and incubated for 15 minutes, and the mixture was slowly mixed with the cells prepared the day before. After completion of transduction, incubation was carried out at 37 °C, 80% humidity, 8% CO _{2 ,} 130 rpm incubator for 5 days.

The cultured cells were centrifuged to take 100 ml of each supernatant, and purified using AKTA Prime (GE healthcare). A Protein A column (GE healthcare, 17-0405-03) was installed on AKTA Prime, and the culture medium was flowed at a flow rate of 5 ml/min, and eluted with an IgG elution buffer (Thermo Scientific, 21004). This was exchanged with PBS buffer and finally three types of antibodies (huAbF46-H4-A1 (U6-HC7), huAbF46-H4-A1 (IgG2 hinge), huAbF46-H4-A1 (IgG2 Fc)) were purified. Among them, huAbF46-H4-A1 (U6-HC7) and huAbF46-H4-A1 (IgG2 Fc) were selected to represent the anti-c-Met antibody according to the present invention and used in the following Examples, and for convenience, each of the antibodies They were named anti-c-Met antibody L3-1Y U6-HC7 (huAbF46-H4-A1(U6-HC7)) and anti-c-Met antibody L3-1Y IgG2 (uAbF46-H4-A1(IgG2 Fc)).

Example 1: clause HER2 scFv production of

In order to select an antibody that binds to Her2, human HER2 (GenBank Accession Nos. NP_004439) against a phage display scFv library (A human scFv antibody generation pipeline for proteome research. 2010, J. Biotechnol., 152, pp.159-170) ) was used to perform panning and screening according to the experimental method described in the paper.

As a result, five anti-HER2 scFvs were selected, and they were named 41-B11, 41-C6, 41-E1, 44-C12 and 44-H4, respectively.

The gene sequence of the selected anti-HER2 scFv was amplified using a thermocycler (GeneAmp PCR System 9700, Applied Biosystem). The primer sequences used at this time are summarized in Table 5 below:

Anti-HER2 scFv forward primer Reverse primer 41-B11 GGTTCCGGAGGCGGCGGATCCGAGGTGCAGCTGGTGCAGTC (SEQ ID NO: 152) AGGGATCGAACCCTTCTCGAGTCAACCTAGGACGGTCAACTTGGTC (SEQ ID NO: 153) 41-C6 GGTTCCGGAGGCGGCGGATCCCAGATCCAGCTGGTACAATCTGG (SEQ ID NO: 154) AGGGATCGAACCCTTCTCGAGTCAACCTAGGACGGTCAGCTTGGT (SEQ ID NO: 155) 41-E1 GGTTCCGGAGGCGGCGGATCCGAGGTGCAGCTGGTGGAGTC (SEQ ID NO: 156) AGGGATCGAACCCTTCTCGAGTCAACGTAGGACGGTCAGCTTGGT (SEQ ID NO: 157) 44-C12 GGTTCCGGAGGCGGCGGATCCGAAGTGCAGCTGGTGCAGTCT (SEQ ID NO: 158) AGGGATCGAACCCTTCTCGAGTCAACGTAGGACGGTCAGCTTGGT (SEQ ID NO: 159) 44-H4 GGTTCCGGAGGCGGCGGATCCGAGGTGCAGCTGGTGCAGTC (SEQ ID NO: 160) AGGGATCGAACCCTTCTCGAGTCAACCTAGGACGGTCACCTTGGT (SEQ ID NO: 161)

PCR products obtained from each reaction were washed with QIAquick Multiwell PCR Purification kit (Qiagen) according to the manufacturer's protocol.

After cloning the obtained PCR products, DNA sequencing was performed by the disclosed method. As a result, the CDR sequences of the anti-HER2 antibody shown in Tables 6 and 7 below and the sequences of the variable region of the anti-HER2 antibody shown in Tables 8 and 9 were obtained.

designation CDR-H1 CDR-H2 CDR-H3 41-B11 SYWIG (SEQ ID NO: 109) IIYPGDSDTRYSPSFQG (SEQ ID NO: 112) RHYYDSSGYSYFPDY (SEQ ID NO: 115) 41-C6 SYWIG (SEQ ID NO: 109) IIYPGDSDTRYSPSFQG (SEQ ID NO: 112) RLSVAAAGTGGYNWFDP (SEQ ID NO: 116) 41-E1 DYAMS (SEQ ID NO: 110) FIRSKAYGGTTEYAASVKG (SEQ ID NO: 113) RDLYPAMAEY (SEQ ID NO: 117) 44-C12 SYAIS (SEQ ID NO: 111) GIIPIFGTANYAQKFQG (SEQ ID NO: 114) RDSGYSYGYPMNYYYYYMDV (SEQ ID NO: 118) 44-H4 SYWIG (SEQ ID NO: 109) IIYPGDSDTRYSPSFQG (SEQ ID NO: 112) RLVVGANPPTYYFDY (SEQ ID NO: 119)

designation CDR-L1 CDR-L2 CDR-L3 41-B11 GLSSGSVSTSYYPS (SEQ ID NO: 120) STNTRSSGVPD (SEQ ID NO: 124) VLYMGSGIWV (SEQ ID NO: 127) 41-C6 GLTSGSVSTSYYPS (SEQ ID NO: 121) STNTRSSGVPD (SEQ ID NO: 124) MLYLGGGISV (SEQ ID NO: 128) 41-E1 TRSSGSIDSNFVQ (SEQ ID NO: 122) DDNQRPSGVPD (SEQ ID NO: 125) QSYDSNNQV (SEQ ID NO: 129) 44-C12 GLSSGSVSPTYYPS (SEQ ID NO: 123) RTNIRSSGVPD (SEQ ID NO: 126) LLYMGSGVSL (SEQ ID NO: 130) 44-H4 GLSSGSVSTSYYPS (SEQ ID NO: 120) STNTRSSGVPD (SEQ ID NO: 124) VLYMGSGISL (SEQ ID NO: 131)

designation Amino acid sequence of heavy chain variable region of anti-HER2 antibody Base sequence of heavy chain variable region of anti-HER2 antibody 41-B11 EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARHYYDSSGYSYFPDYWGQGTLVTVSS (SEQ ID NO: 132) GAGGTGCAGCTGGTGCAGTCTGGAGCAGAGGTGAAAAAGCCCGGGGAGTCTCTGAAGATCTCCTGTAAGGGTTCTGGATACAGCTTTACCAGCTACTGGATCGGCTGGGTGCGCCAGATGCCCGGGAAAGGCCTGGAGTGGATGGGGATCATCTATCCTGGTGACTCTGATACCAGATACAGCCCGTCCTTCCAAGGCCAGGTCACCATCTCAGCCGACAAGTCCATCAGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGGACACCGCCATGTATTACTGTGCGAGACATTACTATGATAGTAGTGGTTATTCCTACTTTCCGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA(서열번호 142) 41-C6 QIQLVQSGAEVKKPGESLKISCRGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLSVAAAGTGGYNWFDPWGQGTLVTVSS (SEQ ID NO: 133) CAGATCCAGCTGGTACAATCTGGAGCAGAGGTGAAAAAGCCCGGGGAGTCTCTGAAGATCTCCTGTAGGGGTTCTGGATACAGCTTTACCAGCTACTGGATCGGCTGGGTGCGCCAGATGCCCGGGAAAGGCCTGGAGTGGATGGGGATCATCTATCCTGGTGACTCTGATACCAGATACAGCCCGTCCTTCCAAGGCCAGGTCACCATCTCAGCCGACAAGTCCATCAGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGGACACCGCCATGTATTACTGTGCGAGACTCAGCGTAGCAGCAGCTGGTACGGGGGGGTACAACTGGTTCGACCCCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA(서열번호 143) 41-E1 EVQLVESGGGLVKPGRSLRLSCTASGFTFGDYAMSWFRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRDLYPAMAEYWGQGTLVTVSS (SEQ ID NO: 134) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTAAAGCCAGGGCGGTCCCTGAGACTCTCCTGTACAGCTTCTGGATTCACCTTTGGTGATTATGCTATGAGCTGGTTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTAGGTTTCATTAGAAGCAAAGCTTATGGTGGGACAACAGAATACGCCGCGTCTGTGAAAGGCAGATTCACCATCTCAAGAGATGATTCCAAAAGCATCGCCTATCTGCAAATGAACAGCCTGAAAACCGAGGACACAGCCGTGTATTACTGTACTAGAGATTTATACCCAGCTATGGCTGAGTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA(서열번호 144) 44-C12 EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARDSGYSYGYPMNYYYYYMDVWGKGTTVTVSS (SEQ ID NO:135) GAAGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGATCATCCCTATCTTTGGTACAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACAAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGAGAGATTCGGGATACAGCTATGGTTACCCTATGAATTACTACTACTACTACATGGACGTCTGGGGCAAAGGGACCACGGTCACCGTCTCCTCA(서열번호 145) 44-H4 EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLVVGANPPTYYFDYWGQGTLVTVSS (SEQ ID NO: 136) GAGGTGCAGCTGGTGCAGTCTGGAGCAGAGGTGAAAAAGCCCGGGGAGTCTCTGAAGATCTCCTGTAAGGGTTCTGGATACAGCTTTACCAGCTACTGGATCGGCTGGGTGCGCCAGATGCCCGGGAAAGGCCTGGAGTGGATGGGGATCATCTATCCTGGTGACTCTGATACCAGATACAGCCCGTCCTTCCAAGGCCAGGTCACCATCTCAGCCGACAAGTCCATCAGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGGACACCGCCATGTATTACTGTGCGAGACTCGTAGTGGGAGCTAACCCCCCAACGTACTACTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA(서열번호 146)

designation Amino acid sequence of light chain variable region of anti-HER2 antibody Base sequence of light chain variable region of anti-HER2 antibody 41-B11 QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGIWVFGGGTKLTVLG (SEQ ID NO: 137) CAGACTGTGGTGACCCAGGAGCCATCGTTCTCAGTGTCCCCTGGAGGGACAGTCACACTCACTTGTGGCTTGAGCTCTGGCTCAGTCTCTACTAGTTACTACCCCAGCTGGTACCAGCAGACCCCAGGCCAGGCTCCACGCACGCTCATCTACAGCACAAACACTCGCTCTTCTGGGGTCCCTGATCGCTTCTCTGGCTCCATCCTTGGGAACAAAGCTGCCCTCACCATCACGGGGGCCCAGGCAGATGATGAATCTGATTATTACTGTGTGCTGTATATGGGTAGTGGCATTTGGGTGTTCGGCGGAGGGACCAAGTTGACCGTCCTAGGT(서열번호 147) 41-C6 QTVVTQEPSSSVSPGGTVTLTCGLTSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCMLYLGGGISVFGGGTKLTVLG (SEQ ID NO: 138) CAGACTGTGGTGACCCAGGAGCCATCGTCCTCAGTGTCCCCTGGAGGGACAGTCACACTCACTTGTGGCTTGACCTCTGGCTCAGTCTCTACTAGTTACTACCCCAGCTGGTACCAGCAGACCCCAGGCCAGGCTCCACGCACGCTCATCTACAGCACAAACACTCGCTCTTCTGGGGTCCCTGATCGCTTCTCTGGCTCCATCCTTGGGAACAAAGCTGCCCTCACCATCACGGGGGCCCAGGCAGATGATGAATCTGATTATTACTGTATGCTATATTTGGGTGGTGGCATTTCGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTAGGT(서열번호 148) 41-E1 QPVLTQPHSVSESPGKTVTISCTRSSGSIDSNFVQWYQQRPGSSPTTVIYDDNQRPSGVPDRFSGSIDSSSNSASLTISGLKIEDEADYYCQSYDSNNQVFGGGTKLTVLR (SEQ ID NO: 139) CAGCCTGTGCTGACTCAGCCCCACTCTGTGTCGGAGTCTCCGGGGAAGACGGTCACCATCTCCTGCACCCGCAGCAGTGGCAGCATTGACAGCAACTTTGTGCAGTGGTACCAGCAGCGCCCGGGCAGTTCCCCCACCACTGTCATCTATGACGATAACCAGAGGCCCTCTGGGGTCCCTGATCGGTTCTCTGGCTCCATCGACAGCTCCTCCAACTCTGCCTCCCTCACCATCTCTGGACTGAAGATTGAGGACGAGGCTGACTACTACTGTCAGTCTTATGATAGCAACAATCAGGTGTTCGGCGGCGGGACCAAGCTGACCGTCCTACGT(서열번호 149) 44-C12 QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSPTYYPSWYQQTPGQAPRTLIYRTNIRSSGVPDRFSGSILGNKAALTITGAQADDESLYYCLLYMGSGVSLFGGGTKLTVLR (SEQ ID NO: 140) CAGACTGTGGTGACTCAGGAGCCATCGTTCTCAGTGTCCCCTGGAGGGACAGTCACACTCACTTGTGGCTTGAGCTCTGGCTCAGTCTCTCCTACTTATTACCCCAGCTGGTACCAGCAGACCCCAGGCCAGGCTCCACGCACGCTCATCTACAGGACAAACATTCGCTCTTCTGGGGTCCCTGATCGCTTCTCTGGCTCCATCCTTGGGAACAAAGCTGCCCTCACCATCACGGGGGCCCAGGCAGATGATGAGTCTCTCTATTACTGTTTGCTCTATATGGGTAGTGGCGTTTCGCTGTTCGGCGGAGGGACCAAGCTGACCGTCCTACGT(서열번호 150) 44-H4 QAVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQTDDESDYYCVLYMGSGISLFGGGTKVTVLG (SEQ ID NO: 141) CAGGCTGTGGTGACCCAGGAGCCATCGTTCTCAGTGTCCCCTGGAGGGACAGTCACACTCACTTGTGGCTTGAGCTCTGGCTCAGTCTCTACTAGTTACTACCCCAGCTGGTACCAGCAGACCCCAGGCCAGGCTCCACGCACGCTCATCTACAGCACAAACACTCGCTCCTCTGGGGTCCCTGATCGCTTCTCTGGCTCCATCCTTGGGAACAAAGCTGCCCTCACCATCACGGGGGCCCAGACAGATGATGAATCTGATTATTACTGTGTGCTGTATATGGGTAGTGGCATTTCGCTATTCGGCGGAGGGACCAAGGTGACCGTCCTAGGT(서열번호 151)

Example 2: term c- Met /port HER2 Construction of bispecific antibodies

Each of the five anti-HER2 scFvs prepared in Example 1 was fused to the c-terminus of the Fc of the anti-cMet antibody L3-1Y-IgG2 prepared in Reference Example 1. The fusion process is as follows.

pcDNA ^TM 3.3-TOPO included in Invitrogen's OptiCHO ^TM Antibody Express Kit (Cat no. 12762-019) A DNA fragment having a nucleotide sequence (SEQ ID NO: 66) corresponding to the heavy chain of the anti-cMet antibody L3-1Y-IgG2 prepared in Reference Example 1 is inserted into the TA Cloning Kit (Cat no. 8300-01), and pOptiVEC ^TM - A DNA fragment having a nucleotide sequence (SEQ ID NO: 68) corresponding to the light chain of the anti-cMet antibody L3-1Y-IgG2 was inserted into the TOPO TA Cloning Kit. Then, at the c-terminus of the Fc of L3-1Y-IgG2 inserted into pcDNA ^TM 3.3, the anti-HER2 scFv coding DNA (heavy chain variable region and light chain variable region linked by (GGGGS)2) prepared in Example 1 was added ( A vector for expression of the diabody was constructed by fusion using the coding DNA sequence of the peptide linker consisting of GGGGS)2.

Each of the constructed vectors was amplified using the Qiagen Maxiprep kit (Cat no. 12662), and the transient expression was performed by Freestyle ^TM MAX 293 Expression System (invitrogen) was used. The cell line used is 293 F cell, FreeStyle ^TM 293 Expression Medium was used as a medium and cultured in a suspension culture method. One day before the transient expression, cells were prepared at a concentration of 5x10 ⁵ cells/ml, and after 24 hours, when the number of cells reached 1x10 ⁶ cells/ml, temporary expression was performed. Transfection was carried out using the liposomal reagent method using Freestyle ^TM MAX reagent (invitrogen). In a 15ml tube, prepare DNA in a ratio of heavy chain DNA: light chain DNA = 3:2 and mix with 2ml of OptiPro ^TM SFM (invtrogen) (A), mix (B) 100 μl of Freestyle ^TM MAX reagent and 2 ml of OptiPro ^TM SFM in another 15 ml tube, mix (A) and (B) and incubate for 15 minutes, The mixture was slowly mixed. After completion of transduction, incubation was carried out at 37 °C, 80% humidity, 8% CO _{2 ,} 130 rpm incubator for 5 days.

The cultured cells were centrifuged to take 100 ml of each supernatant, and purified using AKTA Prime (GE healthcare). A Protein A column (GE healthcare, 17-0405-03) was installed on AKTA Prime, and the culture medium was flowed at a flow rate of 5 ml/min, and eluted with an IgG elution buffer (Thermo Scientific, 21004). This was exchanged with PBS buffer to finally purify the anti-cMet/anti-HER2 bispecific antibody.

Anti-c-Met/anti-HER2 bispecific antibodies fused to the c-terminus of the prepared anti-c-Met antibody L3-1Y-IgG2 with an anti-HER2 scFv were MH2-12, MH2-13, MH2-14, MH2-16 , and MH2-18. The names of the anti-HER2 scFvs selected in Example 1 and the names of the anti-c-Met/anti-HER2 bispecific antibodies containing them are summarized in Table 10 below:

Anti-HER2 scFv name Anti c-Met/anti HER2 bispecific antibody designation 41-B11 MH2-12 41-C6 MH2-13 41-E1 MH2-14 44-C12 MH2-16 44-H4 MH2-18

Example 3: clause c- Met /port HER2 The double bond of a bispecific antibody ( dual binding ) Confirm

Affinities for each of the two antigens (c-Met and HER2) of the prepared anti-c-Met/anti-HER2 bispecific antibody were confirmed using Biacore T100 (GE). Human Fab binding agent (GE Healthcare) was immobilized on the surface of a CM5 chip (#BR-1005-30, GE) according to the manufacturer's instructions. About 90-120 RU of diabodies (MH2-12, MH2-13, MH2-14, MH2-16, or MH2-18) were captured, and various concentrations of c-Met-Fc (#358-MT/CF, R&D Systems) or Her2-Fc (#1129-ER, R&D Systems) were injected into the captured antibody. Here, 10 mM Glycine-HCl (pH 2.1) solution was injected to regenerate the surface. In order to measure the affinity, the data obtained in the above experiment were fitted using BIAevaluation software (GE Healthcare, Biacore T100 evaluation software).

The obtained results are shown in Tables 11 and 12.

Antibody Antigen K _D (nM) k _a (1/Ms) k _d (1/s) MH2-12 Her2 <0.01 2.0x10 ⁵ <5.8x10 ^-5 MH2-13 <0.01 3.6x10 ⁵ <7.9x10 ^-5 MH2-14 6.6 2.5x10 ⁵ 1.6x10 ^-3 MH2-16 1.16 5.8x10 ⁵ 6.7x10 ^-4 MH2-18 <0.01 8.2x10 ⁵ <1.3x10 ^-5

Antibody Antigen K _D (nM) k _a (1/Ms) k _d (1/s) MH2-12 c-Met 0.04 5.0x10 ⁵ 1.9x10 ^-5 MH2-13 0.09 4.8x10 ⁵ 4.4x10 ^-5 MH2-14 0.12 5.7x10 ⁵ 6.8x10 ^-5 MH2-16 0.04 8.7x10 ⁵ 3.6x10 ^-5 MH2-18 0.03 5.9x10 ⁵ 1.5x10 ^-5

As shown in Tables 11 and 12, it was confirmed that all of the five types of bispecific antibodies prepared in Example 2 had high affinity for c-Met and HER2.

Example 4: clause c- Met /port HER2 Cancer cell proliferation inhibition test of bispecific antibody

The anti-c-Met/anti-HER2 bispecific antibody prepared in Example 2 above had an inhibitory effect on cancer cell proliferation in MKN45 cells, a gastric cancer cell line. The cell line was purchased from ATCC.

The cell line was cultured in RPMI1640 medium (#11875-093, Gibco) by adding 10% (v/v) FBS and 1% (v/v) Penicilin-Streptomycin to 5% CO ₂ and 37 °C conditions. For cell proliferation assay, each of the 5 types of anti-c-Met/anti-HER2 diabodies prepared in Example 2 was 5 each while subculturing the cell line in a 96-well plate at a concentration of 1x10 ⁴ cells/well. It was treated with an amount of ug (microgram)/ml and cultured for 72 hours. As a negative control, a medium-treated group (indicated by medium) to which no antibody was added was used, and as a positive control, a group treated with 5 ug/ml of Herceptin (Roche), a commercially available HER2 inhibitor, L3-1Y-IgG2 prepared in Reference Example 1 The antibody 5 ug/ml treatment group and the combination treatment group with 5 ug/ml of the L3-1Y-IgG2 antibody prepared in Reference Example 1 and 5 ug/ml Herceptin were used, respectively.

After incubation, the degree of cell proliferation was analyzed using the Cell Counting Kit-8 assay (Dojindo Molecular Technologies, Gaithersburg, MD) according to the manufacturer's instructions. Briefly, after 72 hours of incubation, 10 μL of CCK8 solution was added to each well, incubated for 2.5 hours, and the absorbance at 450 nm was read with a microplate reader.

The obtained results are shown in FIG. 2 . As shown in FIG. 2 , the five anti-c-Met/anti-HER2 diabodies prepared in Example 2 were all anti-c-Met antibody L3-1Y-IgG2 (L3-1Y) and anti-HER2 antibody Herceptin. showed a significant increase in the cell proliferation inhibitory effect compared to the case of treatment alone, and also showed a superior cell proliferation inhibitory effect compared to the case where the anti-c-Met antibody L3-1Y-IgG2 and Herceptin were administered in combination. it was

Example 5: clause c- Met /port HER2 c- by bispecific antibody Met and HER2 Confirmation of simultaneous cellular internalization of

MKN45 cells (ATCC) were prepared in an amount of 4X10 ⁴ cells/well, and anti-c-Met/anti-HER2 bispecific antibodies (Example 2: MH2-12, MH2-13, MH2-14, MH2-16, MH2- 18) were treated respectively. The amount of the treated antibody was 5 μg/ml per well, respectively, and the antibody treatment was performed for 4 hours under a temperature condition of 37°C. For comparison, a group not treated with the bispecific antibody was prepared as a control. The cells were treated with 4% (v/v) formaldehyde for 15 minutes, fixed on a plate, and washed three times with PBS (phosphate buffer saline). Thereafter, the cells were treated with blocking buffer (0.5% triton x-100 and 5% donkey serum) at room temperature for 1 hour, and then primary antibodies against c-Met and HER2 (c-Met primary antibody; # FAB3582A, R&D systems, HER2 primary antibody; #2165, Cell signaling) was treated with a 1:100 dilution. At this time, the amount of the treated primary antibody was 100 μl, respectively, and the antibody treatment was performed at 4° C. for 15 hours. The cells were washed 3 times with PBS, then treated with 100 μl of the secondary antibody (#A21433, Invitrogen) diluted 1:2000 for 1 hour at room temperature, washed 3 times with PBS, and then washed with mounting medium (#H-1200) , Vector Labs) were prepared. The prepared cells were observed with a confocal microscope (Zeiss, LSM710).

The obtained results are shown in FIG. 3 . As shown in FIG. 3 , by treatment with an anti-c-Met/anti-HER2 bispecific antibody (MH2-12, MH2-13, MH2-14, MH2-16, or MH2-18), c-Met and HER2 were It was confirmed that all of them migrated into cells.

Korea Cell Line Research Foundation KCLRFBP00220 20091006

<110> Samsung Electronics Co. Ltd <120> Anti-HER2 scFv Fragment and Anti-HER2 Antibody and Anti-c-Met/Anti- HER2 Bispecific Antibodies Comprising the Same <130> DPP20147061KR <150> KR 10-2014-0055665 <151> 2014-05-09 <160> 162 <170> KopatentIn 1.71 <210> 1 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR1 of AbF46 <400> 1 Asp Tyr Tyr Met Ser 1 5 <210> 2 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR2 of AbF46 <400> 2 Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala Ser 1 5 10 15 Val Lys Gly <210> 3 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR3 of AbF46 <400> 3 Asp Asn Trp Phe Ala Tyr 1 5 <210> 4 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR1 of c-Met antibody <220> <221> MOD_RES <222> (1) <223> X is Pro or Ser or absent <220> <221> MOD_RES <222> (2) <223> X is Glu or Asp <400> 4 Xaa Xaa Tyr Tyr Met Ser 1 5 <210> 5 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR2 of c-Met antibody <220> <221> MOD_RES <222> (3) <223> X is Asn or Lys <220> <221> MOD_RES <222> (4) <223> X is Ala or Val <220> <221> MOD_RES <222> (7) <223> X is Asn or Thr <400> 5 Arg Asn Xaa Xaa Asn Gly Xaa Thr 1 5 <210> 6 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR3 of c-Met antibody <220> <221> MOD_RES <222> (5) <223> X is Ser or Thr <400> 6 Asp Asn Trp Leu Xaa Tyr 1 5 <210> 7 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR1 of c-Met antibody <220> <221> MOD_RES <222> (4) <223> X is His, Arg, Gln or Lys <220> <221> MOD_RES <222> (12) <223> X is His or Gln <220> <221> MOD_RES <222> (13) <223> X is Lys or Asn <220> <221> MOD_RES <222> (9) <223> X is Ser or Trp <400> 7 Lys Ser Ser Xaa Ser Leu Leu Ala Xaa Gly Asn Xaa Xaa Asn Tyr Leu 1 5 10 15 Ala <210> 8 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR2 of c-Met antibody <220> <221> MOD_RES <222> (2) <223> X is Ala or Gly <220> <221> MOD_RES <222> (4) <223> X is Thr or Lys <220> <221> MOD_RES <222> (7) <223> X is Ser or Pro <400> 8 Trp Xaa Ser Xaa Arg Val Xaa 1 5 <210> 9 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR3 of c-Met antibody <220> <221> MOD_RES <222> (1) <223> X is Gly, Ala or Gln <220> <221> MOD_RES <222> (6) <223> X is Arg, His, Ser, Ala, Gly or Lys <220> <221> MOD_RES <222> (8) <223> X is Leu, Tyr, Phe or Met <400> 9 Xaa Gln Ser Tyr Ser Xaa Pro Xaa Thr 1 5 <210> 10 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR1 of AbF46 <400> 10 Lys Ser Ser Gln Ser Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu 1 5 10 15 Ala <210> 11 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR2 of AbF46 <400> 11 Trp Ala Ser Thr Arg Val Ser 1 5 <210> 12 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR3 of AbF46 <400> 12 Gln Gln Ser Tyr Ser Ala Pro Leu Thr 1 5 <210> 13 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-L3 derived from L3-1 clone <400> 13 Gln Gln Ser Tyr Ser Arg Pro Tyr Thr 1 5 <210> 14 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-L3 derived from L3-2 clone <400> 14 Gly Gln Ser Tyr Ser Arg Pro Leu Thr 1 5 <210> 15 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-L3 derived from L3-3 clone <400> 15 Ala Gln Ser Tyr Ser His Pro Phe Ser 1 5 <210> 16 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-L3 derived from L3-5 clone <400> 16 Gln Gln Ser Tyr Ser Arg Pro Phe Thr 1 5 <210> 17 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of anti c-Met humanized antibody (huAbF46-H4) <400> 17 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 18 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti c-Met humanized antibody (huAbF46-H4) <400> 18 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Arg Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 19 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti c-Met humanized antibody (huAbF46-H4) <400> 19 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gly Gln 85 90 95 Ser Tyr Ser Arg Pro Leu Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 20 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti c-Met humanized antibody (huAbF46-H4) <400> 20 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Ala Gln 85 90 95 Ser Tyr Ser His Pro Phe Ser Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 21 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti c-Met humanized antibody (huAbF46-H4) <400> 21 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Arg Pro Phe Thr Phe Gly Gln Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 22 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> CDR-H1 derived from H11-4 clone <400> 22 Pro Glu Tyr Tyr Met Ser 1 5 <210> 23 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> CDR-H1 derived from YC151 clone <400> 23 Pro Asp Tyr Tyr Met Ser 1 5 <210> 24 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> CDR-H1 derived from YC193 clone <400> 24 Ser Asp Tyr Tyr Met Ser 1 5 <210> 25 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> CDR-H2 derived from YC244 clone <400> 25 Arg Asn Asn Ala Asn Gly Asn Thr 1 5 <210> 26 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> CDR-H2 derived from YC321 clone <400> 26 Arg Asn Lys Val Asn Gly Tyr Thr 1 5 <210> 27 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> CDR-H3 derived from YC354 clone <400> 27 Asp Asn Trp Leu Ser Tyr 1 5 <210> 28 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> CDR-H3 derived from YC374 clone <400> 28 Asp Asn Trp Leu Thr Tyr 1 5 <210> 29 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 derived from L1-1 clone <400> 29 Lys Ser Ser His Ser Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu 1 5 10 15 Ala <210> 30 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 derived from L1-3 clone <400> 30 Lys Ser Ser Arg Ser Leu Leu Ser Ser Ser Gly Asn His Lys Asn Tyr Leu 1 5 10 15 Ala <210> 31 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 derived from L1-4 clone <400> 31 Lys Ser Ser Lys Ser Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu 1 5 10 15 Ala <210> 32 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 derived from L1-12 clone <400> 32 Lys Ser Ser Arg Ser Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu 1 5 10 15 Ala <210> 33 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 derived from L1-22 clone <400> 33 Lys Ser Ser His Ser Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu 1 5 10 15 Ala <210> 34 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> CDR-L2 derived from L2-9 clone <400> 34 Trp Ala Ser Lys Arg Val Ser 1 5 <210> 35 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> CDR-L2 derived from L2-12 clone <400> 35 Trp Gly Ser Thr Arg Val Ser 1 5 <210> 36 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> CDR-L2 derived from L2-16 clone <400> 36 Trp Gly Ser Thr Arg Val Pro 1 5 <210> 37 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-L3 derived from L3-32 clone <400> 37 Gln Gln Ser Tyr Ser Lys Pro Phe Thr 1 5 <210> 38 <211> 1416 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of heavy chain of chAbF46 <220> <221> misc_feature <222> (1)..(6) <223> EcoRI restriction site <220> <221> misc_feature <222> (7)..(66) <223> signal sequence <220> <221> misc_feature <222> (67)..(417) <223> VH - heavy chain variable region <220> <221> misc_feature <222> (418)..(423) <223> NdeI restriction site <220> <221> misc_feature <222> (418)..(1407) <223> CH - heavy chain constant region <220> <221> misc_feature <222> (1408)..(1410) <223> TGA - stop codon <220> <221> misc_feature <222> (1411)..(1416) <223> XhoI restriction site <400> 38 gaattcgccg ccaccatgga atggagctgg gtttttctcg taacactttt aaatggtatc 60 cagtgtgagg tgaagctggt ggagtctgga ggaggcttgg tacagcctgg gggttctctg 120 agactctcct gtgcaacttc tgggttcacc ttcactgatt actacatgag ctgggtccgc 180 cagcctccag gaaaggcact tgagtggttg ggttttatta gaaacaaagc taatggttac 240 acaacagagt acagtgcatc tgtgaagggt cggttcacca tctccagaga taattcccaa 300 agcatcctct atcttcaaat ggacaccctg agagctgagg acagtgccac ttattactgt 360 gcaagagata actggtttgc ttactggggc caagggactc tggtcactgt ctctgcagct 420 agcaccaagg gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc 480 acagcggccc tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 540 aactcaggcg ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga 600 ctctactccc tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac 660 atctgcaacg tgaatcacaa gcccagcaac accaaggtgg acaagaaagt tgagcccaaa 720 tcttgtgaca aaactcacac atgcccaccg tgcccagcac ctgaactcct ggggggaccg 780 tcagtcttcc tcttcccccc aaaacccaag gacaccctca tgatctcccg gacccctgag 840 gtcacatgcg tggtggtgga cgtgagccac gaagaccctg aggtcaagtt caactggtac 900 gtggacggcg tggaggtgca taatgccaag acaaagccgc gggaggagca gtacaacagc 960 acgtaccgtg tggtcagcgt cctcaccgtc ctgcaccagg actggctgaa tggcaaggag 1020 tacaagtgca aggtctccaa caaagccctc ccagccccca tcgagaaaac catctccaaa 1080 gccaaagggc agccccgaga accacaggtg tacaccctgc ccccatcccg ggaggagatg 1140 accaagaacc aggtcagcct gacctgcctg gtcaaaggct tctatcccag cgacatcgcc 1200 gtggagtggg agagcaatgg gcagccggag aacaactaca agaccacgcc tcccgtgctg 1260 gactccgacg gctccttctt cctctacagc aagctcaccg tggacaagag caggtggcag 1320 caggggaacg tcttctcatg ctccgtgatg catgaggctc tgcacaacca ctacacgcag 1380 aagagcctct ccctgtctcc gggtaaatga ctcgag 1416 <210> 39 <211> 759 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of light chain of chAbF46 <220> <221> misc_difference <222> (1)..(6) <223> EcoRI restriction site <220> <221> misc_difference <222> (7)..(90) <223> signal sequence <220> <221> misc_difference <222> (91)..(432) <223> VL - light chain variable region <220> <221> misc_difference <222> (430)..(435) <223> BsiWI restriction site <220> <221> misc_difference <222> (433)..(750) <223> CL - light chain constant region <220> <221> misc_difference <222> (751)..(753) <223> stop codon <220> <221> misc_difference <222> (754)..(759) <223> XhoI restriction site <400> 39 gaattcacta gtgattaatt cgccgccacc atggattcac aggcccaggt cctcatgttg 60 ctgctgctat cggtatctgg tacctgtgga gacattttga tgacccagtc tccatcctcc 120 ctgactgtgt cagcaggaga gaaggtcact atgagctgca agtccagtca gagtctttta 180 gctagtggca accaaaataa ctacttggcc tggcaccagc agaaaccagg acgatctcct 240 aaaatgctga taatttgggc atccactagg gtatctggag tccctgatcg cttcataggc 300 agtggatctg ggacggattt cactctgacc atcaacagtg tgcaggctga agatctggct 360 gtttattact gtcagcagtc ctacagcgct ccgctcacgt tcggtgctgg gaccaagctg 420 gagctgaaac gtacggtggc tgcaccatct gtcttcatct tcccgccatc tgatgagcag 480 ttgaaatctg gaactgcctc tgttgtgtgc ctgctgaata acttctatcc cagagaggcc 540 aaagtacagt ggaaggtgga taacgccctc caatcgggta actcccagga gagtgtcaca 600 gagcaggaca gcaaggacag cacctacagc ctcagcagca ccctgacgct gagcaaagca 660 gactacgaga aacacaaagt ctacgcctgc gaagtcaccc atcagggcct gagctcgccc 720 gtcacaaaga gcttcaacag gggagagtgt tgactcgag 759 <210> 40 <211> 447 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H1-heavy <400> 40 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Ser 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu 115 120 125 Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys 130 135 140 Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser 145 150 155 160 Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser 165 170 175 Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser 180 185 190 Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn 195 200 205 Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His 210 215 220 Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 225 230 235 240 Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 245 250 255 Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 260 265 270 Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 275 280 285 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 290 295 300 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 305 310 315 320 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile 325 330 335 Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 340 345 350 Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 355 360 365 Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 370 375 380 Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 385 390 395 400 Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 405 410 415 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420 425 430 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440 445 <210> 41 <211> 447 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H3-heavy <400> 41 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Ser 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu 115 120 125 Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys 130 135 140 Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser 145 150 155 160 Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser 165 170 175 Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser 180 185 190 Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn 195 200 205 Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His 210 215 220 Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 225 230 235 240 Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 245 250 255 Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 260 265 270 Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 275 280 285 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 290 295 300 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 305 310 315 320 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile 325 330 335 Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 340 345 350 Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 355 360 365 Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 370 375 380 Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 385 390 395 400 Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 405 410 415 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420 425 430 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440 445 <210> 42 <211> 447 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H4-heavy <400> 42 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu 115 120 125 Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys 130 135 140 Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser 145 150 155 160 Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser 165 170 175 Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser 180 185 190 Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn 195 200 205 Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His 210 215 220 Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val 225 230 235 240 Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr 245 250 255 Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu 260 265 270 Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys 275 280 285 Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser 290 295 300 Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys 305 310 315 320 Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile 325 330 335 Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro 340 345 350 Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu 355 360 365 Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn 370 375 380 Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser 385 390 395 400 Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg 405 410 415 Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu 420 425 430 His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 435 440 445 <210> 43 <211> 220 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H1-light <400> 43 Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Glu Arg Ala Thr Ile Asn Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Gln 35 40 45 Pro Pro Lys Met Leu Ile Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp 115 120 125 Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn 130 135 140 Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu 145 150 155 160 Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp 165 170 175 Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr 180 185 190 Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser 195 200 205 Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215 220 <210> 44 <211> 220 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H2-light <400> 44 Asp Ile Val Met Thr Gln Thr Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Leu Gln Lys Pro Gly Gln 35 40 45 Ser Pro Gln Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys 65 70 75 80 Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gln Gly Thr Lys Leu Glu Leu 100 105 110 Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp 115 120 125 Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn 130 135 140 Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu 145 150 155 160 Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp 165 170 175 Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr 180 185 190 Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser 195 200 205 Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215 220 <210> 45 <211> 220 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H3-light <400> 45 Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Glu Arg Ala Thr Ile Asn Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln 35 40 45 Pro Pro Lys Leu Leu Ile Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp 115 120 125 Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn 130 135 140 Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu 145 150 155 160 Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp 165 170 175 Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr 180 185 190 Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser 195 200 205 Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215 220 <210> 46 <211> 219 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of H4-light <400> 46 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp 115 120 125 Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn 130 135 140 Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu 145 150 155 160 Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp 165 170 175 Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr 180 185 190 Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser 195 200 205 Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu 210 215 <210> 47 <211> 1350 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H1-heavy <400> 47 gaggtgcagc tggtggagtc tgggggaggc ttggtccagc ctggagggtc cctgagactc 60 tcctgtgcag cctctggatt caccttcact gactactaca tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg gttgggcttt attagaaaca aagctaacgg ttacaccaca 180 gaatacagtg cgtctgtgaa aggcagattc accatctcaa gagataattc aaagaactca 240 ctgtatctgc aaatgaacag cctgaaaacc gaggacacgg ccgtgtatta ctgtgctaga 300 gataactggt ttgcttactg gggtcaagga accctggtca ccgtctcctc ggctagcacc 360 aagggcccat cggtcttccc cctggcaccc tcctccaaga gcacctctgg gggcacagcg 420 gccctgggct gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc gtggaactca 480 ggcgccctga ccagcggcgt gcacaccttc ccggctgtcc tacagtcctc aggactctac 540 tccctcagca gcgtggtgac cgtgccctcc agcagcttgg gcacccagac ctacatctgc 600 aacgtgaatc acaagcccag caacaccaag gtggacaaga aagttgagcc caaatcttgt 660 gacaaaactc acacatgccc accgtgccca gcacctgaac tcctgggggg accgtcagtc 720 ttcctcttcc ccccaaaacc caaggacacc ctcatgatct cccggacccc tgaggtcaca 780 tgcgtggtgg tggacgtgag ccacgaagac cctgaggtca agttcaactg gtacgtggac 840 ggcgtggagg tgcataatgc caagacaaag ccgcgggagg agcagtacaa cagcacgtac 900 cgtgtggtca gcgtcctcac cgtcctgcac caggactggc tgaatggcaa ggagtacaag 960 tgcaaggtct ccaacaaagc cctcccagcc cccatcgaga aaaccatctc caaagccaaa 1020 gggcagcccc gagaaccaca ggtgtacacc ctgcccccat cccgggagga gatgaccaag 1080 aaccaggtca gcctgacctg cctggtcaaa ggcttctatc ccagcgacat cgccgtggag 1140 tgggagagca atgggcagcc ggagaacaac tacaagacca cgcctcccgt gctggactcc 1200 gacggctcct tcttcctcta cagcaagctc accgtggaca agagcaggtg gcagcagggg 1260 aacgtcttct catgctccgt gatgcatgag gctctgcaca accactacac gcagaagagc 1320 ctctccctgt ctccgggtaa atgactcgag 1350 <210> 48 <211> 1350 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H3-heavy <400> 48 gaggtgcagc tggtggagtc tgggggaggc ttggtccagc ctggagggtc cctgagactc 60 tcctgtgcag cctctggatt caccttcact gactactaca tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg gttgggcttt attagaaaca aagctaacgg ttacaccaca 180 gaatacagtg cgtctgtgaa aggcagattc accatctcaa gagataattc aaagaactca 240 ctgtatctgc aaatgaacag cctgcgtgct gaggacacgg ccgtgtatta ctgtgctaga 300 gataactggt ttgcttactg gggtcaagga accctggtca ccgtctcctc ggctagcacc 360 aagggcccat cggtcttccc cctggcaccc tcctccaaga gcacctctgg gggcacagcg 420 gccctgggct gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc gtggaactca 480 ggcgccctga ccagcggcgt gcacaccttc ccggctgtcc tacagtcctc aggactctac 540 tccctcagca gcgtggtgac cgtgccctcc agcagcttgg gcacccagac ctacatctgc 600 aacgtgaatc acaagcccag caacaccaag gtggacaaga aagttgagcc caaatcttgt 660 gacaaaactc acacatgccc accgtgccca gcacctgaac tcctgggggg accgtcagtc 720 ttcctcttcc ccccaaaacc caaggacacc ctcatgatct cccggacccc tgaggtcaca 780 tgcgtggtgg tggacgtgag ccacgaagac cctgaggtca agttcaactg gtacgtggac 840 ggcgtggagg tgcataatgc caagacaaag ccgcgggagg agcagtacaa cagcacgtac 900 cgtgtggtca gcgtcctcac cgtcctgcac caggactggc tgaatggcaa ggagtacaag 960 tgcaaggtct ccaacaaagc cctcccagcc cccatcgaga aaaccatctc caaagccaaa 1020 gggcagcccc gagaaccaca ggtgtacacc ctgcccccat cccgggagga gatgaccaag 1080 aaccaggtca gcctgacctg cctggtcaaa ggcttctatc ccagcgacat cgccgtggag 1140 tgggagagca atgggcagcc ggagaacaac tacaagacca cgcctcccgt gctggactcc 1200 gacggctcct tcttcctcta cagcaagctc accgtggaca agagcaggtg gcagcagggg 1260 aacgtcttct catgctccgt gatgcatgag gctctgcaca accactacac gcagaagagc 1320 ctctccctgt ctccgggtaa atgactcgag 1350 <210> 49 <211> 1350 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H4-heavy <400> 49 gaggttcagc tggtggagtc tggcggtggc ctggtgcagc cagggggctc actccgtttg 60 tcctgtgcag cttctggctt caccttcact gattactaca tgagctgggt gcgtcaggcc 120 ccgggtaagg gcctggaatg gttgggtttt attagaaaca aagctaatgg ttacacaaca 180 gagtacagtg catctgtgaa gggtcgtttc actataagca gagataattc caaaaacaca 240 ctgtacctgc agatgaacag cctgcgtgct gaggacactg ccgtctatta ttgtgctaga 300 gataactggt ttgcttactg gggccaaggg actctggtca ccgtctcctc ggctagcacc 360 aagggcccat cggtcttccc cctggcaccc tcctccaaga gcacctctgg gggcacagcg 420 gccctgggct gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc gtggaactca 480 ggcgccctga ccagcggcgt gcacaccttc ccggctgtcc tacagtcctc aggactctac 540 tccctcagca gcgtggtgac cgtgccctcc agcagcttgg gcacccagac ctacatctgc 600 aacgtgaatc acaagcccag caacaccaag gtggacaaga aagttgagcc caaatcttgt 660 gacaaaactc acacatgccc accgtgccca gcacctgaac tcctgggggg accgtcagtc 720 ttcctcttcc ccccaaaacc caaggacacc ctcatgatct cccggacccc tgaggtcaca 780 tgcgtggtgg tggacgtgag ccacgaagac cctgaggtca agttcaactg gtacgtggac 840 ggcgtggagg tgcataatgc caagacaaag ccgcgggagg agcagtacaa cagcacgtac 900 cgtgtggtca gcgtcctcac cgtcctgcac caggactggc tgaatggcaa ggagtacaag 960 tgcaaggtct ccaacaaagc cctcccagcc cccatcgaga aaaccatctc caaagccaaa 1020 gggcagcccc gagaaccaca ggtgtacacc ctgcccccat cccgggagga gatgaccaag 1080 aaccaggtca gcctgacctg cctggtcaaa ggcttctatc ccagcgacat cgccgtggag 1140 tgggagagca atgggcagcc ggagaacaac tacaagacca cgcctcccgt gctggactcc 1200 gacggctcct tcttcctcta cagcaagctc accgtggaca agagcaggtg gcagcagggg 1260 aacgtcttct catgctccgt gatgcatgag gctctgcaca accactacac gcagaagagc 1320 ctctccctgt ctccgggtaa atgactcgag 1350 <210> 50 <211> 669 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H1-light <400> 50 gacatcgtga tgacccagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc 60 atcaactgca agtccagcca gagtctttta gctagcggca accaaaataa ctacttagct 120 tggcaccagc agaaaccagg acagcctcct aagatgctca ttatttgggc atctacccgg 180 gtatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 240 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaatc ctatagtgct 300 cctctcacgt tcggaggcgg taccaaggtg gagatcaaac gtacggtggc tgcaccatct 360 gtcttcatct tcccgccatc tgatgagcag ttgaaatctg gaactgcctc tgttgtgtgc 420 ctgctgaata acttctatcc cagagaggcc aaagtacagt ggaaggtgga taacgccctc 480 caatcgggta actcccagga gagtgtcaca gagcaggaca gcaaggacag cacctacagc 540 ctcagcagca ccctgacgct gagcaaagca gactacgaga aacacaaagt ctacgcctgc 600 gaagtcaccc atcagggcct gagctcgccc gtcacaaaga gcttcaacag gggagagtgt 660 tgactcgag 669 <210> 51 <211> 669 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H2-light <400> 51 gatattgtga tgacccagac tccactctcc ctgcccgtca cccctggaga gccggcctcc 60 atctcctgca agtccagtca gagtctttta gctagtggca accaaaataa ctacttggcc 120 tggcacctgc agaagccagg gcagtctcca cagatgctga tcatttgggc atccactagg 180 gtatctggag tcccagacag gttcagtggc agtgggtcag gcactgattt cacactgaaa 240 atcagcaggg tggaggctga ggatgttgga gtttattact gccagcagtc ctacagcgct 300 ccgctcacgt tcggacaggg taccaagctg gagctcaaac gtacggtggc tgcaccatct 360 gtcttcatct tcccgccatc tgatgagcag ttgaaatctg gaactgcctc tgttgtgtgc 420 ctgctgaata acttctatcc cagagaggcc aaagtacagt ggaaggtgga taacgccctc 480 caatcgggta actcccagga gagtgtcaca gagcaggaca gcaaggacag cacctacagc 540 ctcagcagca ccctgacgct gagcaaagca gactacgaga aacacaaagt ctacgcctgc 600 gaagtcaccc atcagggcct gagctcgccc gtcacaaaga gcttcaacag gggagagtgt 660 tgactcgag 669 <210> 52 <211> 669 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H3-light <400> 52 gacatcgtga tgacccagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc 60 atcaactgca agtccagcca gagtctttta gctagcggca accaaaataa ctacttagct 120 tggtaccagc agaaaccagg acagcctcct aagctgctca ttatttgggc atctacccgg 180 gtatccgggg tccctgaccg attcagtggc agcgggtctg ggacagattt cactctcacc 240 atcagcagcc tgcaggctga agatgtggca gtttattact gtcagcaatc ctatagtgct 300 cctctcacgt tcggaggcgg taccaaggtg gagatcaaac gtacggtggc tgcaccatct 360 gtcttcatct tcccgccatc tgatgagcag ttgaaatctg gaactgcctc tgttgtgtgc 420 ctgctgaata acttctatcc cagagaggcc aaagtacagt ggaaggtgga taacgccctc 480 caatcgggta actcccagga gagtgtcaca gagcaggaca gcaaggacag cacctacagc 540 ctcagcagca ccctgacgct gagcaaagca gactacgaga aacacaaagt ctacgcctgc 600 gaagtcaccc atcagggcct gagctcgccc gtcacaaaga gcttcaacag gggagagtgt 660 tgactcgag 669 <210> 53 <211> 669 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of H4-light <400> 53 gatatccaga tgacccagtc cccgagctcc ctgtccgcct ctgtgggcga tagggtcacc 60 atcacctgca agtccagtca gagtctttta gctagtggca accaaaataa ctacttggcc 120 tggcaccaac agaaaccagg aaaagctccg aaaatgctga ttatttgggc atccactagg 180 gtatctggag tcccttctcg cttctctgga tccgggtctg ggacggattt cactctgacc 240 atcagcagtc tgcagccgga agacttcgca acttattact gtcagcagtc ctacagcgct 300 ccgctcacgt tcggacaggg taccaaggtg gagatcaaac gtacggtggc tgcaccatct 360 gtcttcatct tcccgccatc tgatgagcag ttgaaatctg gaactgcctc tgttgtgtgc 420 ctgctgaata acttctatcc cagagaggcc aaagtacagt ggaaggtgga taacgccctc 480 caatcgggta actcccagga gagtgtcaca gagcaggaca gcaaggacag cacctacagc 540 ctcagcagca ccctgacgct gagcaaagca gactacgaga aacacaaagt ctacgcctgc 600 gaagtcaccc atcagggcct gagctcgccc gtcacaaaga gcttcaacag gggagagtgt 660 tgactcgag 669 <210> 54 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> linker between VH and VL <400> 54 Gly Leu Gly Gly Leu Gly Gly Gly Gly Ser Gly Gly Gly Gly Gly Ser Gly 1 5 10 15 Gly Ser Ser Gly Val Gly Ser 20 <210> 55 <211> 1088 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding scFv of huAbF46 antibody <400> 55 gctagcgttt tagcagaagt tcaattggtt gaatctggtg gtggtttggt tcaaccaggt 60 ggttctttga gattgtcttg tgctgcttct ggttttactt tcaccgatta ttacatgtcc 120 tgggttagac aagctccagg taaaggtttg gaatggttgg gtttcattag aaacaaggct 180 aacggttaca ctaccgaata ttctgcttct gttaagggta gattcaccat ttctagagac 240 aactctaaga acaccttgta cttgcaaatg aactccttga gagctgaaga tactgctgtt 300 tattactgcg ctagagataa ttggtttgct tattggggtc aaggtacttt ggttactgtt 360 tcttctggcc tcggggggcct cggaggagga ggtagtggcg gaggaggctc cggtggatcc 420 agcggtgtgg gttccgatat tcaaatgacc caatctccat cttctttgtc tgcttcagtt 480 ggtgatagag ttaccattac ttgtaagtcc tcccaatctt tgttggcttc tggtaatcag 540 aacaattact tggcttggca tcaacaaaaa ccaggtaaag ctccaaagat gttgattatt 600 tgggcttcta ccagagtttc tggtgttcca tctagatttt ctggttctgg ttccggtact 660 gattttactt tgaccatttc atccttgcaa ccagaagatt tcgctactta ctactgtcaa 720 caatcttact ctgctccatt gacttttggt caaggtacaa aggtcgaaat caagagagaa 780 ttcggtaagc ctatccctaa ccctctcctc ggtctcgatt ctacgggtgg tggtggatct 840 ggtggtggtg gttctggtgg tggtggttct caggaactga caactatatg cgagcaaatc 900 ccctcaccaa ctttagaatc gacgccgtac tctttgtcaa cgactactat tttggccaac 960 gggaaggcaa tgcaaggagt ttttgaatat tacaaatcag taacgtttgt cagtaattgc 1020 ggttctcacc cctcaacaac tagcaaaggc agccccataa acacacagta tgttttttga 1080 gtttaaac 1088 <210> 56 <211> 5597 <212> DNA <213> Artificial Sequence <220> <223> expression vector including polynucleotide encoding scFv of huAbF46 antibody <220> <221> misc_difference <222> (573)..(578) <223> NheI restriction site <220> <221> misc_difference <222> (588)..(938) <223> huAbF46 VH <220> <221> misc_difference <222> (939)..(1007) <223> linker <220> <221> misc_difference <222> (1008)..(1349) <223> huAbF46 VL <220> <221> misc_difference <222> (1350)..(1355) <223> EcoRI restriction site <220> <221> misc_difference <222> (1356)..(1397) <223> V5 epitope <220> <221> misc_difference <222> (1398)..(1442) <223> (G4S)3 linker <220> <221> misc_difference <222> (1443)..(1649) <223> Aga2 <220> <221> misc_difference <222> (1650)..(1652) <223> TGA (stop codon) <220> <221> misc_difference <222> (1653)..(1660) <223> PmeI restriction site <400> 56 acggattaga agccgccgag cgggtgacag ccctccgaag gaagactctc ctccgtgcgt 60 cctcgtcttc accggtcgcg ttcctgaaac gcagatgtgc ctcgcgccgc actgctccga 120 acaataaaga ttctacaata ctagctttta tggttatgaa gaggaaaaat tggcagtaac 180 ctggccccac aaaccttcaa atgaacgaat caaattaaca accataggat gataatgcga 240 ttagtttttt agccttattt ctggggtaat taatcagcga agcgatgatt tttgatctat 300 taacagatat ataaatgcaa aaactgcata accactttaa ctaatacttt caacattttc 360 ggtttgtatt acttcttatt caaatgtaat aaaagtatca acaaaaaatt gttaatatac 420 ctctatactt taacgtcaag gagaaaaaac cccggatcgg actactagca gctgtaatac 480 gactcactat agggaatatt aagctaattc tacttcatac attttcaatt aagatgcagt 540 tacttcgctg tttttcaata ttttctgtta ttgctagcgt tttagcagaa gttcaattgg 600 ttgaatctgg tggtggtttg gttcaaccag gtggttcttt gagattgtct tgtgctgctt 660 ctggttttac tttcaccgat tattacatgt cctgggttag acaagctcca ggtaaaggtt 720 tggaatggtt gggtttcatt agaaacaagg ctaacggtta cactaccgaa tattctgctt 780 ctgttaaggg tagattcacc atttctagag acaactctaa gaacaccttg tacttgcaaa 840 tgaactcctt gagagctgaa gatactgctg tttattactg cgctagagat aattggtttg 900 cttattgggg tcaaggtact ttggttactg tttcttctgg cctcgggggc ctcggaggag 960 gaggtagtgg cggaggaggc tccggtggat ccagcggtgt gggttccgat attcaaatga 1020 cccaatctcc atcttctttg tctgcttcag ttggtgatag agttaccatt acttgtaagt 1080 cctcccaatc tttgttggct tctggtaatc agaacaatta cttggcttgg catcaacaaa 1140 aaccaggtaa agctccaaag atgttgatta tttgggcttc taccagagtt tctggtgttc 1200 catctagatt ttctggttct ggttccggta ctgattttac tttgaccatt tcatccttgc 1260 aaccagaaga tttcgctact tactactgtc aacaatctta ctctgctcca ttgacttttg 1320 gtcaaggtac aaaggtcgaa atcaagagag aattcggtaa gcctatccct aaccctctcc 1380 tcggtctcga ttctacgggt ggtggtggat ctggtggtgg tggttctggt ggtggtggtt 1440 ctcaggaact gacaactata tgcgagcaaa tcccctcacc aactttagaa tcgacgccgt 1500 actctttgtc aacgactact attttggcca acgggaaggc aatgcaagga gtttttgaat 1560 attacaaatc agtaacgttt gtcagtaatt gcggttctca cccctcaaca actagcaaag 1620 gcagccccat aaacacacag tatgtttttt gagtttaaac ccgctgatct gataacaaca 1680 gtgtagatgt aacaaaatcg actttgttcc cactgtactt ttagctcgta caaaatacaa 1740 tatacttttc atttctccgt aaacaacatg ttttcccatg taatatcctt ttctattttt 1800 cgttccgtta ccaactttac acatacttta tatagctatt cacttctata cactaaaaaa 1860 ctaagacaat tttaattttg ctgcctgcca tatttcaatt tgttataaat tcctataatt 1920 tatcctatta gtagctaaaa aaagatgaat gtgaatcgaa tcctaagaga attgggcaag 1980 tgcacaaaca atacttaaat aaatactact cagtaataac ctatttctta gcatttttga 2040 cgaaatttgc tattttgtta gagtctttta caccatttgt ctccacacct ccgcttacat 2100 caacaccaat aacgccattt aatctaagcg catcaccaac attttctggc gtcagtccac 2160 cagctaacat aaaatgtaag ctctcggggc tctcttgcct tccaacccag tcagaaatcg 2220 agttccaatc caaaagttca cctgtcccac ctgcttctga atcaaacaag ggaataaacg 2280 aatgaggttt ctgtgaagct gcactgagta gtatgttgca gtcttttgga aatacgagtc 2340 ttttaataac tggcaaaccg aggaactctt ggtattcttg ccacgactca tctccgtgca 2400 gttggacgat atcaatgccg taatcattga ccagagccaa aacatcctcc ttaggttgat 2460 tacgaaacac gccaaccaag tatttcggag tgcctgaact atttttatat gcttttacaa 2520 gacttgaaat tttccttgca ataaccgggt caattgttct ctttctattg ggcacacata 2580 taatacccag caagtcagca tcggaatcta gagcacattc tgcggcctct gtgctctgca 2640 agccgcaaac tttcaccaat ggaccagaac tacctgtgaa attaataaca gacatactcc 2700 aagctgcctt tgtgtgctta atcacgtata ctcacgtgct caatagtcac caatgccctc 2760 cctcttggcc ctctcctttt cttttttcga ccgaatttct tgaagacgaa agggcctcgt 2820 gatacgccta tttttatagg ttaatgtcat gataataatg gtttcttagg acggatcgct 2880 tgcctgtaac tacacgcgc ctcgtatctt ttaatgatgg aataatttgg gaatttactc 2940 tgtgtttatt tatttttatg ttttgtattt ggattttaga aagtaaataa agaaggtaga 3000 agagttacgg aatgaagaaa aaaaaataaa caaaggttta aaaaatttca acaaaaagcg 3060 tactttacat atatatttat tagacaagaa aagcagatta aatagatata cattcgatta 3120 acgataagta aaatgtaaaa tcacaggatt ttcgtgtgtg gtcttctaca cagacaagat 3180 gaaacaattc ggcattaata cctgagagca ggaagagcaa gataaaaggt agtatttgtt 3240 ggcgatcccc ctagagtctt ttacatcttc ggaaaacaaa aactattttt tctttaattt 3300 ctttttttac tttctatttt taatttatat atttatatta aaaaatttaa attataatta 3360 tttttatagc acgtgatgaa aaggacccag gtggcacttt tcggggaaat gtgcgcggaa 3420 cccctatttg tttatttttc taaatacatt caaatatgta tccgctcatg agacaataac 3480 cctgataaat gcttcaataa tattgaaaaa ggaagagtat gagtattcaa catttccgtg 3540 tcgcccttat tccctttttt gcggcatttt gccttcctgt ttttgctcac ccagaaacgc 3600 tggtgaaagt aaaagatgct gaagatcagt tgggtgcacg agtgggttac atcgaactgg 3660 atctcaacag cggtaagatc cttgagagtt ttcgccccga agaacgtttt ccaatgatga 3720 gcacttttaa agttctgcta tgtggcgcgg tattatcccg tgttgacgcc gggcaagagc 3780 aactcggtcg ccgcatacac tattctcaga atgacttggt tgagtactca ccagtcacag 3840 aaaagcatct tacggatggc atgacagtaa gagaattatg cagtgctgcc ataaccatga 3900 gtgataacac tgcggccaac ttacttctga caacgatcgg aggaccgaag gagctaaccg 3960 cttttttgca caacatgggg gatcatgtaa ctcgccttga tcgttgggaa ccggagctga 4020 atgaagccat accaaacgac gagcgtgaca ccacgatgcc tgtagcaatg gcaacaacgt 4080 tgcgcaaact attaactggc gaactactta ctctagcttc ccggcaacaa ttaatagact 4140 ggatggaggc ggataaagtt gcaggaccac ttctgcgctc ggcccttccg gctggctggt 4200 ttattgctga taaatctgga gccggtgagc gtgggtctcg cggtatcatt gcagcactgg 4260 ggccagatgg taagccctcc cgtatcgtag ttatctacac gacgggcagt caggcaacta 4320 tggatgaacg aaatagacag atcgctgaga taggtgcctc actgattaag cattggtaac 4380 tgtcagacca agtttactca tatatacttt agattgattt aaaacttcat ttttaattta 4440 aaaggatcta ggtgaagatc ctttttgata atctcatgac caaaatccct taacgtgagt 4500 tttcgttcca ctgagcgtca gaccccgtag aaaagatcaa aggatcttct tgagatcctt 4560 tttttctgcg cgtaatctgc tgcttgcaaa caaaaaaacc accgctacca gcggtggttt 4620 gtttgccgga tcaagagcta ccaactcttt ttccgaaggt aactggcttc agcagagcgc 4680 agataccaaa tactgtcctt ctagtgtagc cgtagttagg ccaccacttc aagaactctg 4740 tagcaccgcc tacatacctc gctctgctaa tcctgttacc agtggctgct gccagtggcg 4800 ataagtcgtg tcttaccggg ttggactcaa gacgatagtt accggataag gcgcagcggt 4860 cgggctgaac ggggggttcg tgcacacagc ccagcttgga gcgaacgacc tacaccgaac 4920 tgagatacct acagcgtgag cattgagaaa gcgccacgct tcccgaaggg agaaaggcgg 4980 acaggtatcc ggtaagcggc agggtcggaa caggagagcg cacgagggag cttccagggg 5040 ggaacgcctg gtatctttat agtcctgtcg ggtttcgcca cctctgactt gagcgtcgat 5100 ttttgtgatg ctcgtcaggg gggccgagcc tatggaaaaa cgccagcaac gcggcctttt 5160 tacggttcct ggccttttgc tggccttttg ctcacatgtt ctttcctgcg ttatcccctg 5220 attctgtgga taaccgtatt accgcctttg agtgagctga taccgctcgc cgcagccgaa 5280 cgaccgagcg cagcgagtca gtgagcgagg aagcggaaga gcgcccaata cgcaaaccgc 5340 ctctccccgc gcgttggccg attcattaat gcagctggca cgacaggttt cccgactgga 5400 aagcgggcag tgagcgcaac gcaattaatg tgagttacct cactcattag gcaccccagg 5460 ctttacactt tatgcttccg gctcctatgt tgtgtggaat tgtgagcgga taacaatttc 5520 acacaggaaa cagctatgac catgattacg ccaagctcgg aattaaccct cactaaaggg 5580 aacaaaagct ggctagt 5597 <210> 57 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> U6-HC7 hinge <400> 57 Glu Pro Lys Ser Cys Asp Cys His Cys Pro Pro Cys Pro 1 5 10 <210> 58 <211> 435 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding CDR-L3 derived from L3-1 clone <400> 58 gaattcacta gtgattaatt cgccgccacc atggattcac aggcccaggt cctcatgttg 60 ctgctgctat cggtatctgg tacctgtgga gatatccaga tgacccagtc cccgagctcc 120 ctgtccgcct ctgtgggcga tagggtcacc atcacctgca agtccagtca gagtctttta 180 gctagtggca accaaaataa ctacttggcc tggcaccaac agaaaccagg aaaagctccg 240 aaaatgctga ttatttgggc atccactagg gtatctggag tcccttctcg cttctctgga 300 tccgggtctg ggacggattt cactctgacc atcagcagtc tgcagccgga agacttcgca 360 acttattact gtcagcagtc ctacagccgc ccgtacacgt tcggacaggg taccaaggtg 420 gagatcaaac gtacg 435 <210> 59 <211> 435 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding CDR-L3 derived from L3-2 clone <400> 59 gaattcacta gtgattaatt cgccgccacc atggattcac aggcccaggt cctcatgttg 60 ctgctgctat cggtatctgg tacctgtgga gatatccaga tgacccagtc cccgagctcc 120 ctgtccgcct ctgtgggcga tagggtcacc atcacctgca agtccagtca gagtctttta 180 gctagtggca accaaaataa ctacttggcc tggcaccaac agaaaccagg aaaagctccg 240 aaaatgctga ttatttgggc atccactagg gtatctggag tcccttctcg cttctctgga 300 tccgggtctg ggacggattt cactctgacc atcagcagtc tgcagccgga agacttcgca 360 acttattact gtgggcagtc ctacagccgt ccgctcacgt tcggacaggg taccaaggtg 420 gagatcaaac gtacg 435 <210> 60 <211> 435 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding CDR-L3 derived from L3-3 clone <400> 60 gaattcacta gtgattaatt cgccgccacc atggattcac aggcccaggt cctcatgttg 60 ctgctgctat cggtatctgg tacctgtgga gatatccaga tgacccagtc cccgagctcc 120 ctgtccgcct ctgtgggcga tagggtcacc atcacctgca agtccagtca gagtctttta 180 gctagtggca accaaaataa ctacttggcc tggcaccaac agaaaccagg aaaagctccg 240 aaaatgctga ttatttgggc atccactagg gtatctggag tcccttctcg cttctctgga 300 tccgggtctg ggacggattt cactctgacc atcagcagtc tgcagccgga agacttcgca 360 acttattact gtgcacagtc ctacagccat ccgttctctt tcggacaggg taccaaggtg 420 gagatcaaac gtacg 435 <210> 61 <211> 435 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding CDR-L3 derived from L3-5 clone <400> 61 gaattcacta gtgattaatt cgccgccacc atggattcac aggcccaggt cctcatgttg 60 ctgctgctat cggtatctgg tacctgtgga gatatccaga tgacccagtc cccgagctcc 120 ctgtccgcct ctgtgggcga tagggtcacc atcacctgca agtccagtca gagtctttta 180 gctagtggca accaaaataa ctacttggcc tggcaccaac agaaaccagg aaaagctccg 240 aaaatgctga ttatttgggc atccactagg gtatctggag tcccttctcg cttctctgga 300 tccgggtctg ggacggattt cactctgacc atcagcagtc tgcagccgga agacttcgca 360 acttattact gtcagcagtc ctacagccgc ccgtttacgt tcggacaggg taccaaggtg 420 gagatcaaac gtacg 435 <210> 62 <211> 462 <212> PRT <213> Artificial Sequence <220> <223> polypeptide consisting of heavy chain of huAbF46-H4-A1, U6-HC7 hinge and constant region of human IgG1 <400> 62 Met Glu Trp Ser Trp Val Phe Leu Val Thr Leu Leu Asn Gly Ile Gln 1 5 10 15 Cys Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly 20 25 30 Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp 35 40 45 Tyr Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp 50 55 60 Leu Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser 65 70 75 80 Ala Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95 Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr 115 120 125 Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 130 135 140 Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 145 150 155 160 Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 165 170 175 Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 180 185 190 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 195 200 205 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 210 215 220 Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Cys His 225 230 235 240 Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe 245 250 255 Leu Phe Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro 260 265 270 Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val 275 280 285 Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 290 295 300 Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val 305 310 315 320 Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys 325 330 335 Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser 340 345 350 Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro 355 360 365 Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val 370 375 380 Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly 385 390 395 400 Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Val Leu Asp Ser Asp 405 410 415 Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp 420 425 430 Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His 435 440 445 Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 450 455 460 <210> 63 <211> 1410 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding polypeptide consisting of heavy chain of huAbF46-H4-A1, U6-HC7 hinge and constant region of human IgG1 <400> 63 gaattcgccg ccaccatgga atggagctgg gtttttctcg taacactttt aaatggtatc 60 cagtgtgagg ttcagctggt ggagtctggc ggtggcctgg tgcagccagg gggctcactc 120 cgtttgtcct gtgcagcttc tggcttcacc ttcactgatt actacatgag ctgggtgcgt 180 caggccccgg gtaagggcct ggaatggttg ggttttatta gaaacaaagc taatggttac 240 acaacagagt acagtgcatc tgtgaagggt cgtttcacta taagcagaga taattccaaa 300 aacacactgt acctgcagat gaacagcctg cgtgctgagg acactgccgt ctattattgt 360 gctagagata actggtttgc ttactggggc caagggactc tggtcaccgt ctcctcggct 420 agcaccaagg gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc 480 acagcggccc tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 540 aactcaggcg ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga 600 ctctactccc tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac 660 atctgcaacg tgaatcacaa gcccagcaac accaaggtgg acaagaaagt tgagcccaaa 720 agctgcgatt gccactgtcc tccatgtcca gcacctgaac tcctgggggg accgtcagtc 780 ttcctcttcc ccccaaaacc caaggacacc ctcatgatct cccggacccc tgaggtcaca 840 tgcgtggtgg tggacgtgag ccacgaagac cctgaggtca agttcaactg gtacgtggac 900 ggcgtggagg tgcataatgc caagacaaag ccgcgggagg agcagtacaa cagcacgtac 960 cgtgtggtca gcgtcctcac cgtcctgcac caggactggc tgaatggcaa ggagtacaag 1020 tgcaaggtct ccaacaaagc cctcccagcc cccatcgaga aaaccatctc caaagccaaa 1080 gggcagcccc gagaaccaca ggtgtacacc ctgcccccat cccgggagga gatgaccaag 1140 aaccaggtca gcctgacctg cctggtcaaa ggcttctatc ccagcgacat cgccgtggag 1200 tgggagagca atgggcagcc ggagaacaac tacaagacca cgcctcccgt gctggactcc 1260 gacggctcct tcttcctcta cagcaagctc accgtggaca agagcaggtg gcagcagggg 1320 aacgtcttct catgctccgt gatgcatgag gctctgcaca accactacac gcagaagagc 1380 ctctccctgt ctccgggtaa atgactcgag 1410 <210> 64 <211> 461 <212> PRT <213> Artificial Sequence <220> <223> polypeptide consisting of heavy chain of huAbF46-H4-A1, human IgG2 hinge and constant region of human IgG1 <400> 64 Met Glu Trp Ser Trp Val Phe Leu Val Thr Leu Leu Asn Gly Ile Gln 1 5 10 15 Cys Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly 20 25 30 Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp 35 40 45 Tyr Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp 50 55 60 Leu Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser 65 70 75 80 Ala Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95 Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr 115 120 125 Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 130 135 140 Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 145 150 155 160 Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 165 170 175 Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 180 185 190 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 195 200 205 Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 210 215 220 Asn Thr Lys Val Asp Lys Lys Val Glu Arg Lys Cys Cys Val Glu Cys 225 230 235 240 Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu 245 250 255 Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu 260 265 270 Val Thr Cys Val Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys 275 280 285 Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys 290 295 300 Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu 305 310 315 320 Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys 325 330 335 Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 340 345 350 Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser 355 360 365 Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys 370 375 380 Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln 385 390 395 400 Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly 405 410 415 Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln 420 425 430 Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn 435 440 445 His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 450 455 460 <210> 65 <211> 1407 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding polypeptide consisting of heavy chain of huAbF46-H4-A1, human IgG2 hinge and constant region of human IgG1 <400> 65 gaattcgccg ccaccatgga atggagctgg gtttttctcg taacactttt aaatggtatc 60 cagtgtgagg ttcagctggt ggagtctggc ggtggcctgg tgcagccagg gggctcactc 120 cgtttgtcct gtgcagcttc tggcttcacc ttcactgatt actacatgag ctgggtgcgt 180 caggccccgg gtaagggcct ggaatggttg ggttttatta gaaacaaagc taatggttac 240 acaacagagt acagtgcatc tgtgaagggt cgtttcacta taagcagaga taattccaaa 300 aacacactgt acctgcagat gaacagcctg cgtgctgagg acactgccgt ctattattgt 360 gctagagata actggtttgc ttactggggc caagggactc tggtcaccgt ctcctcggct 420 agcaccaagg gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc 480 acagcggccc tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 540 aactcaggcg ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga 600 ctctactccc tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac 660 atctgcaacg tgaatcacaa gcccagcaac accaaggtgg acaagaaagt tgagaggaag 720 tgctgtgtgg agtgcccccc ctgcccagca cctgaactcc tggggggacc gtcagtcttc 780 ctcttccccc caaaacccaa ggacaccctc atgatctccc ggacccctga ggtcacatgc 840 gtggtggtgg acgtgagcca cgaagaccct gaggtcaagt tcaactggta cgtggacggc 900 gtggaggtgc ataatgccaa gacaaagccg cgggaggagc agtacaacag cacgtaccgt 960 gtggtcagcg tcctcaccgt cctgcaccag gactggctga atggcaagga gtacaagtgc 1020 aaggtctcca acaaagccct cccagccccc atcgagaaaa ccatctccaa agccaaaggg 1080 cagccccgag aaccacaggt gtacaccctg cccccatccc gggaggagat gaccaagaac 1140 caggtcagcc tgacctgcct ggtcaaaggc ttctatccca gcgacatcgc cgtggagtgg 1200 gagagcaatg ggcagccgga gaacaactac aagaccacgc ctcccgtgct ggactccgac 1260 ggctccttct tcctctacag caagctcacc gtggacaaga gcaggtggca gcaggggaac 1320 gtcttctcat gctccgtgat gcatgaggct ctgcacaacc actacacgca gaagagcctc 1380 tccctgtctc cgggtaaatg actcgag 1407 <210> 66 <211> 460 <212> PRT <213> Artificial Sequence <220> <223> polypeptide consisting of heavy chain of huAbF46-H4-A1, human IgG2 hinge and constant region of human IgG2 <400> 66 Met Glu Trp Ser Trp Val Phe Leu Val Thr Leu Leu Asn Gly Ile Gln 1 5 10 15 Cys Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly 20 25 30 Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp 35 40 45 Tyr Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp 50 55 60 Leu Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser 65 70 75 80 Ala Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95 Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr 115 120 125 Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 130 135 140 Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly 145 150 155 160 Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn 165 170 175 Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 180 185 190 Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 195 200 205 Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser 210 215 220 Asn Thr Lys Val Asp Lys Thr Val Glu Arg Lys Cys Cys Val Glu Cys 225 230 235 240 Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser Val Phe Leu Phe 245 250 255 Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val 260 265 270 Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe 275 280 285 Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro 290 295 300 Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr 305 310 315 320 Val Val His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val 325 330 335 Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr 340 345 350 Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg 355 360 365 Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly 370 375 380 Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro 385 390 395 400 Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser 405 410 415 Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln 420 425 430 Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His 435 440 445 Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 450 455 460 <210> 67 <211> 1404 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding polypeptide consisting of heavy chain of huAbF46-H4-A1, human IgG2 hinge and constant region of human IgG2 <400> 67 gaattcgccg ccaccatgga atggagctgg gtttttctcg taacactttt aaatggtatc 60 cagtgtgagg ttcagctggt ggagtctggc ggtggcctgg tgcagccagg gggctcactc 120 cgtttgtcct gtgcagcttc tggcttcacc ttcactgatt actacatgag ctgggtgcgt 180 caggccccgg gtaagggcct ggaatggttg ggttttatta gaaacaaagc taatggttac 240 acaacagagt acagtgcatc tgtgaagggt cgtttcacta taagcagaga taattccaaa 300 aacacactgt acctgcagat gaacagcctg cgtgctgagg acactgccgt ctattattgt 360 gctagagata actggtttgc ttactggggc caagggactc tggtcaccgt ctcctcggct 420 agcaccaagg gcccatcggt cttccccctg gcgccctgct ccaggagcac ctccgagagc 480 acagcggccc tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 540 aactcaggcg ctctgaccag cggcgtgcac accttcccag ctgtcctaca gtcctcagga 600 ctctactccc tcagcagcgt ggtgaccgtg ccctccagca acttcggcac ccagacctac 660 acctgcaacg tagatcacaa gcccagcaac accaaggtgg acaagacagt tgagcgcaaa 720 tgttgtgtcg agtgcccacc gtgcccagca ccacctgtgg caggaccgtc agtcttcctc 780 ttccccccaa aacccaagga caccctcatg atctcccgga cccctgaggt cacgtgcgtg 840 gtggtggacg tgagccacga agaccccgag gtccagttca actggtacgt ggacggcgtg 900 gaggtgcata atgccaagac aaagccacgg gaggagcagt tcaacagcac gttccgtgtg 960 gtcagcgtcc tcaccgttgt gcaccaggac tggctgaacg gcaaggagta caagtgcaag 1020 gtctccaaca aaggcctccc agcccccatc gagaaaacca tctccaaaac caaagggcag 1080 ccccgagaac cacaggtgta caccctgccc ccatccggg aggagatgac caagaaccag 1140 gtcagcctga cctgcctggt caaaggcttc taccccagcg acatcgccgt ggagtgggag 1200 agcaatgggc agccggagaa caactacaag accacgcctc ccatgctgga ctccgacggc 1260 tccttcttcc tctacagcaa gctcaccgtg gacaagagca ggtggcagca ggggaacgtc 1320 ttctcatgct ccgtgatgca tgaggctctg cacaaccact acacgcagaa gagcctctcc 1380 ctgtctccgg gtaaatgact cgag 1404 <210> 68 <211> 240 <212> PRT <213> Artificial Sequence <220> <223> polypeptide consisting of light chain of huAbF46-H4-A1(H36Y) and human kappa constant region <400> 68 Met Asp Ser Gln Ala Gln Val Leu Met Leu Leu Leu Leu Leu Ser Val Ser 1 5 10 15 Gly Thr Cys Gly Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser 20 25 30 Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser 35 40 45 Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu Ala Trp Tyr Gln Gln 50 55 60 Lys Pro Gly Lys Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg 65 70 75 80 Val Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp 85 90 95 Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr 100 105 110 Tyr Cys Gln Gln Ser Tyr Ser Arg Pro Tyr Thr Phe Gly Gln Gly Thr 115 120 125 Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe 130 135 140 Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys 145 150 155 160 Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val 165 170 175 Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln 180 185 190 Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser 195 200 205 Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His 210 215 220 Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230 235 240 <210> 69 <211> 758 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding polypeptide consisting of light chain of huAbF46-H4-A1(H36Y) and human kappa constant region <400> 69 aattcactag tgattaattc gccgccacca tggattcaca ggcccaggtc ctcatgttgc 60 tgctgctatc ggtatctggt acctgtggag atatccagat gacccagtcc ccgagctccc 120 tgtccgcctc tgtgggcgat agggtcacca tcacctgcaa gtccagtcag agtcttttag 180 ctagtggcaa ccaaaataac tacttggcct ggtaccaaca gaaaccagga aaagctccga 240 aaatgctgat tatttgggca tccactaggg tatctggagt cccttctcgc ttctctggat 300 ccgggtctgg gacggatttc actctgacca tcagcagtct gcagccggaa gacttcgcaa 360 cttattactg tcagcagtcc tacagccgcc cgtacacgtt cggacagggt accaaggtgg 420 agatcaaacg tacggtggct gcaccatctg tcttcatctt cccgccatct gatgagcagt 480 tgaaatctgg aactgcctct gttgtgtgcc tgctgaataa cttctatccc agagaggcca 540 aagtacagtg gaaggtggat aacgccctcc aatcgggtaa ctcccaggag agtgtcacag 600 agcaggacag caaggacagc acctacagcc tcagcagcac cctgacgctg agcaaagcag 660 actacgagaa acacaaagtc tacgcctgcg aagtcaccca tcagggcctg agctcgcccg 720 tcacaaagag cttcaacagg ggagagtgtt gactcgag 758 <210> 70 <211> 240 <212> PRT <213> Artificial Sequence <220> <223> polypeptide consisting of light chain of huAbF46-H4-A1 and human kappa constant region <400> 70 Met Asp Ser Gln Ala Gln Val Leu Met Leu Leu Leu Leu Leu Ser Val Ser 1 5 10 15 Gly Thr Cys Gly Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser 20 25 30 Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser 35 40 45 Leu Leu Ala Ser Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln 50 55 60 Lys Pro Gly Lys Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg 65 70 75 80 Val Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp 85 90 95 Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr 100 105 110 Tyr Cys Gln Gln Ser Tyr Ser Arg Pro Tyr Thr Phe Gly Gln Gly Thr 115 120 125 Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe 130 135 140 Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys 145 150 155 160 Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val 165 170 175 Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln 180 185 190 Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser 195 200 205 Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His 210 215 220 Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230 235 240 <210> 71 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> epitope in SEMA domain of c-Met <400> 71 Phe Ser Pro Gln Ile Glu Glu Pro Ser Gln Cys Pro Asp Cys Val Val 1 5 10 15 Ser Ala Leu <210> 72 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> epitope in SEMA domain of c-Met <400> 72 Pro Gln Ile Glu Glu Pro Ser Gln Cys Pro 1 5 10 <210> 73 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> epitope in SEMA domain of c-Met <400> 73 Glu Glu Pro Ser Gln 1 5 <210> 74 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of anti-c-Met antibody (AbF46 or huAbF46-H1) <400> 74 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Ser 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 75 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti-c-Met antibody (AbF46 or huAbF46-H1) <400> 75 Asp Ile Val Met Thr Gln Ser Pro Asp Ser Leu Ala Val Ser Leu Gly 1 5 10 15 Glu Arg Ala Thr Ile Asn Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Gln 35 40 45 Pro Pro Lys Met Leu Ile Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 76 <211> 1416 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of heavy chain of anti-c-Met antibody (AbF46 or huAbF46-H1) <220> <221> misc_feature <222> (1)..(6) <223> EcoRI restriction site <220> <221> misc_feature <222> (7)..(66) <223> signal sequence <220> <221> misc_feature <222> (67)..(417) <223> VH - heavy chain variable region <220> <221> misc_feature <222> (418)..(423) <223> NdeI restriction site <220> <221> misc_feature <222> (418)..(1407) <223> CH - heavy chain constant region <220> <221> misc_feature <222> (1408)..(1410) <223> TGA - stop codon <220> <221> misc_feature <222> (1411)..(1416) <223> XhoI restriction site <400> 76 gaattcgccg ccaccatgga atggagctgg gtttttctcg taacactttt aaatggtatc 60 cagtgtgagg tgaagctggt ggagtctgga ggaggcttgg tacagcctgg gggttctctg 120 agactctcct gtgcaacttc tgggttcacc ttcactgatt actacatgag ctgggtccgc 180 cagcctccag gaaaggcact tgagtggttg ggttttatta gaaacaaagc taatggttac 240 acaacagagt acagtgcatc tgtgaagggt cggttcacca tctccagaga taattcccaa 300 agcatcctct atcttcaaat ggacaccctg agagctgagg acagtgccac ttattactgt 360 gcaagagata actggtttgc ttactggggc caagggactc tggtcactgt ctctgcagct 420 agcaccaagg gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc 480 acagcggccc tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg 540 aactcaggcg ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga 600 ctctactccc tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac 660 atctgcaacg tgaatcacaa gcccagcaac accaaggtgg acaagaaagt tgagcccaaa 720 tcttgtgaca aaactcacac atgcccaccg tgcccagcac ctgaactcct ggggggaccg 780 tcagtcttcc tcttcccccc aaaacccaag gacaccctca tgatctcccg gacccctgag 840 gtcacatgcg tggtggtgga cgtgagccac gaagaccctg aggtcaagtt caactggtac 900 gtggacggcg tggaggtgca taatgccaag acaaagccgc gggaggagca gtacaacagc 960 acgtaccgtg tggtcagcgt cctcaccgtc ctgcaccagg actggctgaa tggcaaggag 1020 tacaagtgca aggtctccaa caaagccctc ccagccccca tcgagaaaac catctccaaa 1080 gccaaagggc agccccgaga accacaggtg tacaccctgc ccccatcccg ggaggagatg 1140 accaagaacc aggtcagcct gacctgcctg gtcaaaggct tctatcccag cgacatcgcc 1200 gtggagtggg agagcaatgg gcagccggag aacaactaca agaccacgcc tcccgtgctg 1260 gactccgacg gctccttctt cctctacagc aagctcaccg tggacaagag caggtggcag 1320 caggggaacg tcttctcatg ctccgtgatg catgaggctc tgcacaacca ctacacgcag 1380 aagagcctct ccctgtctcc gggtaaatga ctcgag 1416 <210> 77 <211> 759 <212> DNA <213> Artificial Sequence <220> <223> nucleotide sequence of light chain of anti-c-Met antibody (AbF46 or huAbF46-H1) <220> <221> misc_difference <222> (1)..(6) <223> EcoRI restriction site <220> <221> misc_difference <222> (7)..(90) <223> signal sequence <220> <221> misc_difference <222> (91)..(432) <223> VL - light chain variable region <220> <221> misc_difference <222> (430)..(435) <223> BsiWI restriction site <220> <221> misc_difference <222> (433)..(750) <223> CL - light chain constant region <220> <221> misc_difference <222> (751)..(753) <223> stop codon <220> <221> misc_difference <222> (754)..(759) <223> XhoI restriction site <400> 77 gaattcacta gtgattaatt cgccgccacc atggattcac aggcccaggt cctcatgttg 60 ctgctgctat cggtatctgg tacctgtgga gacattttga tgacccagtc tccatcctcc 120 ctgactgtgt cagcaggaga gaaggtcact atgagctgca agtccagtca gagtctttta 180 gctagtggca accaaaataa ctacttggcc tggcaccagc agaaaccagg acgatctcct 240 aaaatgctga taatttgggc atccactagg gtatctggag tccctgatcg cttcataggc 300 agtggatctg ggacggattt cactctgacc atcaacagtg tgcaggctga agatctggct 360 gtttattact gtcagcagtc ctacagcgct ccgctcacgt tcggtgctgg gaccaagctg 420 gagctgaaac gtacggtggc tgcaccatct gtcttcatct tcccgccatc tgatgagcag 480 ttgaaatctg gaactgcctc tgttgtgtgc ctgctgaata acttctatcc cagagaggcc 540 aaagtacagt ggaaggtgga taacgccctc caatcgggta actcccagga gagtgtcaca 600 gagcaggaca gcaaggacag cacctacagc ctcagcagca ccctgacgct gagcaaagca 660 gactacgaga aacacaaagt ctacgcctgc gaagtcaccc atcagggcct gagctcgccc 720 gtcacaaaga gcttcaacag gggagagtgt tgactcgag 759 <210> 78 <211> 4170 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding c-Met protein <400> 78 atgaaggccc ccgctgtgct tgcacctggc atcctcgtgc tcctgtttac cttggtgcag 60 aggagcaatg gggagtgtaa agaggcacta gcaaagtccg agatgaatgt gaatatgaag 120 tatcagcttc ccaacttcac cgcggaaaca cccatccaga atgtcattct acatgagcat 180 cacatttcc ttggtgccac taactacatt tatgttttaa atgaggaaga ccttcagaag 240 gttgctgagt acaagactgg gcctgtgctg gaacacccag attgtttccc atgtcaggac 300 tgcagcagca aagccaattt atcaggaggt gtttggaaag ataacatcaa catggctcta 360 gttgtcgaca cctactatga tgatcaactc attagctgtg gcagcgtcaa cagagggacc 420 tgccagcgac atgtctttcc ccacaatcat actgctgaca tacagtcgga ggttcactgc 480 atattctccc cacagataga agagcccagc cagtgtcctg actgtgtggt gagcgccctg 540 ggagccaaag tcctttcatc tgtaaaggac cggttcatca acttctttgt aggcaatacc 600 ataaattctt cttatttccc agatcatcca ttgcattcga tatcagtgag aaggctaaag 660 gaaacgaaag atggttttat gtttttgacg gaccagtcct acattgatgt tttacctgag 720 ttcagagatt cttaccccat taagtatgtc catgcctttg aaagcaacaa ttttatttac 780 ttcttgacgg tccaaaggga aactctagat gctcagactt ttcacacaag aataatcagg 840 ttctgttcca taaactctgg attgcattcc tacatggaaa tgcctctgga gtgtattctc 900 acagaaaaga gaaaaaagag atccacaaag aaggaagtgt ttaatatact tcaggctgcg 960 tatgtcagca agcctggggc ccagcttgct agacaaatag gagccagcct gaatgatgac 1020 attcttttcg gggtgttcgc acaaagcaag ccagattctg ccgaaccaat ggatcgatct 1080 gccatgtgtg cattccctat caaatatgtc aacgacttct tcaacaagat cgtcaacaaa 1140 aacaatgtga gatgtctcca gcatttttac ggacccaatc atgagcactg ctttaatagg 1200 acacttctga gaaattcatc aggctgtgaa gcgcgccgtg atgaatatcg aacagagttt 1260 accacagctt tgcagcgcgt tgacttattc atgggtcaat tcagcgaagt cctcttaaca 1320 tctatatcca ccttcattaa aggagacctc accatagcta atcttgggac atcagagggt 1380 cgcttcatgc aggttgtggt ttctcgatca ggaccatcaa cccctcatgt gaattttctc 1440 ctggactccc atccagtgtc tccagaagtg attgtggagc atacattaaa ccaaaatggc 1500 tacacactgg ttatcactgg gaagaagatc acgaagatcc cattgaatgg cttgggctgc 1560 agacatttcc agtcctgcag tcaatgcctc tctgccccac cctttgttca gtgtggctgg 1620 tgccacgaca aatgtgtgcg atcggaggaa tgcctgagcg ggacatggac tcaacagatc 1680 tgtctgcctg caatctacaa ggttttccca aatagtgcac cccttgaagg agggacaagg 1740 ctgaccatat gtggctggga ctttggattt cggaggaata ataaatttga tttaaagaaa 1800 actagagttc tccttggaaa tgagagctgc accttgactt taagtgagag cacgatgaat 1860 acattgaaat gcacagttgg tcctgccatg aataagcatt tcaatatgtc cataattatt 1920 tcaaatggcc acgggacaac acaatacagt acatctcct atgtggatcc tgtaataaca 1980 agtatttcgc cgaaatacgg tcctatggct ggtggcactt tacttacttt aactggaaat 2040 tacctaaaca gtgggaattc tagacacatt tcaattggtg gaaaaacatg tactttaaaa 2100 agtgtgtcaa acagtattct tgaatgttat accccagccc aaaccatttc aactgagttt 2160 gctgttaaat tgaaaattga cttagccaac cgagagacaa gcatcttcag ttaccgtgaa 2220 gatcccattg tctatgaaat tcatccaacc aaatctttta ttagtggtgg gagcacaata 2280 acaggtgttg ggaaaaacct gaattcagtt agtgtcccga gaatggtcat aaatgtgcat 2340 gaagcaggaa ggaactttac agtggcatgt caacatcgct ctaattcaga gataatctgt 2400 tgtaccactc cttccctgca acagctgaat ctgcaactcc ccctgaaaac caaagccttt 2460 ttcatgttag atgggatcct ttccaaatac tttgatctca tttatgtaca taatcctgtg 2520 tttaagcctt ttgaaaagcc agtgatgatc tcaatgggca atgaaaatgt actggaaatt 2580 aagggaaatg atattgaccc tgaagcagtt aaaggtgaag tgttaaaagt tggaaataag 2640 agctgtgaga atatacactt acattctgaa gccgttttat gcacggtccc caatgacctg 2700 ctgaaattga acagcgagct aaatatagag tggaagcaag caatttcttc aaccgtcctt 2760 ggaaaagtaa tagttcaacc agatcagaat ttcacaggat tgattgctgg tgttgtctca 2820 atatcaacag cactgttatt actacttggg tttttcctgt ggctgaaaaa gagaaagcaa 2880 attaaagatc tgggcagtga attagttcgc tacgatgcaa gagtacacac tcctcatttg 2940 gataggcttg taagtgcccg aagtgtaagc ccaactacag aaatggtttc aaatgaatct 3000 gtagactacc gagctacttt tccagaagat cagtttccta attcatctca gaacggttca 3060 tgccgacaag tgcagtatcc tctgacagac atgtccccca tcctaactag tggggactct 3120 gatatatcca gtccattact gcaaaatact gtccacattg acctcagtgc tctaaatcca 3180 gagctggtcc aggcagtgca gcatgtagtg attgggccca gtagcctgat tgtgcatttc 3240 aatgaagtca taggaagagg gcattttggt tgtgtatatc atgggacttt gttggacaat 3300 gatggcaaga aaattcactg tgctgtgaaa tccttgaaca gaatcactga cataggagaa 3360 gtttcccaat ttctgaccga gggaatcatc atgaaagatt ttagtcatcc caatgtcctc 3420 tcgctcctgg gaatctgcct gcgaagtgaa gggtctccgc tggtggtcct accatacatg 3480 aaacatggag atcttcgaaa tttcattcga aatgagactc ataatccaac tgtaaaagat 3540 cttattggct ttggtcttca agtagccaaa ggcatgaaat atcttgcaag caaaaagttt 3600 gtccacagag acttggctgc aagaaactgt atgctggatg aaaaattcac agtcaaggtt 3660 gctgattttg gtcttgccag agacatgtat gataaagaat actatagtgt acacaacaaa 3720 acaggtgcaa agctgccagt gaagtggatg gctttggaaa gtctgcaaac tcaaaagttt 3780 accaccaagt cagatgtgtg gtcctttggc gtgctcctct gggagctgat gacaagagga 3840 gccccacctt atcctgacgt aaacaccttt gatataactg tttacttgtt gcaagggaga 3900 agactcctac aacccgaata ctgcccagac cccttatatg aagtaatgct aaaatgctgg 3960 caccctaaag ccgaaatgcg cccatccttt tctgaactgg tgtcccggat atcagcgatc 4020 ttctctactt tcattgggga gcactatgtc catgtgaacg ctacttatgt gaacgtaaaa 4080 tgtgtcgctc cgtatccttc tctgttgtca tcagaagata acgctgatga tgaggtggac 4140 acacgaccag cctccttctg ggagacatca 4170 <210> 79 <211> 444 <212> PRT <213> Artificial Sequence <220> <223> SEMA domain of c-Met <400> 79 Leu His Glu His His Ile Phe Leu Gly Ala Thr Asn Tyr Ile Tyr Val 1 5 10 15 Leu Asn Glu Glu Asp Leu Gln Lys Val Ala Glu Tyr Lys Thr Gly Pro 20 25 30 Val Leu Glu His Pro Asp Cys Phe Pro Cys Gln Asp Cys Ser Ser Lys 35 40 45 Ala Asn Leu Ser Gly Gly Val Trp Lys Asp Asn Ile Asn Met Ala Leu 50 55 60 Val Val Asp Thr Tyr Tyr Asp Asp Gln Leu Ile Ser Cys Gly Ser Val 65 70 75 80 Asn Arg Gly Thr Cys Gln Arg His Val Phe Pro His Asn His Thr Ala 85 90 95 Asp Ile Gln Ser Glu Val His Cys Ile Phe Ser Pro Gln Ile Glu Glu 100 105 110 Pro Ser Gln Cys Pro Asp Cys Val Val Ser Ala Leu Gly Ala Lys Val 115 120 125 Leu Ser Ser Val Lys Asp Arg Phe Ile Asn Phe Phe Val Gly Asn Thr 130 135 140 Ile Asn Ser Ser Tyr Phe Pro Asp His Pro Leu His Ser Ile Ser Val 145 150 155 160 Arg Arg Leu Lys Glu Thr Lys Asp Gly Phe Met Phe Leu Thr Asp Gln 165 170 175 Ser Tyr Ile Asp Val Leu Pro Glu Phe Arg Asp Ser Tyr Pro Ile Lys 180 185 190 Tyr Val His Ala Phe Glu Ser Asn Asn Phe Ile Tyr Phe Leu Thr Val 195 200 205 Gln Arg Glu Thr Leu Asp Ala Gln Thr Phe His Thr Arg Ile Ile Arg 210 215 220 Phe Cys Ser Ile Asn Ser Gly Leu His Ser Tyr Met Glu Met Pro Leu 225 230 235 240 Glu Cys Ile Leu Thr Glu Lys Arg Lys Lys Arg Ser Thr Lys Lys Glu 245 250 255 Val Phe Asn Ile Leu Gln Ala Ala Tyr Val Ser Lys Pro Gly Ala Gln 260 265 270 Leu Ala Arg Gln Ile Gly Ala Ser Leu Asn Asp Asp Ile Leu Phe Gly 275 280 285 Val Phe Ala Gln Ser Lys Pro Asp Ser Ala Glu Pro Met Asp Arg Ser 290 295 300 Ala Met Cys Ala Phe Pro Ile Lys Tyr Val Asn Asp Phe Phe Asn Lys 305 310 315 320 Ile Val Asn Lys Asn Asn Val Arg Cys Leu Gln His Phe Tyr Gly Pro 325 330 335 Asn His Glu His Cys Phe Asn Arg Thr Leu Leu Arg Asn Ser Ser Gly 340 345 350 Cys Glu Ala Arg Arg Asp Glu Tyr Arg Thr Glu Phe Thr Thr Ala Leu 355 360 365 Gln Arg Val Asp Leu Phe Met Gly Gln Phe Ser Glu Val Leu Leu Thr 370 375 380 Ser Ile Ser Thr Phe Ile Lys Gly Asp Leu Thr Ile Ala Asn Leu Gly 385 390 395 400 Thr Ser Glu Gly Arg Phe Met Gln Val Val Val Ser Arg Ser Gly Pro 405 410 415 Ser Thr Pro His Val Asn Phe Leu Leu Asp Ser His Pro Val Ser Pro 420 425 430 Glu Val Ile Val Glu His Thr Leu Asn Gln Asn Gly 435 440 <210> 80 <211> 451 <212> PRT <213> Artificial Sequence <220> <223> PSI-IPT domain of c-Met <400> 80 Tyr Thr Leu Val Ile Thr Gly Lys Lys Ile Thr Lys Ile Pro Leu Asn 1 5 10 15 Gly Leu Gly Cys Arg His Phe Gln Ser Cys Ser Gln Cys Leu Ser Ala 20 25 30 Pro Pro Phe Val Gln Cys Gly Trp Cys His Asp Lys Cys Val Arg Ser 35 40 45 Glu Glu Cys Leu Ser Gly Thr Trp Thr Gln Gln Ile Cys Leu Pro Ala 50 55 60 Ile Tyr Lys Val Phe Pro Asn Ser Ala Pro Leu Glu Gly Gly Thr Arg 65 70 75 80 Leu Thr Ile Cys Gly Trp Asp Phe Gly Phe Arg Arg Asn Asn Lys Phe 85 90 95 Asp Leu Lys Lys Thr Arg Val Leu Leu Gly Asn Glu Ser Cys Thr Leu 100 105 110 Thr Leu Ser Glu Ser Thr Met Asn Thr Leu Lys Cys Thr Val Gly Pro 115 120 125 Ala Met Asn Lys His Phe Asn Met Ser Ile Ile Ile Ile Ser Asn Gly His 130 135 140 Gly Thr Thr Gln Tyr Ser Thr Phe Ser Tyr Val Asp Pro Val Ile Thr 145 150 155 160 Ser Ile Ser Pro Lys Tyr Gly Pro Met Ala Gly Gly Thr Leu Leu Thr 165 170 175 Leu Thr Gly Asn Tyr Leu Asn Ser Gly Asn Ser Arg His Ile Ser Ile 180 185 190 Gly Gly Lys Thr Cys Thr Leu Lys Ser Val Ser Asn Ser Ile Leu Glu 195 200 205 Cys Tyr Thr Pro Ala Gln Thr Ile Ser Thr Glu Phe Ala Val Lys Leu 210 215 220 Lys Ile Asp Leu Ala Asn Arg Glu Thr Ser Ile Phe Ser Tyr Arg Glu 225 230 235 240 Asp Pro Ile Val Tyr Glu Ile His Pro Thr Lys Ser Phe Ile Ser Thr 245 250 255 Trp Trp Lys Glu Pro Leu Asn Ile Val Ser Phe Leu Phe Cys Phe Ala 260 265 270 Ser Gly Gly Ser Thr Ile Thr Gly Val Gly Lys Asn Leu Asn Ser Val 275 280 285 Ser Val Pro Arg Met Val Ile Asn Val His Glu Ala Gly Arg Asn Phe 290 295 300 Thr Val Ala Cys Gln His Arg Ser Asn Ser Glu Ile Ile Cys Cys Thr 305 310 315 320 Thr Pro Ser Leu Gln Gln Leu Asn Leu Gln Leu Pro Leu Lys Thr Lys 325 330 335 Ala Phe Phe Met Leu Asp Gly Ile Leu Ser Lys Tyr Phe Asp Leu Ile 340 345 350 Tyr Val His Asn Pro Val Phe Lys Pro Phe Glu Lys Pro Val Met Ile 355 360 365 Ser Met Gly Asn Glu Asn Val Leu Glu Ile Lys Gly Asn Asp Ile Asp 370 375 380 Pro Glu Ala Val Lys Gly Glu Val Leu Lys Val Gly Asn Lys Ser Cys 385 390 395 400 Glu Asn Ile His Leu His Ser Glu Ala Val Leu Cys Thr Val Pro Asn 405 410 415 Asp Leu Leu Lys Leu Asn Ser Glu Leu Asn Ile Glu Trp Lys Gln Ala 420 425 430 Ile Ser Ser Thr Val Leu Gly Lys Val Ile Val Gln Pro Asp Gln Asn 435 440 445 Phe Thr Gly 450 <210> 81 <211> 313 <212> PRT <213> Artificial Sequence <220> <223> TyrKc domain of c-Met <400> 81 Val His Phe Asn Glu Val Ile Gly Arg Gly His Phe Gly Cys Val Tyr 1 5 10 15 His Gly Thr Leu Leu Asp Asn Asp Gly Lys Lys Ile His Cys Ala Val 20 25 30 Lys Ser Leu Asn Arg Ile Thr Asp Ile Gly Glu Val Ser Gln Phe Leu 35 40 45 Thr Glu Gly Ile Ile Met Lys Asp Phe Ser His Pro Asn Val Leu Ser 50 55 60 Leu Leu Gly Ile Cys Leu Arg Ser Glu Gly Ser Pro Leu Val Val Leu 65 70 75 80 Pro Tyr Met Lys His Gly Asp Leu Arg Asn Phe Ile Arg Asn Glu Thr 85 90 95 His Asn Pro Thr Val Lys Asp Leu Ile Gly Phe Gly Leu Gln Val Ala 100 105 110 Lys Gly Met Lys Tyr Leu Ala Ser Lys Lys Phe Val His Arg Asp Leu 115 120 125 Ala Ala Arg Asn Cys Met Leu Asp Glu Lys Phe Thr Val Lys Val Ala 130 135 140 Asp Phe Gly Leu Ala Arg Asp Met Tyr Asp Lys Glu Tyr Tyr Ser Val 145 150 155 160 His Asn Lys Thr Gly Ala Lys Leu Pro Val Lys Trp Met Ala Leu Glu 165 170 175 Ser Leu Gln Thr Gln Lys Phe Thr Thr Lys Ser Asp Val Trp Ser Phe 180 185 190 Gly Val Leu Leu Trp Glu Leu Met Thr Arg Gly Ala Pro Pro Tyr Pro 195 200 205 Asp Val Asn Thr Phe Asp Ile Thr Val Tyr Leu Leu Gln Gly Arg Arg 210 215 220 Leu Leu Gln Pro Glu Tyr Cys Pro Asp Pro Leu Tyr Glu Val Met Leu 225 230 235 240 Lys Cys Trp His Pro Lys Ala Glu Met Arg Pro Ser Phe Ser Glu Leu 245 250 255 Val Ser Arg Ile Ser Ala Ile Phe Ser Thr Phe Ile Gly Glu His Tyr 260 265 270 Val His Val Asn Ala Thr Tyr Val Asn Val Lys Cys Val Ala Pro Tyr 275 280 285 Pro Ser Leu Leu Ser Ser Glu Asp Asn Ala Asp Asp Glu Val Asp Thr 290 295 300 Arg Pro Ala Ser Phe Trp Glu Thr Ser 305 310 <210> 82 <211> 1332 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding SEMA domain of c-Met <400> 82 ctacatgagc atcacatttt ccttggtgcc actaactaca tttatgtttt aaatgaggaa 60 gaccttcaga aggttgctga gtacaagact gggcctgtgc tggaacaccc agattgtttc 120 ccatgtcagg actgcagcag caaagccaat ttatcaggag gtgtttggaa agataacatc 180 aacatggctc tagttgtcga cacctactat gatgatcaac tcattagctg tggcagcgtc 240 aacagaggga cctgccagcg acatgtcttt ccccacaatc atactgctga catacagtcg 300 gaggttcact gcatattctc cccacagata gaagagccca gccagtgtcc tgactgtgtg 360 gtgagcgccc tgggagccaa agtcctttca tctgtaaagg accggttcat caacttcttt 420 gtaggcaata ccataaattc ttcttatttc ccagatcatc cattgcattc gatatcagtg 480 agaaggctaa aggaaacgaa agatggtttt atgtttttga cggaccagtc ctacattgat 540 gttttacctg agttcagaga ttcttacccc attaagtatg tccatgcctt tgaaagcaac 600 aattttattt acttcttgac ggtccaaagg gaaactctag atgctcagac ttttcacaca 660 agaataatca ggttctgttc cataaactct ggattgcatt cctacatgga aatgcctctg 720 gagtgtattc tcacagaaaa gagaaaaaag agatccacaa agaaggaagt gtttaatata 780 cttcaggctg cgtatgtcag caagcctggg gcccagcttg ctagacaaat aggagccagc 840 ctgaatgatg acattctttt cggggtgttc gcacaaagca agccagattc tgccgaacca 900 atggatcgat ctgccatgtg tgcattccct atcaaatatg tcaacgactt cttcaacaag 960 atcgtcaaca aaaacaatgt gagatgtctc cagcattttt acggacccaa tcatgagcac 1020 tgctttaata ggacacttct gagaaattca tcaggctgtg aagcgcgccg tgatgaatat 1080 cgaacagagt ttaccacagc tttgcagcgc gttgacttat tcatgggtca attcagcgaa 1140 gtcctcttaa catctatatc caccttcatt aaaggagacc tcaccatagc taatcttggg 1200 acatcagagg gtcgcttcat gcaggttgtg gtttctcgat caggaccatc aacccctcat 1260 gtgaattttc tcctggactc ccatccagtg tctccagaag tgattgtgga gcatacatta 1320 aaccaaaatg gc 1332 <210> 83 <211> 1299 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding PSI-IPT domain of c-Met <400> 83 tacacactgg ttatcactgg gaagaagatc acgaagatcc cattgaatgg cttgggctgc 60 agacatttcc agtcctgcag tcaatgcctc tctgccccac cctttgttca gtgtggctgg 120 tgccacgaca aatgtgtgcg atcggaggaa tgcctgagcg ggacatggac tcaacagatc 180 tgtctgcctg caatctacaa ggttttccca aatagtgcac cccttgaagg agggacaagg 240 ctgaccatat gtggctggga ctttggattt cggaggaata ataaatttga tttaaagaaa 300 actagagttc tccttggaaa tgagagctgc accttgactt taagtgagag cacgatgaat 360 acattgaaat gcacagttgg tcctgccatg aataagcatt tcaatatgtc cataattatt 420 tcaaatggcc acgggacaac acaatacagt acatctcct atgtggatcc tgtaataaca 480 agtatttcgc cgaaatacgg tcctatggct ggtggcactt tacttacttt aactggaaat 540 tacctaaaca gtgggaattc tagacacatt tcaattggtg gaaaaacatg tactttaaaa 600 agtgtgtcaa acagtattct tgaatgttat accccagccc aaaccatttc aactgagttt 660 gctgttaaat tgaaaattga cttagccaac cgagagacaa gcatcttcag ttaccgtgaa 720 gatcccattg tctatgaaat tcatccaacc aaatctttta ttagtggtgg gagcacaata 780 acaggtgttg ggaaaaacct gaattcagtt agtgtcccga gaatggtcat aaatgtgcat 840 gaagcaggaa ggaactttac agtggcatgt caacatcgct ctaattcaga gataatctgt 900 tgtaccactc cttccctgca acagctgaat ctgcaactcc ccctgaaaac caaagccttt 960 ttcatgttag atgggatcct ttccaaatac tttgatctca tttatgtaca taatcctgtg 1020 tttaagcctt ttgaaaagcc agtgatgatc tcaatgggca atgaaaatgt actggaaatt 1080 aagggaaatg atattgaccc tgaagcagtt aaaggtgaag tgttaaaagt tggaaataag 1140 agctgtgaga atatacactt acattctgaa gccgttttat gcacggtccc caatgacctg 1200 ctgaaattga acagcgagct aaatatagag tggaagcaag caatttcttc aaccgtcctt 1260 ggaaaagtaa tagttcaacc agatcagaat ttcacagga 1299 <210> 84 <211> 939 <212> DNA <213> Artificial Sequence <220> <223> polynucleotide encoding TyrKc domain of c-Met <400> 84 gtgcatttca atgaagtcat aggaagaggg cattttggtt gtgtatatca tgggactttg 60 ttggacaatg atggcaagaa aattcactgt gctgtgaaat ccttgaacag aatcactgac 120 ataggagaag tttcccaatt tctgaccgag ggaatcatca tgaaagattt tagtcatccc 180 aatgtcctct cgctcctggg aatctgcctg cgaagtgaag ggtctccgct ggtggtccta 240 ccatacatga aacatggaga tcttcgaaat ttcattcgaa atgagactca taatccaact 300 gtaaaagatc ttattggctt tggtcttcaa gtagccaaag gcatgaaata tcttgcaagc 360 aaaaagtttg tccacagaga cttggctgca agaaactgta tgctggatga aaaattcaca 420 gtcaaggttg ctgattttgg tcttgccaga gacatgtatg ataaagaata ctatagtgta 480 cacaacaaaa caggtgcaaa gctgccagtg aagtggatgg ctttggaaag tctgcaaact 540 caaaagttta ccaccaagtc agatgtgtgg tcctttggcg tgctcctctg ggagctgatg 600 acaagaggag ccccacctta tcctgacgta aacacctttg atataactgt ttacttgttg 660 caagggagaa gactcctaca acccgaatac tgcccagacc ccttatatga agtaatgcta 720 aaatgctggc accctaaagc cgaaatgcgc ccatcctttt ctgaactggt gtccccggata 780 tcagcgatct tctctacttt cattggggag cactatgtcc atgtgaacgc tacttatgtg 840 aacgtaaaat gtgtcgctcc gtatccttct ctgttgtcat cagaagataa cgctgatgat 900 gagtggaca cacgaccagc ctccttctgg gagacatca 939 <210> 85 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> heavy chain CDR3 of anti-c-Met antibody <400> 85 Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val 1 5 10 <210> 86 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR3 of anti-c-Met antibody <400> 86 Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu 1 5 10 <210> 87 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of monoclonal antibody AbF46 <400> 87 Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Pro Pro Gly Lys Ala Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Gln Ser Ile 65 70 75 80 Leu Tyr Leu Gln Met Asp Thr Leu Arg Ala Glu Asp Ser Ala Thr Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ala 115 <210> 88 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti-c-Met antibody <400> 88 Asp Ile Leu Met Thr Gln Ser Pro Ser Ser Leu Thr Val Ser Ala Gly 1 5 10 15 Glu Lys Val Thr Met Ser Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Arg 35 40 45 Ser Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ile Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Asn Ser Val Gln Ala Glu Asp Leu Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu 100 105 110 Lys Arg <210> 89 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> light chain CDR3 of anti-c-Met antibody <400> 89 Gln Gln Ser Tyr Ser Ala Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu 1 5 10 15 Glu <210> 90 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of AT-VH1 <400> 90 Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Ser Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Ser Ala Thr Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 91 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of AT-VH2 <400> 91 Glu Val Lys Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Ser Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Thr Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 92 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of AT-VH3 <400> 92 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Ser Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Thr Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 93 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of AT-VH4 <400> 93 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Thr Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 94 <211> 117 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of AT-VH5 <400> 94 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Thr Ser Gly Phe Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Ser Trp Val Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Leu 35 40 45 Gly Phe Ile Arg Asn Lys Ala Asn Gly Tyr Thr Thr Glu Tyr Ser Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr 65 70 75 80 Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Ala Arg Asp Asn Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115 <210> 95 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti c-Met humanized antibody (huAbF46-H4) <400> 95 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 96 <211> 113 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of AT-Vk1 <400> 96 Asp Ile Leu Met Thr Gln Ser Pro Ser Ser Leu Thr Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Met Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ile Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gin Gly Thr Lys Leu Glu Ile 100 105 110 Lys <210> 97 <211> 113 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of AT-Vk2 <400> 97 Asp Ile Leu Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ile Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gin Gly Thr Lys Leu Glu Ile 100 105 110 Lys <210> 98 <211> 113 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of AT-Vk3 <400> 98 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ile Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gin Gly Thr Lys Leu Glu Ile 100 105 110 Lys <210> 99 <211> 113 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of AT-Vk4 <400> 99 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp His Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Ala Pro Leu Thr Phe Gly Gin Gly Thr Lys Leu Glu Ile 100 105 110 Lys <210> 100 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> modified hinge region (U7-HC6) <400> 100 Glu Pro Ser Cys Asp Lys His Cys Cys Pro Pro Cys Pro 1 5 10 <210> 101 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> modified hinge region (U6-HC7) <400> 101 Glu Pro Lys Ser Cys Asp Cys His Cys Pro Pro Cys Pro 1 5 10 <210> 102 <211> 12 <212> PRT <213> Artificial Sequence <220> <223> modified hinge region (U3-HC9) <400> 102 Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro 1 5 10 <210> 103 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> modified hinge region (U6-HC8) <400> 103 Glu Pro Arg Asp Cys Gly Cys Lys Pro Cys Pro Pro Cys Pro 1 5 10 <210> 104 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> modified hinge region (U8-HC5) <400> 104 Glu Lys Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 1 5 10 <210> 105 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> human hinge region <400> 105 Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro 1 5 10 15 <210> 106 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 of antibody L3-11Y <400> 106 Lys Ser Ser Gln Ser Leu Leu Ala Trp Gly Asn Gln Asn Asn Tyr Leu 1 5 10 15 Ala <210> 107 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of light chain variable region of antibody L3-11Y <400> 107 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Trp 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Arg Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg <210> 108 <211> 220 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of light chain of antibody L3-11Y <400> 108 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Trp 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Arg Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp 115 120 125 Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn 130 135 140 Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu 145 150 155 160 Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp 165 170 175 Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr 180 185 190 Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser 195 200 205 Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 210 215 220 <210> 109 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H1 of anti-HER2 antibody <400> 109 Ser Tyr Trp Ile Gly 1 5 <210> 110 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H1 of anti-HER2 antibody <400> 110 Asp Tyr Ala Met Ser 1 5 <210> 111 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H1 of anti-HER2 antibody <400> 111 Ser Tyr Ala Ile Ser 1 5 <210> 112 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H2 of anti-HER2 antibody <400> 112 Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe Gln 1 5 10 15 Gly <210> 113 <211> 19 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H2 of anti-HER2 antibody <400> 113 Phe Ile Arg Ser Lys Ala Tyr Gly Gly Thr Thr Glu Tyr Ala Ala Ser 1 5 10 15 Val Lys Gly <210> 114 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H2 of anti-HER2 antibody <400> 114 Gly Ile Ile Pro Ile Phe Gly Thr Ala Asn Tyr Ala Gln Lys Phe Gln 1 5 10 15 Gly <210> 115 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H3 of anti-HER2 antibody <400> 115 Arg His Tyr Tyr Asp Ser Ser Gly Tyr Ser Tyr Phe Pro Asp Tyr 1 5 10 15 <210> 116 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H3 of anti-HER2 antibody <400> 116 Arg Leu Ser Val Ala Ala Ala Gly Thr Gly Gly Tyr Asn Trp Phe Asp 1 5 10 15 Pro <210> 117 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H3 of anti-HER2 antibody <400> 117 Arg Asp Leu Tyr Pro Ala Met Ala Glu Tyr 1 5 10 <210> 118 <211> 20 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H3 of anti-HER2 antibody <400> 118 Arg Asp Ser Gly Tyr Ser Tyr Gly Tyr Pro Met Asn Tyr Tyr Tyr Tyr 1 5 10 15 Tyr Met Asp Val 20 <210> 119 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-H3 of anti-HER2 antibody <400> 119 Arg Leu Val Val Gly Ala Asn Pro Pro Thr Tyr Tyr Phe Asp Tyr 1 5 10 15 <210> 120 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L1 of anti-HER2 antibody <400> 120 Gly Leu Ser Ser Gly Ser Val Ser Thr Ser Tyr Tyr Pro Ser 1 5 10 <210> 121 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L1 of anti-HER2 antibody <400> 121 Gly Leu Thr Ser Gly Ser Val Ser Thr Ser Tyr Tyr Pro Ser 1 5 10 <210> 122 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L1 of anti-HER2 antibody <400> 122 Thr Arg Ser Ser Gly Ser Ile Asp Ser Asn Phe Val Gln 1 5 10 <210> 123 <211> 14 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L1 of anti-HER2 antibody <400> 123 Gly Leu Ser Ser Gly Ser Val Ser Pro Thr Tyr Tyr Pro Ser 1 5 10 <210> 124 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L2 of anti-HER2 antibody <400> 124 Ser Thr Asn Thr Arg Ser Ser Gly Val Pro Asp 1 5 10 <210> 125 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L2 of anti-HER2 antibody <400> 125 Asp Asp Asn Gln Arg Pro Ser Gly Val Pro Asp 1 5 10 <210> 126 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L2 of anti-HER2 antibody <400> 126 Arg Thr Asn Ile Arg Ser Ser Gly Val Pro Asp 1 5 10 <210> 127 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L3 of anti-HER2 antibody <400> 127 Val Leu Tyr Met Gly Ser Gly Ile Trp Val 1 5 10 <210> 128 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L3 of anti-HER2 antibody <400> 128 Met Leu Tyr Leu Gly Gly Gly Ile Ser Val 1 5 10 <210> 129 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L3 of anti-HER2 antibody <400> 129 Gln Ser Tyr Asp Ser Asn Asn Gln Val 1 5 <210> 130 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L3 of anti-HER2 antibody <400> 130 Leu Leu Tyr Met Gly Ser Gly Val Ser Leu 1 5 10 <210> 131 <211> 10 <212> PRT <213> Artificial Sequence <220> <223> Polynucleotide used for CDR-L3 of anti-HER2 antibody <400> 131 Val Leu Tyr Met Gly Ser Gly Ile Ser Leu 1 5 10 <210> 132 <211> 123 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of heavy chain variable region of anti-HER2 antibody 41-B11 <400> 132 Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Glu 1 5 10 15 Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr Ser Tyr 20 25 30 Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met 35 40 45 Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe 50 55 60 Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80 Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Met Tyr Tyr Cys 85 90 95 Ala Arg His Tyr Tyr Asp Ser Ser Gly Tyr Ser Tyr Phe Pro Asp Tyr 100 105 110 Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 <210> 133 <211> 125 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of heavy chain variable region of anti-HER2 antibody 41-C6 <400> 133 Gln Ile Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Glu 1 5 10 15 Ser Leu Lys Ile Ser Cys Arg Gly Ser Gly Tyr Ser Phe Thr Ser Tyr 20 25 30 Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met 35 40 45 Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe 50 55 60 Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80 Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Met Tyr Tyr Cys 85 90 95 Ala Arg Leu Ser Val Ala Ala Ala Gly Thr Gly Gly Tyr Asn Trp Phe 100 105 110 Asp Pro Trp Gly Gin Gly Thr Leu Val Thr Val Ser Ser 115 120 125 <210> 134 <211> 120 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of heavy chain variable region of anti-HER2 antibody 41-E1 <400> 134 Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Phe Thr Phe Gly Asp Tyr 20 25 30 Ala Met Ser Trp Phe Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Gly Phe Ile Arg Ser Lys Ala Tyr Gly Gly Thr Thr Glu Tyr Ala Ala 50 55 60 Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asp Ser Lys Ser Ile 65 70 75 80 Ala Tyr Leu Gln Met Asn Ser Leu Lys Thr Glu Asp Thr Ala Val Tyr 85 90 95 Tyr Cys Thr Arg Asp Leu Tyr Pro Ala Met Ala Glu Tyr Trp Gly Gln 100 105 110 Gly Thr Leu Val Thr Val Ser Ser 115 120 <210> 135 <211> 128 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of heavy chain variable region of anti-HER2 antibody 44-C12 <400> 135 Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Gly Thr Phe Ser Ser Tyr 20 25 30 Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Gly Ile Ile Pro Ile Phe Gly Thr Ala Asn Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asp Ser Gly Tyr Ser Tyr Gly Tyr Pro Met Asn Tyr Tyr Tyr 100 105 110 Tyr Tyr Met Asp Val Trp Gly Lys Gly Thr Thr Val Thr Val Ser Ser 115 120 125 <210> 136 <211> 123 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of heavy chain variable region of anti-HER2 antibody 44-H4 <400> 136 Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Glu 1 5 10 15 Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr Ser Tyr 20 25 30 Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met 35 40 45 Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe 50 55 60 Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala Tyr 65 70 75 80 Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Met Tyr Tyr Cys 85 90 95 Ala Arg Leu Val Val Gly Ala Asn Pro Pro Thr Tyr Tyr Phe Asp Tyr 100 105 110 Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 <210> 137 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of light chain variable region of anti-HER2 antibody 41-B11 <400> 137 Gln Thr Val Val Thr Gln Glu Pro Ser Phe Ser Val Ser Pro Gly Gly 1 5 10 15 Thr Val Thr Leu Thr Cys Gly Leu Ser Ser Gly Ser Val Ser Thr Ser 20 25 30 Tyr Tyr Pro Ser Trp Tyr Gln Gln Thr Pro Gly Gln Ala Pro Arg Thr 35 40 45 Leu Ile Tyr Ser Thr Asn Thr Arg Ser Ser Gly Val Pro Asp Arg Phe 50 55 60 Ser Gly Ser Ile Leu Gly Asn Lys Ala Ala Leu Thr Ile Thr Gly Ala 65 70 75 80 Gln Ala Asp Asp Glu Ser Asp Tyr Tyr Cys Val Leu Tyr Met Gly Ser 85 90 95 Gly Ile Trp Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110 <210> 138 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of light chain variable region of anti-HER2 antibody 41-C6 <400> 138 Gln Thr Val Val Thr Gln Glu Pro Ser Ser Ser Val Ser Pro Gly Gly 1 5 10 15 Thr Val Thr Leu Thr Cys Gly Leu Thr Ser Gly Ser Val Ser Thr Ser 20 25 30 Tyr Tyr Pro Ser Trp Tyr Gln Gln Thr Pro Gly Gln Ala Pro Arg Thr 35 40 45 Leu Ile Tyr Ser Thr Asn Thr Arg Ser Ser Gly Val Pro Asp Arg Phe 50 55 60 Ser Gly Ser Ile Leu Gly Asn Lys Ala Ala Leu Thr Ile Thr Gly Ala 65 70 75 80 Gln Ala Asp Asp Glu Ser Asp Tyr Tyr Cys Met Leu Tyr Leu Gly Gly 85 90 95 Gly Ile Ser Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110 <210> 139 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of light chain variable region of anti-HER2 antibody 41-E1 <400> 139 Gln Pro Val Leu Thr Gln Pro His Ser Val Ser Glu Ser Pro Gly Lys 1 5 10 15 Thr Val Thr Ile Ser Cys Thr Arg Ser Ser Gly Ser Ile Asp Ser Asn 20 25 30 Phe Val Gln Trp Tyr Gln Gln Arg Pro Gly Ser Ser Pro Thr Thr Val 35 40 45 Ile Tyr Asp Asp Asn Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Ile Asp Ser Ser Ser Asn Ser Ala Ser Leu Thr Ile Ser Gly 65 70 75 80 Leu Lys Ile Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser 85 90 95 Asn Asn Gln Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Arg 100 105 110 <210> 140 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of light chain variable region of anti-HER2 antibody 44-C12 <400> 140 Gln Thr Val Val Thr Gln Glu Pro Ser Phe Ser Val Ser Pro Gly Gly 1 5 10 15 Thr Val Thr Leu Thr Cys Gly Leu Ser Ser Gly Ser Val Ser Pro Thr 20 25 30 Tyr Tyr Pro Ser Trp Tyr Gln Gln Thr Pro Gly Gln Ala Pro Arg Thr 35 40 45 Leu Ile Tyr Arg Thr Asn Ile Arg Ser Ser Gly Val Pro Asp Arg Phe 50 55 60 Ser Gly Ser Ile Leu Gly Asn Lys Ala Ala Leu Thr Ile Thr Gly Ala 65 70 75 80 Gln Ala Asp Asp Glu Ser Leu Tyr Tyr Cys Leu Leu Tyr Met Gly Ser 85 90 95 Gly Val Ser Leu Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Arg 100 105 110 <210> 141 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> Amino acid sequence of light chain variable region of anti-HER2 antibody 44-H4 <400> 141 Gln Ala Val Val Thr Gln Glu Pro Ser Phe Ser Val Ser Pro Gly Gly 1 5 10 15 Thr Val Thr Leu Thr Cys Gly Leu Ser Ser Gly Ser Val Ser Thr Ser 20 25 30 Tyr Tyr Pro Ser Trp Tyr Gln Gln Thr Pro Gly Gln Ala Pro Arg Thr 35 40 45 Leu Ile Tyr Ser Thr Asn Thr Arg Ser Ser Gly Val Pro Asp Arg Phe 50 55 60 Ser Gly Ser Ile Leu Gly Asn Lys Ala Ala Leu Thr Ile Thr Gly Ala 65 70 75 80 Gln Thr Asp Asp Glu Ser Asp Tyr Tyr Cys Val Leu Tyr Met Gly Ser 85 90 95 Gly Ile Ser Leu Phe Gly Gly Gly Thr Lys Val Thr Val Leu Gly 100 105 110 <210> 142 <211> 369 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of heavy chain variable region of anti-HER2 antibody 41-B11 <400> 142 gaggtgcagc tggtgcagtc tggagcagag gtgaaaaagc ccggggagtc tctgaagatc 60 tcctgtaagg gttctggata cagctttacc agctactgga tcggctgggt gcgccagatg 120 cccgggaaag gcctggagtg gatggggatc atctatcctg gtgactctga taccagatac 180 agcccgtcct tccaaggcca ggtcaccatc tcagccgaca agtccatcag caccgcctac 240 ctgcagtgga gcagcctgaa ggcctcggac accgccatgt attactgtgc gagacattac 300 tatgatagta gtggttattc ctactttccg gactactggg gccagggaac cctggtcacc 360 gtctcctca 369 <210> 143 <211> 375 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of heavy chain variable region of anti-HER2 antibody 41-C6 <400> 143 cagatccagc tggtacaatc tggagcagag gtgaaaaagc ccggggagtc tctgaagatc 60 tcctgtaggg gttctggata cagctttacc agctactgga tcggctgggt gcgccagatg 120 cccgggaaag gcctggagtg gatggggatc atctatcctg gtgactctga taccagatac 180 agcccgtcct tccaaggcca ggtcaccatc tcagccgaca agtccatcag caccgcctac 240 ctgcagtgga gcagcctgaa ggcctcggac accgccatgt attactgtgc gagactcagc 300 gtagcagcag ctggtacggg ggggtacaac tggttcgacc cctggggcca gggaaccctg 360 gtcaccgtct cctca 375 <210> 144 <211> 360 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of heavy chain variable region of anti-HER2 antibody 41-E1 <400> 144 gaggtgcagc tggtggagtc tgggggaggc ttggtaaagc cagggcggtc cctgagactc 60 tcctgtacag cttctggatt cacctttggt gattatgcta tgagctggtt ccgccaggct 120 ccagggaagg ggctggagtg ggtaggtttc attagaagca aagcttatgg tgggacaaca 180 gaatacgccg cgtctgtgaa aggcagattc accatctcaa gagatgattc caaaagcatc 240 gcctatctgc aaatgaacag cctgaaaacc gaggacacag ccgtgtatta ctgtactaga 300 gattatacc cagctatggc tgagtactgg ggccagggaa ccctggtcac cgtctcctca 360 360 <210> 145 <211> 384 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of heavy chain variable region of anti-HER2 antibody 44-C12 <400> 145 gaagtgcagc tggtgcagtc tggggctgag gtgaagaagc ctgggtcctc ggtgaaggtc 60 tcctgcaagg cttctggagg caccttcagc agctatgcta tcagctgggt gcgacaggcc 120 cctggacaag ggcttgagtg gatgggaggg atcatcccta tctttggtac agcaaactac 180 gcacagaagt tccagggcag agtcacgatt accgcggaca aatccacgag cacagcctac 240 atggagctga gcagcctgag atctgaggac acggccgtgt attactgtgc gagagattcg 300 ggatacagct atggttaccc tatgaattac tactactact acatggacgt ctggggcaaa 360 gggaccacgg tcaccgtctc ctca 384 <210> 146 <211> 369 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of heavy chain variable region of anti-HER2 antibody 44-H4 <400> 146 gaggtgcagc tggtgcagtc tggagcagag gtgaaaaagc ccggggagtc tctgaagatc 60 tcctgtaagg gttctggata cagctttacc agctactgga tcggctgggt gcgccagatg 120 cccgggaaag gcctggagtg gatggggatc atctatcctg gtgactctga taccagatac 180 agcccgtcct tccaaggcca ggtcaccatc tcagccgaca agtccatcag caccgcctac 240 ctgcagtgga gcagcctgaa ggcctcggac accgccatgt attactgtgc gagactcgta 300 gtgggagcta accccccaac gtactacttt gactactggg gccagggaac cctggtcacc 360 gtctcctca 369 <210> 147 <211> 333 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of light chain variable region of anti-HER2 antibody 41-B11 <400> 147 cagactgtgg tgacccagga gccatcgttc tcagtgtccc ctggagggac agtcacactc 60 acttgtggct tgagctctgg ctcagtctct actagttact accccagctg gtaccagcag 120 accccaggcc aggctccacg cacgctcatc tacagcacaa acactcgctc ttctggggtc 180 cctgatcgct tctctggctc catccttggg aacaaagctg ccctcaccat cacgggggcc 240 caggcagatg atgaatctga ttattactgt gtgctgtata tgggtagtgg catttgggtg 300 ttcggcggag ggaccaagtt gaccgtccta ggt 333 <210> 148 <211> 333 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of light chain variable region of anti-HER2 antibody 41-C6 <400> 148 cagactgtgg tgacccagga gccatcgtcc tcagtgtccc ctggagggac agtcacactc 60 acttgtggct tgacctctgg ctcagtctct actagttact accccagctg gtaccagcag 120 accccaggcc aggctccacg cacgctcatc tacagcacaa acactcgctc ttctggggtc 180 cctgatcgct tctctggctc catccttggg aacaaagctg ccctcaccat cacgggggcc 240 caggcagatg atgaatctga ttattactgt atgctatatt tgggtggtgg catttcggta 300 ttcggcggag ggaccaagct gaccgtccta ggt 333 <210> 149 <211> 333 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of light chain variable region of anti-HER2 antibody 41-E1 <400> 149 cagcctgtgc tgactcagcc ccactctgtg tcggagtctc cggggaagac ggtcaccatc 60 tcctgcaccc gcagcagtgg cagcattgac agcaactttg tgcagtggta ccagcagcgc 120 ccgggcagtt cccccaccac tgtcatctat gacgataacc agaggccctc tggggtccct 180 gatcggttct ctggctccat cgacagctcc tccaactctg cctccctcac catctctgga 240 ctgaagattg aggacgaggc tgactactac tgtcagtctt atgatagcaa caatcaggtg 300 ttcggcggcg ggaccaagct gaccgtccta cgt 333 <210> 150 <211> 333 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of light chain variable region of anti-HER2 antibody 44-C12 <400> 150 cagactgtgg tgactcagga gccatcgttc tcagtgtccc ctggagggac agtcacactc 60 acttgtggct tgagctctgg ctcagtctct cctacttatt accccagctg gtaccagcag 120 accccaggcc aggctccacg cacgctcatc tacaggacaa acattcgctc ttctggggtc 180 cctgatcgct tctctggctc catccttggg aacaaagctg ccctcaccat cacgggggcc 240 caggcagatg atgagtctct ctattactgt ttgctctata tgggtagtgg cgtttcgctg 300 ttcggcggag ggaccaagct gaccgtccta cgt 333 <210> 151 <211> 333 <212> DNA <213> Artificial Sequence <220> <223> Nucleotide sequence of light chain variable region of anti-HER2 antibody 44-H4 <400> 151 caggctgtgg tgacccagga gccatcgttc tcagtgtccc ctggagggac agtcacactc 60 acttgtggct tgagctctgg ctcagtctct actagttact accccagctg gtaccagcag 120 accccaggcc aggctccacg cacgctcatc tacagcacaa acactcgctc ctctggggtc 180 cctgatcgct tctctggctc catccttggg aacaaagctg ccctcaccat cacgggggcc 240 cagacagatg atgaatctga ttattactgt gtgctgtata tgggtagtgg catttcgcta 300 ttcggcggag ggaccaaggt gaccgtccta ggt 333 <210> 152 <211> 41 <212> DNA <213> Artificial Sequence <220> <223> Forward primer for anti-HER2 scFv 41-B11 <400> 152 ggttccggag gcggcggatc cgaggtgcag ctggtgcagt c 41 <210> 153 <211> 46 <212> DNA <213> Artificial Sequence <220> <223> Reverse primer for anti-HER2 scFv 41-B11 <400> 153 agggatcgaa cccttctcga gtcaacctag gacggtcaac ttggtc 46 <210> 154 <211> 44 <212> DNA <213> Artificial Sequence <220> <223> Forward primer for anti-HER2 scFv 41-C6 <400> 154 ggttccggag gcggcggatc ccagatccag ctggtacaat ctgg 44 <210> 155 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Reverse primer for anti-HER2 scFv 41-C6 <400> 155 agggatcgaa cccttctcga gtcaacctag gacggtcagc ttggt 45 <210> 156 <211> 41 <212> DNA <213> Artificial Sequence <220> <223> Forward primer for anti-HER2 scFv 41-E1 <400> 156 ggttccggag gcggcggatc cgaggtgcag ctggtggagt c 41 <210> 157 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Reverse primer for anti-HER2 scFv 41-E1 <400> 157 agggatcgaa cccttctcga gtcaacgtag gacggtcagc ttggt 45 <210> 158 <211> 42 <212> DNA <213> Artificial Sequence <220> <223> Forward primer for anti-HER2 scFv 44-C12 <400> 158 ggttccggag gcggcggatc cgaagtgcag ctggtgcagt ct 42 <210> 159 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Reverse primer for anti-HER2 scFv 44-C12 <400> 159 agggatcgaa cccttctcga gtcaacgtag gacggtcagc ttggt 45 <210> 160 <211> 41 <212> DNA <213> Artificial Sequence <220> <223> Forward primer for anti-HER2 scFv 44-H4 <400> 160 ggttccggag gcggcggatc cgaggtgcag ctggtgcagt c 41 <210> 161 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Reverse primer for anti-HER2 scFv 44-H4 <400> 161 agggatcgaa cccttctcga gtcaacctag gacggtcacc ttggt 45 <210> 162 <211> 114 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of anti c-Met antibody <400> 162 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ser Ser Gln Ser Leu Leu Ala Ser 20 25 30 Gly Asn Gln Asn Asn Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys 35 40 45 Ala Pro Lys Met Leu Ile Ile Trp Ala Ser Thr Arg Val Ser Gly Val 50 55 60 Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln 85 90 95 Ser Tyr Ser Arg Pro Tyr Thr Phe Gly Gin Gly Thr Lys Val Glu Ile 100 105 110 Lys Arg

Claims (16)

delete delete (1) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 109, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 112, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 115, and the amino acid sequence of SEQ ID NO: 120 a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 127,
(2) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 109, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 112, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 116, and the amino acid sequence of SEQ ID NO: 121 a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 128;
(3) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 110, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 113, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 117, and the amino acid sequence of SEQ ID NO: 122 a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 125, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 129,
(4) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 111, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 114, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 118, comprising the amino acid sequence of SEQ ID NO: 123 a CDR-L1 comprising the amino acid sequence of SEQ ID NO: 126, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 130, or
(5) CDR-H1 comprising the amino acid sequence of SEQ ID NO: 109, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 112, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 119, comprising the amino acid sequence of SEQ ID NO: 120 A CDR-L1 comprising the amino acid sequence of SEQ ID NO: 124, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 131
Including, anti-HER2 antibody or antigen-binding fragment thereof. 4. The method of claim 3,
(1) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 132, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 137;
(2) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 133, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 136;
(3) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 134, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 139;
(4) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 135, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140, or
(5) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 136, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 141
Including, anti-HER2 antibody or antigen-binding fragment thereof. 5. The method of claim 4, wherein the anti-HER2 antibody or antigen-binding fragment thereof
(1) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 132, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 137;
(2) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 133, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 136;
(3) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 134, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 139;
(4) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 135, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140, or
(5) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 136, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 141
An anti-HER2 scFv comprising a, anti-HER2 antibody or antigen-binding fragment thereof. An anti-c-Met antibody or antigen-binding fragment thereof, and the anti-HER2 antibody or antigen-binding fragment thereof of claim 3,
The anti-c-Met antibody or antigen-binding fragment thereof
CDR-H1 comprising the amino acid sequence of SEQ ID NO: 1, CDR-H2 comprising the amino acid sequence of SEQ ID NO: 2, CDR-H3 comprising the amino acid sequence of SEQ ID NO: 3, CDR- comprising the amino acid sequence of SEQ ID NO: 10 L1, a CDR-L2 comprising the amino acid sequence of SEQ ID NO: 11, and a CDR-L3 comprising the amino acid sequence of SEQ ID NO: 13, 14, 15, or 16,
Anti c-Met/anti HER2 bispecific antibody. The method of claim 6, wherein the anti-c-Met antibody or antigen-binding fragment thereof,
Which comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 17, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 18,
Anti c-Met/anti HER2 bispecific antibody: delete delete delete The method of claim 6, wherein the anti-HER2 antibody or antigen-binding fragment thereof,
(1) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 132, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 137;
(2) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 133, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 136;
(3) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 134, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 139;
(4) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 135, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 140, or
(5) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 136, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 141
It comprises a, anti c-Met / anti HER2 bispecific antibody. The anti-c- according to claim 6, wherein the anti-c-Met/anti-HER2 bispecific antibody is in the form of an anti-c-Met antibody and a scFv fragment of the anti-HER2 antibody linked to the C-terminus of the anti-c-Met antibody. Met/anti HER2 bispecific antibody. 13. The method of any one of claims 6, 7, 11 and 12,
wherein the anti-c-Met antibody and the anti-HER2 antibody are a mouse-derived antibody, a mouse-human chimeric antibody, a humanized antibody, or a human antibody, respectively;
Anti c-Met/anti HER2 bispecific antibody. A pharmaceutical composition for preventing or treating cancer comprising the anti-HER2 antibody or antigen-binding fragment thereof of any one of claims 3 to 5 as an active ingredient. A pharmaceutical composition for preventing or treating cancer comprising the anti-c-Met/anti-HER2 bispecific antibody of any one of claims 6, 7, 11 and 12 as an active ingredient. A polynucleotide encoding the anti-HER2 antibody or antigen-binding fragment thereof according to any one of claims 3 to 5.

Images