KR102216225B1 - Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor - Google Patents
Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor Download PDFInfo
- Publication number
- KR102216225B1 KR102216225B1 KR1020190077161A KR20190077161A KR102216225B1 KR 102216225 B1 KR102216225 B1 KR 102216225B1 KR 1020190077161 A KR1020190077161 A KR 1020190077161A KR 20190077161 A KR20190077161 A KR 20190077161A KR 102216225 B1 KR102216225 B1 KR 102216225B1
- Authority
- KR
- South Korea
- Prior art keywords
- ser
- gly
- leu
- ala
- pro
- Prior art date
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Virology (AREA)
- Hematology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Plant Pathology (AREA)
- Developmental Biology & Embryology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
본 발명은 키메라 항원 수용체 및 이를 발현하는 면역세포에 관한 것으로, 구체적으로는 항-메소텔린 항체 또는 이의 단편; CD8α의 신호서열(signal peptide), CD28 또는 CD8α의 힌지(hinge); CD28 또는 CD8α의 막관통 도메인(transmembrane domain); 및 CD28, 4-1BB 및 CD3ζ의 세포 내 신호 영역 서열을 포함하는 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체, 및 이를 발현하는 면역세포, 바람직하게는 T 세포에 관한 것이다.
본 발명에 따른 키메라 항원 수용체 및 이를 발현하는 T 세포는 면역세포는 우수한 항암 활성 효과를 나타내므로, 암 치료에 효과적으로 이용될 수 있다.The present invention relates to a chimeric antigen receptor and an immune cell expressing the same, specifically, an anti-mesothelin antibody or fragment thereof; The signal peptide of CD8α, the hinge of CD28 or CD8α; The transmembrane domain of CD28 or CD8α; And a chimeric antigen receptor comprising an intracellular signaling domain comprising an intracellular signaling domain sequence of CD28, 4-1BB and CD3ζ, and an immune cell expressing the same, preferably a T cell.
Since the chimeric antigen receptor and the T cells expressing the same according to the present invention exhibit excellent anticancer activity, immune cells can be effectively used for cancer treatment.
Description
본 발명은 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 T 세포에 관한 것이다. The present invention relates to a mesothelin-specific chimeric antigen receptor and T cells expressing the same.
T 세포(T cells)는 적응성 면역반응(adaptive immunity)을 매개하는 중요한 역할을 하는 세포이다. T 세포는 항원을 인지할 수 있는 수용체(T cell receptor, TCR), 보조자극인자(co-stimulatory molecules), 그리고 사이토카인(cytokines) 자극을 통해서 활성화(activation)된다. 또한, T 세포의 TCR은 항원과 결합된 MHC 분자(major histocompatibility complex, MHC molecules)를 통해 면역반응을 일으키는데, 암세포는 면역반응을 회피하기 위한 기전으로 MHC 분자의 발현을 억제한다. 면역세포 치료제(adoptive immune therapy, adoptive cellular therapy)는 T 세포의 이러한 특성을 이용하여 개발되고 있다.T cells are cells that play an important role in mediating adaptive immunity. T cells are activated through the stimulation of antigen-recognizing receptors (T cell receptors, TCRs), co-stimulatory molecules, and cytokines. In addition, the TCR of T cells induces an immune response through the major histocompatibility complex (MHC molecules) bound to the antigen, and cancer cells suppress the expression of the MHC molecule as a mechanism to avoid the immune response. Adoptive immune therapy (adoptive cellular therapy) is being developed using these properties of T cells.
T 세포가 MHC 분자 없이 직접 항원을 인지할 수 있도록 키메라 항원 수용체(chimeric antigen receptor, CAR)가 개발되고 있다. 키메라 항원 수용체는 항원을 인지하는 scFv(single chain variable fragment) 부분, 막관통 도메인(transmembrane domain), 세포 내로 신호를 전달하는 신호전달 도메인(signaling domain)으로 구성되어 있다. T 세포 내에 키메라 항원 수용체를 인위적으로 도입시켜 T 세포(CAR-T 세포)가 특정 항원을 가진 암에 대해 반응할 수 있도록 한다. 현재 미국의 Novartis, Gilead, Juno Therapeutics, Celgene 등과 같은 다국적 제약사들은 혈액암을 적응증으로 하여 CAR-T 세포를 이용하고 있지만, 고형암에 대한 연구는 아직 미진하다.Chimeric antigen receptors (CARs) are being developed so that T cells can directly recognize antigens without MHC molecules. The chimeric antigen receptor is composed of a single chain variable fragment (scFv) that recognizes an antigen, a transmembrane domain, and a signaling domain that transmits signals into cells. Chimeric antigen receptors are artificially introduced into T cells, allowing T cells (CAR-T cells) to respond to cancers with specific antigens. Currently, multinational pharmaceutical companies such as Novartis, Gilead, Juno Therapeutics, and Celgene in the United States are using CAR-T cells with blood cancer as an indication, but studies on solid cancer are still insufficient.
메소텔린(Mesothelin, MSLN)은 40 kDa의 크기를 갖는 세포표면에 발현하는 당단백질이다. 일반 조직에서는 낮은 발현을 보이지만 중피암(Mesothelioma), 췌장암(Pancreatic cancer), 난소암(Ovarian cancer)을 비롯한 여러 종류의 고형암에서 과발현이 확인되었고, 항암표적으로 연구가 진행 중이다(Chang K 1996, Raffot H 2004). 이에 기반하여 Novartis와 협업하는 미국 펜실베니아 대학의 Carl H. June 박사그룹은 메소텔린을 표적하는 마우스 유래 항-메소텔린의 scFv을 가진 키메라 항원 수용체(ss1 CAR) 연구를 진행 중이다. ss1 CAR mRNA를 T 세포에 전달하여 일시적으로(transiently) CAR 를 발현시켜 환자에게 투여했을 때, 환자로부터 항-마우스 항체 반응(human anti-mouse antibody response, HAMA response)이 일어났음이 확인되었다(Beatty GL 2014). Mesothelin (MSLN) is a glycoprotein expressed on the cell surface having a size of 40 kDa. Although it shows low expression in general tissues, overexpression has been confirmed in several types of solid cancer, including Mesothelioma, Pancreatic cancer, and Ovarian cancer, and studies are underway as anticancer targets (Chang K 1996, Raffot. H 2004). Based on this, Dr. Carl H. June of the University of Pennsylvania, in collaboration with Novartis, is working on a chimeric antigen receptor (ss1 CAR) with scFv of mouse-derived anti-mesothelin targeting mesothelin. When ss1 CAR mRNA was delivered to T cells to transiently express CAR and administered to a patient, it was confirmed that an anti-mouse antibody response (HAMA response) occurred from the patient (Beatty GL 2014).
본 발명자들은 메소텔린을 발현하는 암 치료 용도로 사용될 수 있으며, 기존의 항-마우스 항체 반응 문제를 해소하기 위해, 메소텔린을 특이적으로 표적하는 인간 유래 scFv를 포함하는 키메라 항원 수용체를 제작하였으며, 상기 인간 유래 메소텔린 특이적인 scFv를 포함하는 키메라 항원 수용체를 발현하는 T 세포가 우수한 항암 효과를 보임을 규명하여 본 발명을 완성하였다. The present inventors have produced a chimeric antigen receptor containing a human-derived scFv that specifically targets mesothelin, which can be used for the treatment of cancer expressing mesothelin, and to solve the problem of the existing anti-mouse antibody response, The present invention was completed by finding out that T cells expressing chimeric antigen receptors containing the human-derived mesothelin-specific scFv exhibit excellent anticancer effects.
본 발명은 기존의 메소텔린 결합 도메인을 포함하는 키메라 항원 수용체를 발현하는 T 세포를 이용한 항암 면역세포 치료의 문제점을 해결한, 높은 항암 효과를 나타내는 새로운 메소텔린 결합 도메인을 포함하는 키메라 항원 수용체, 상기 키메라 항원 수용체를 발현하는 T 세포, 및 이를 이용한 암 치료방법을 제공하는 것을 목적으로 한다.The present invention solves the problem of anticancer immune cell therapy using T cells expressing a chimeric antigen receptor containing a conventional mesothelin binding domain, a chimeric antigen receptor comprising a new mesothelin binding domain exhibiting a high anticancer effect, the An object of the present invention is to provide a T cell expressing a chimeric antigen receptor, and a cancer treatment method using the same.
상기 목적을 달성하기 위하여, 본 발명은 메소텔린(Mesothelin, MSLN)에 특이적으로 결합하는 결합 도메인을 포함하는 키메라 항원 수용체를 제공한다. In order to achieve the above object, the present invention provides a chimeric antigen receptor comprising a binding domain that specifically binds to mesothelin (MSLN).
본 발명에 따른 메소텔린(Mesothelin, MSLN)에 대한 결합 도메인은 항-메소텔린 항체 또는 그의 단편인 것이 바람직하지만 이에 한정되는 것은 아니다.The binding domain for mesothelin (MSLN) according to the present invention is preferably an anti-mesothelin antibody or fragment thereof, but is not limited thereto.
본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은 서열번호 45, 51, 또는 57의 아미노산 서열을 포함하는 중쇄 CDR1; 서열번호 46, 52, 또는 58의 아미노산 서열을 포함하는 중쇄 CDR2; 및 서열번호 47, 53, 또는 59의 아미노산 서열을 포함하는 중쇄 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 48, 54, 또는 60의 아미노산 서열을 포함하는 경쇄 CDR1; 서열번호 49, 55, 또는 61의 아미노산 서열을 포함하는 경쇄 CDR2; 및 서열번호 50, 56, 또는 62의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 경쇄 가변영역을 함유하는 것을 특징으로 한다. The anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention comprises a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 45, 51, or 57; A heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 46, 52, or 58; And a heavy chain variable region comprising a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 47, 53, or 59, and a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 48, 54, or 60; A light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 49, 55, or 61; And a light chain variable region comprising a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 50, 56, or 62.
바람직하게는 본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은 서열번호 39, 41, 또는 43의 아미노산 서열을 포함하는 중쇄 가변영역, 및 서열번호 40, 42, 또는 44의 아미노산 서열을 포함하는 경쇄 가변영역을 함유하는 것을 특징으로 한다. Preferably, the anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention is a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39, 41, or 43, and SEQ ID NO: 40, 42, or 44. It is characterized by containing a light chain variable region comprising an amino acid sequence.
본 발명은 또한, 메소텔린 특이적인 키메라 항원 수용체를 코딩하는 핵산; 상기 핵산을 함유하는 벡터; 및 상기 키메라 항원 수용체를 발현하는 면역세포 및 이를 이용한 암 치료방법을 제공한다. The present invention also provides a nucleic acid encoding a mesothelin-specific chimeric antigen receptor; A vector containing the nucleic acid; And immune cells expressing the chimeric antigen receptor, and a cancer treatment method using the same.
본 발명에 따른 키메라 항원 수용체는 메소텔린 특이적인 표적 효율이 우수할 뿐 아니라, 발현지속율이 우수한 장점을 가지고 있으며,The chimeric antigen receptor according to the present invention not only has excellent mesothelin-specific targeting efficiency, but also has the advantage of excellent expression persistence,
본 발명에 따른 키메라 항원 수용체를 발현하는 T 세포는 암세포에 대한 세포독성이 우수하여, 암 치료를 위한 면역세포 치료에 유용하게 사용될 수 있다.The T cells expressing the chimeric antigen receptor according to the present invention are excellent in cytotoxicity to cancer cells, and thus can be usefully used in the treatment of immune cells for cancer treatment.
도 1A는 본 발명의 실시예에 따른 재조합 인간 메소텔린(recombinant human mesothelin, rhMSLN)에 대한 MS501 scFv, MS503 scFv 또는 C2G4 scFv의 결합 정도를 효소 결합 면역 침강 분석법(Enzyme-linked immunosorbent assay, ELISA)을 통해 나타낸다.
도 1B는 본 발명의 실시예에 따른 MIA PaCa2-MSLN 세포에 대한 MS501 scFv, MS503 scFv 또는 C2G4 scFv의 세포 결합 정도를 유세포 분석을 통해 나타낸다.
도 2A는 본 발명의 실시예에 따른 인비트로 실험에 사용된 CAR 구조의 모식도를 나타낸다.
도 2B는 본 발명의 실시예에 따른 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z로 형질도입 된 Jurkat 세포에서의 각각의 CAR 발현양을 유세포 분석을 통해 나타낸다.
도 2C는 본 발명의 실시예에 따른 Jurkat 세포로 형질도입 된 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z의 발현율을 메소텔린 키메라 항원 수용체 발현양과 GFP (green fluorescent protein) 발현양으로 나타낸다.
도 3A는 본 발명의 실시예에 따른 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z로 형질도입 된 Jurkat 세포의 메소텔린을 발현하는 표적세포인 HeLa(자궁경부암) 세포, OVCAR3(난소암) 세포, CAPAN1(췌장암) 세포에 대한 반응에 따른 세포 활성도를 유세포 분석을 통해 나타낸다.
도 3B는 본 발명의 실시예에 따른 위 도 3A에 있어서, 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z로 형질도입 된 Jurkat 세포의 메소텔린 특이적인 반응에 따른 사이토카인 분비능을 효소 결합 면역 침강 분석법을 통해 나타낸다.
도 4A는 본 발명의 실시예에 따른 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z로 형질도입된 Jurkat 세포의 메소텔린 특이적인 반응에 따른 세포 활성도를 유세포 분석을 통해 나타낸다.
도 4B는 본 발명의 실시예에 따른 위 도 4A에 있어서, 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z로 형질도입 된 Jurkat 세포의 메소텔린 특이적인 반응에 따른 사이토카인 분비능을 효소 결합 면역 침강 분석법을 통해 나타낸다.
도 5A는 본 발명의 실시예에 따른 인간 T 세포로 형질도입 된 501(28H)28z 또는 C2G4(28H)28z의 발현율을 유세포 분석을 통해 나타낸다.
도 5B는 본 발명의 실시예에 따른 위 도 5A에 있어서, 501(28H)28z 또는 C2G4(28H)28z로 형질도입 된 인간 T 세포에서의 메소텔린 특이적인 반응에 따른 살해능을 나타낸다.
도 5C는 본 발명의 실시예에 따른 위 도 5B에 있어서, 501(28H)28z 또는 C2G4(28H)28z로 형질도입된 인간 T 세포에서의 메소텔린 특이적인 반응에 따른 사이토카인 분비능을 효소 결합 면역 침강 분석법을 통해 나타낸다.
도 5D는 본 발명의 실시예에 따른 위 도 A에 있어서, 501(28H)28z 또는 C2G4(28H)28z로 형질도입 된 인간 T 세포에서의 메소텔린을 발현하는 표적 OVCAR3(난소암) 세포, CAPAN1(췌장암) 세포에 대한 살해능을 나타낸다.
도 6A는 본 발명의 실시예에 따른 인비보 실험에 사용된 CAR 구조의 모식도를 나타낸다.
도 6B는 본 발명의 실시예에 따른 위 도 6A에 있어서, NCI-H226 이종이식 한 마우스 모델에 501(8H)Δ, 501(8H)z, 501(8H)BBz, 501(8H)28z 또는 501(28H)28z로 형질도입 된 인간 T 세포를 종양 내 주사(intra-tumoral)한 후 종양 크기의 변화를 나타낸다.
도 6C는 본 발명의 실시예에 따른 위 도 6B에 있어서, 형질도입 된 인간 T 세포를 종양 내 주사한 후 20일째에 마우스의 종양조직을 수확(Harvest)한 뒤, 그 무게를 나타낸다.
도 6D는 본 발명의 실시예에 따른 위 도 6C에 있어서, 종양조직 내 형질도입 된 인간 T 세포의 사이토카인 분비능을 효소 결합 면역 침강 분석법을 통해 나타낸다.
도 6E는 본 발명의 실시예에 따른 위 도 6B에 있어서, 마우스의 무게를 통해 부작용을 확인한다.
도 6F는 본 발명의 실시예에 따른 위 도 6B에 있어서, 실험의 종료점에서의 마우스 생존률을 나타낸다.1A is an enzyme-linked immunosorbent assay (ELISA) for the degree of binding of MS501 scFv, MS503 scFv, or C2G4 scFv to recombinant human mesothelin (rhMSLN) according to an embodiment of the present invention. Show through.
1B shows the degree of cell binding of MS501 scFv, MS503 scFv, or C2G4 scFv to MIA PaCa2-MSLN cells according to an embodiment of the present invention through flow cytometry.
2A shows a schematic diagram of a CAR structure used in an in vitro experiment according to an embodiment of the present invention.
Figure 2B shows the expression amount of each CAR in Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z according to an embodiment of the present invention through flow cytometry.
Figure 2C shows the expression rate of 501(28H)28z, 503(28H)28z or C2G4(28H)28z transduced with Jurkat cells according to an embodiment of the present invention.Mesothelin chimeric antigen receptor expression level and GFP (green fluorescent protein) expression It is expressed as a quantity.
3A is a HeLa (cervical cancer) cell, OVCAR3, which is a target cell expressing mesothelin of Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z according to an embodiment of the present invention. Cellular activity according to the response to (ovarian cancer) cells and CAPAN1 (pancreatic cancer) cells is shown through flow cytometry.
3B is a cytokine secretion ability according to a mesothelin-specific response of Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z in FIG. 3A according to an embodiment of the present invention. Is shown through enzyme-linked immunoprecipitation assay.
Figure 4A shows the cell activity according to the mesothelin-specific reaction of Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z according to an embodiment of the present invention through flow cytometry.
4B is a cytokine secretion ability according to a mesothelin-specific response of Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z in FIG. 4A according to an embodiment of the present invention. Is shown through enzyme-linked immunoprecipitation assay.
5A shows the expression rate of 501(28H)28z or C2G4(28H)28z transduced with human T cells according to an embodiment of the present invention through flow cytometry.
5B shows the killing ability according to the mesothelin-specific reaction in human T cells transduced with 501(28H)28z or C2G4(28H)28z in FIG. 5A according to an embodiment of the present invention.
5C is an enzyme-linked immunity showing cytokine secretion ability according to a mesothelin-specific reaction in human T cells transduced with 501(28H)28z or C2G4(28H)28z in FIG. 5B according to an embodiment of the present invention. Shown through sedimentation assay.
5D is a target OVCAR3 (ovarian cancer) cell, CAPAN1, expressing mesothelin in human T cells transduced with 501(28H)28z or C2G4(28H)28z in latitude A according to an embodiment of the present invention. (Pancreatic cancer) Shows the ability to kill cells.
6A shows a schematic diagram of a CAR structure used in an in vivo experiment according to an embodiment of the present invention.
6B is a 501(8H)Δ, 501(8H)z, 501(8H)BBz, 501(8H)28z or 501 mouse model in the above FIG. 6A according to an embodiment of the present invention. (28H) Shows the change in tumor size after intra-tumoral injection of human T cells transduced with 28z.
6C shows the weight of the mouse tumor tissue after harvesting the tumor tissue on the 20th day after intratumoral injection of the transduced human T cells in FIG. 6B according to an embodiment of the present invention.
6D shows the cytokine secretion ability of human T cells transduced in tumor tissue through enzyme-linked immunoprecipitation assay in FIG. 6C above according to an embodiment of the present invention.
Figure 6E is in Figure 6B above according to an embodiment of the present invention, the side effects are confirmed through the weight of the mouse.
6F shows the survival rate of mice at the end of the experiment in the upper FIG. 6B according to an embodiment of the present invention.
본 발명은 메소텔린 특이적으로 결합하는 결합 도메인을 포함하는 키메라 항원 수용체(Chimeric antigen receptor, CAR) 및 이를 발현하는 T 세포에 관한 것이다. 이하 본 발명을 상세히 설명한다.The present invention relates to a chimeric antigen receptor (CAR) comprising a binding domain that specifically binds mesothelin and a T cell expressing the same. Hereinafter, the present invention will be described in detail.
본 발명은 메소텔린(Mesothelin, MSLN)에 특이적으로 결합하는 결합 도메인을 포함하는 키메라 항원 수용체에 대한 것이다. The present invention relates to a chimeric antigen receptor comprising a binding domain that specifically binds to mesothelin (MSLN).
본 발명에 따른 메소텔린(Mesothelin, MSLN)에 대한 결합 도메인은 항-메소텔린 항체 또는 그의 단편인 것이 바람직하지만 이에 한정되는 것은 아니다.The binding domain for mesothelin (MSLN) according to the present invention is preferably an anti-mesothelin antibody or fragment thereof, but is not limited thereto.
본 발명에서의 항체의 “단편”은, 항원 결합 기능을 보유하고 있는 단편을 의미하며, scFv, Fab, F(ab')2 및 Fv 단편 등을 포함하는 의미로 사용된다. The "fragment" of the antibody in the present invention refers to a fragment having an antigen-binding function, and is used in the sense including scFv, Fab, F(ab') 2 and Fv fragments.
"단일쇄 Fv" 또는 "scFv" 항체 단편은 항체의 VH 및 VL 도메인을 포함하는데, 이들 도메인은 단일 폴리펩티드 쇄 내에 존재한다. Fv 폴리펩티드는 scFv가 항원 결합을 위해 목적하는 구조를 형성할 수 있도록 하는 VH 도메인과 VL 도메인 사이에 폴리펩티드 링커를 추가로 포함할 수 있다. “Single chain Fv” or “scFv” antibody fragments comprise the VH and VL domains of an antibody, which domains reside within a single polypeptide chain. The Fv polypeptide may further comprise a polypeptide linker between the VH domain and the VL domain that allows the scFv to form the desired structure for antigen binding.
"Fv" 단편은 완전한 항체 인식 및 결합 부위를 함유하는 항체 단편이다. 이러한 영역은 1개의 중쇄 가변 도메인과 1개의 경쇄 가변 도메인이, 예를 들어 scFv로 단단하게 사실상 공유적으로 연합된 이량체로 이루어진다.“Fv” fragments are antibody fragments that contain a complete antibody recognition and binding site. This region consists of a dimer in which one heavy chain variable domain and one light chain variable domain are tightly and substantially covalently associated with, for example, scFv.
"Fab" 단편은 경쇄의 가변 및 불변 도메인과, 중쇄의 가변 및 제1 불변 도메인 (CH1)을 함유한다. F(ab')2 항체 단편은 일반적으로 그들 사이에 힌지 시스테인에 의해 그들의 카복시 말단 근처에 공유적으로 연결되는 한 쌍의 Fab 단편을 포함한다.The “Fab” fragment contains the variable and constant domains of the light chain and the variable and first constant domains (CH1) of the heavy chain. F(ab') 2 antibody fragments generally comprise a pair of Fab fragments that are covalently linked near their carboxy ends by hinge cysteines between them.
본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은 서열번호 45, 51, 또는 57의 아미노산 서열을 포함하는 중쇄 CDR1; 서열번호 46, 52, 또는 58의 아미노산 서열을 포함하는 중쇄 CDR2; 및 서열번호 47, 53, 또는 59의 아미노산 서열을 포함하는 중쇄 CDR3를 포함하는 중쇄 가변영역, 및 서열번호 48, 54, 또는 60의 아미노산 서열을 포함하는 경쇄 CDR1; 서열번호 49, 55, 또는 61의 아미노산 서열을 포함하는 경쇄 CDR2; 및 서열번호 50, 56, 또는 62의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 경쇄 가변영역을 함유하는 것을 특징으로 하며, The anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention comprises a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 45, 51, or 57; A heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 46, 52, or 58; And a heavy chain variable region comprising a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 47, 53, or 59, and a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 48, 54, or 60; A light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 49, 55, or 61; And characterized in that it contains a light chain variable region comprising a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 50, 56, or 62,
보다 구체적으로는, 본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은,More specifically, the anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention,
서열번호 45의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 46의 아미노산 서열을 포함하는 중쇄 CDR2 서열번호 47의 아미노산 서열을 포함하는 중쇄 CDR3, 및 서열번호 48의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 49의 아미노산 서열을 포함하는 경쇄 CDR2, 서열번호 50의 아미노산 서열을 포함하는 경쇄 CDR3;Heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 45, heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 46 heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 47, and light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 48, SEQ ID NO Light chain CDR2 comprising the amino acid sequence of 49, light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 50;
서열번호 51의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 52의 아미노산 서열을 포함하는 중쇄 CDR2, 서열번호 53의 아미노산 서열을 포함하는 중쇄 CDR3, 및 서열번호 54의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 55의 아미노산 서열을 포함하는 중쇄 CDR2, 서열번호 56의 아미노산 서열을 포함하는 경쇄 CDR3; 또는Heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 51, heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 52, heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 53, and light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 54, sequence A heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 55, a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 56; or
서열번호 57의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 58의 아미노산 서열을 포함하는 중쇄 CDR2, 서열번호 59의 아미노산 서열을 포함하는 중쇄 CDR3, 및 서열번호 60의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 61의 아미노산 서열을 포함하는 중쇄 CDR2, 서열번호 62의 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 것일 수 있다.Heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 57, heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 58, heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 59, and light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 60, sequence It may include a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 61, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
바람직하게는 본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은 서열번호 39, 41, 또는 43의 아미노산 서열을 포함하는 중쇄 가변영역, 및 서열번호 40, 42, 또는 44의 아미노산 서열을 포함하는 경쇄 가변영역을 함유하는 것을 특징으로 한다. Preferably, the anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention is a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39, 41, or 43, and SEQ ID NO: 40, 42, or 44. It is characterized by containing a light chain variable region comprising an amino acid sequence.
보다 구체적으로는 본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은, More specifically, the anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention,
서열번호 39의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 40의 아미노산 서열을 포함하는 경쇄 가변영역;A heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 40;
서열번호 41의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 42의 아미노산 서열을 포함하는 경쇄 가변영역; 또는 A heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 41 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 42; or
서열번호 43의 아미노산 서열을 포함하는 중쇄 가변영역 및 서열번호 44의 아미노산 서열을 포함하는 경쇄 가변영역을 포함하는 것일 수 있다.It may include a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 43 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 44.
가장 바람직하게는 본 발명에 따른 키메라 항원 수용체에 포함된 항-메소텔린 항체 또는 그의 단편은 scFv의 형태로서, 바람직하게는 서열번호 2, 4, 또는 6으로 표시되는 아미노산 서열을 포함할 수 있지만, 이에 한정되는 것은 아니다.Most preferably, the anti-mesothelin antibody or fragment thereof contained in the chimeric antigen receptor according to the present invention is in the form of scFv, and may preferably include an amino acid sequence represented by SEQ ID NO: 2, 4, or 6, It is not limited thereto.
본 발명에 따른 키메릭 항원 수용체는 메소텔린에 특이적으로 결합하는 결합 도메인과 함께 추가적으로 신호서열(signal peptide, SP), 힌지, 막관통 도메인 및 세포 내 도메인에서 선택된 하나 이상을 포함하는 것을 특징으로 한다. The chimeric antigen receptor according to the present invention is characterized in that it further comprises at least one selected from a signal peptide (SP), a hinge, a transmembrane domain, and an intracellular domain along with a binding domain that specifically binds to mesothelin. do.
본 발명에 따른 키메릭 항원 수용체에 포함될 수 있는 신호서열은 CD8α 신호서열인 것이 바람직하지만, 이에 한정되는 것은 아니며, CD8α 신호서열은 서열번호 8로 표시되는 아미노산 서열을 포함할 수 있다. The signal sequence that can be included in the chimeric antigen receptor according to the present invention is preferably a CD8α signal sequence, but is not limited thereto, and the CD8α signal sequence may include an amino acid sequence represented by SEQ ID NO: 8.
본 발명에 따른 신호서열과, 메소텔린에 특이적으로 결합하는 결합 도메인은 키메라 항원 수용체의 세포 외 도메인을 구성한다. 세포 외 도메인은 주신호가 전달되는 부위로 세포막 외부에 존재하며 메소텔린을 특이적으로 인식하기 위한 도메인이다. The signal sequence according to the present invention and the binding domain specifically binding to mesothelin constitute the extracellular domain of the chimeric antigen receptor. The extracellular domain is a site through which the main signal is transmitted, exists outside the cell membrane, and is a domain for specifically recognizing mesothelin.
본 발명에 따른 키메라 항원 수용체에 포함될 수 있는 막관통 도메인(transmembrane domain)은 상기 세포 외 도메인과 상기 세포 내 신호전달 도메인을 세포막 사이로 연결 가능하다면 어떠한 것이든 사용가능하다. 바람직하게는 상기 막관통 도메인은 CD28 유래의 막관통 도메인 및/또는 CD8α 유래의 막관통 도메인으로 이루어지며, 상기 CD28 유래의 막관통 도메인 및/또는 CD8α 유래의 막관통 도메인의 전체 또는 일부를 포함하는 것일 수 있다.Any transmembrane domain that can be included in the chimeric antigen receptor according to the present invention can be used as long as the extracellular domain and the intracellular signaling domain can be linked between the cell membrane. Preferably, the transmembrane domain is composed of a transmembrane domain derived from CD28 and/or a transmembrane domain derived from CD8α, and includes all or part of the transmembrane domain derived from CD28 and/or a transmembrane domain derived from CD8α. Can be.
바람직하게는 상기 막관통 도메인은 서열번호 12 및/또는 18로 표시되는 아미노산 서열을 포함할 수 있지만, 이에 한정되는 것은 아니다.Preferably, the transmembrane domain may include an amino acid sequence represented by SEQ ID NO: 12 and/or 18, but is not limited thereto.
본 발명의 일 실시예에 따르면, 상기 세포 외 도메인과 상기 막관통 도메인은 스페이서 도메인으로 연결될 수 있다. According to an embodiment of the present invention, the extracellular domain and the transmembrane domain may be connected by a spacer domain.
바람직하게는 상기 스페이서 도메인은 힌지 도메인일 수 있다. 본 발명에 따른 키메릭 항원 수용체에 포함될 수 있는 스페이서 도메인은 CD28 유래의 힌지 도메인 및/또는 CD8α 유래의 힌지 도메인을 포함할 수 있으며, 상기 CD28 유래의 힌지 도메인 및/또는 CD8α 유래의 힌지 도메인의 전체 또는 일부를 포함하는 것일 수 있다. CD28 및 CD8α로서 전체 또는 일부를 포함하는 것일 수 있다.Preferably, the spacer domain may be a hinge domain. The spacer domain that may be included in the chimeric antigen receptor according to the present invention may include a hinge domain derived from CD28 and/or a hinge domain derived from CD8α, and the entire hinge domain derived from the CD28 and/or the hinge domain derived from CD8α Or it may be to include some. CD28 and CD8α may include all or part.
바람직하게는 상기 힌지 도메인은 서열번호 10 및/또는 16으로 표시되는 아미노산 서열이나, 이에 한정되는 것은 아니다.Preferably, the hinge domain is an amino acid sequence represented by SEQ ID NO: 10 and/or 16, but is not limited thereto.
구체적인 일 실시예에 따르면, MS501 scFv를 포함하는 다양한 조합의 CAR 구조를 이용한 인-비보(in-vivo) 실험에서, MS501 scFv를 CD28 막관통 도메인, CD28 유래 및 CD3ζ 유래의 세포 내 신호 전달 도메인과 연결한 조합들(501(8H)28z 및 501(28H)28z)이 다른 조합들(501(8H)z 및 501(8H)BBz)에 비해 종양의 크기를 감소시키는 예기치 못한 우수한 항암 효과를 나타내었으며, 특히, 힌지 영역을 CD28로 조합(501(28H)28z)하였을 때 CD8α 힌지를 사용(501(8H)28z)하였을 때보다 현저한 항암 효과를 나타내었다.According to a specific embodiment, in an in-vivo experiment using various combinations of CAR structures including MS501 scFv, MS501 scFv was used with a CD28 transmembrane domain, a CD28-derived, and a CD3ζ-derived intracellular signal transduction domain. The linked combinations (501(8H)28z and 501(28H)28z) showed unexpected and excellent anticancer effect in reducing the size of the tumor compared to other combinations (501(8H)z and 501(8H)BBz). In particular, when the hinge region was combined with CD28 (501(28H)28z), it showed a remarkable anticancer effect than when the CD8α hinge was used (501(8H)28z).
본 발명의 일 실시예에 따르면, 상기 세포 내 신호전달 도메인은 T 세포의 세포막 안쪽, 즉 세포질에 위치하게 되는 부분으로서, 세포 외 도메인에 결합된 항체가 표적 항원에 결합하였을 때, 면역세포의 면역반응을 활성화시키는 부위를 의미한다. According to an embodiment of the present invention, the intracellular signaling domain is a part that is located inside the cell membrane of T cells, that is, in the cytoplasm, and when an antibody bound to the extracellular domain binds to a target antigen, immunity of immune cells It means a site that activates the reaction.
본 발명에 따른 키메라 항원 수용체는 2개 이상의 세포 내 신호전달 도메인을 포함하는 것일 수 있다. 2개 이상의 세포 내 신호전달 도메인을 포함하는 경우에는 세포 내, 신호전달 도메인들이 서로 직렬로 연결될 수 있다. 본 발명에 따른 키메릭 항원 수용체에 포함될 수 있는 세포 내 신호전달 도메인은 CD28 유래의 세포 내 신호전달 도메인, 또는 4-1BB 유래의 세포 내 신호전달 도메인이 CD3ζ 유래의 세포 내 신호전달 도메인과 연결된 것일 수 있으며, 바람직하게는 서열번호 14. 20 및/또는 22로 표시되는 아미노산 서열을 포함할 수 있지만, 이에 한정되는 것은 아니다. The chimeric antigen receptor according to the present invention may include two or more intracellular signaling domains. When two or more intracellular signaling domains are included, the intracellular and signaling domains may be connected in series with each other. The intracellular signaling domain that can be included in the chimeric antigen receptor according to the present invention is one in which the intracellular signaling domain derived from CD28, or the intracellular signaling domain derived from 4-1BB is linked to the intracellular signaling domain derived from CD3ζ. It may, and preferably includes an amino acid sequence represented by SEQ ID NO: 14. 20 and/or 22, but is not limited thereto.
구체적인 일 실시예에 따르면, 본 발명에 따른 키메라 항원 수용체는 서열번호 24, 26, 28, 30, 32, 34 및 36으로 구성된 군으로부터 선택되는 하나 이상의 아미노산 서열, 또는 상기 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열 동일성을 갖는 이의 변이체를 포함하는 것일 수 있다. According to a specific embodiment, the chimeric antigen receptor according to the present invention is at least one amino acid sequence selected from the group consisting of SEQ ID NOs: 24, 26, 28, 30, 32, 34 and 36, or 80% or more of the amino acid sequence, It may include a variant thereof having sequence identity of preferably 90% or more, more preferably 95% or more, and most preferably 99% or more.
또한 본 발명은 앞서 기술한 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포를 제공하며, 상기 면역세포는 T 세포, NK 세포 또는 NKT 세포일 수 있지만, 이에 한정되는 것은 아니며, 바람직하게는 T 세포이다.In addition, the present invention provides an immune cell expressing the chimeric antigen receptor according to the present invention described above, and the immune cell may be a T cell, an NK cell or an NKT cell, but is not limited thereto, and preferably a T cell to be.
본 발명의 면역세포는 메소텔린을 발현하는 종양세포에 대해 독성을 나타내는 것일 수 있다. 일 실시예에 따르면, 본 발명의 면역세포(예컨대, T 세포)가 췌장암(Pancreatic cancer) 세포, 자궁경부암(Cervical cancer) 세포, 중피종(Mesothelioma) 세포 또는 난소암(Ovarian cancer) 세포에 대해 독성을 나타낼 수 있다. 예컨대, 상기 췌장암 세포, 자궁경부암 세포, 중피종 세포 또는 난소암 세포는 메소텔린을 발현하는 것일 수 있다.The immune cells of the present invention may exhibit toxicity to tumor cells expressing mesothelin. According to one embodiment, the immune cells (e.g., T cells) of the present invention are toxic to pancreatic cancer cells, cervical cancer cells, mesothelioma cells, or ovarian cancer cells. Can be indicated. For example, the pancreatic cancer cells, cervical cancer cells, mesothelioma cells, or ovarian cancer cells may express mesothelin.
또한 본 발명은 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포(예컨대, T 세포)를 포함하는 종양 또는 종양 전이의 예방 또는 치료용 약학 조성물을 제공한다. 상기 조성물에는 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포의 수가 치료 대상 내의 종양 세포(예컨대, 췌장암, 자궁경부암, 중피종 또는 난소암)수의 1배 내지 10배로 포함되는 것이 바람직하지만, 이에 한정되는 것은 아니다. In addition, the present invention provides a pharmaceutical composition for preventing or treating tumors or tumor metastasis comprising immune cells (eg, T cells) expressing the chimeric antigen receptor according to the present invention. In the composition, the number of immune cells expressing the chimeric antigen receptor according to the present invention is preferably contained in an amount of 1 to 10 times the number of tumor cells (e.g., pancreatic cancer, cervical cancer, mesothelioma or ovarian cancer) in the treatment target, but limited thereto. It does not become.
본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포를 포함하는 약학 조성물에는 약제학적으로 허용되는 부형제가 추가적으로 포함될 수 있다. 그러한 부형제의 예로는, 계면활성제, 바람직하게는 폴리소르베이트 계열의 비이온성 계면활성제; 중성 완충 염수, 인간염 완충 염수 등의 완충제; 글루코스, 만노스, 수크로스 또는 덱스트란, 만니톨 등의 당 또는 당알콜류; 글리신, 히스티딘 등의 아미노산이나 단백질 또는 폴리펩티드; 항산화제; EDTA 또는 글루타티온 등의 킬레이트제 예컨대; 침투제; 보조제; 및 보존제가 포함될 수 있지만, 이에 한정되는 것은 아니다. Pharmaceutical compositions containing immune cells expressing chimeric antigen receptors according to the present invention may additionally contain pharmaceutically acceptable excipients. Examples of such excipients include surfactants, preferably nonionic surfactants of the polysorbate series; Buffering agents such as neutral buffered saline and human salt buffered saline; Sugars or sugar alcohols such as glucose, mannose, sucrose, dextran, and mannitol; Amino acids, proteins, or polypeptides such as glycine and histidine; Antioxidants; Chelating agents such as EDTA or glutathione; Penetrant; Adjuvants; And a preservative may be included, but is not limited thereto.
본 발명의 일 실시예에 따르면, 본 발명의 약학 조성물은 1회 투여량 내에 상기 면역세포(예컨대, T 세포)의 수가 치료 대상 내의 상기 종양세포, 예를 들어 췌장암 세포, 자궁경부암 세포, 중피종 세포 또는 난소암 세포 수의 1배 내지 10배로 포함된 것일 수 있다.According to an embodiment of the present invention, the pharmaceutical composition of the present invention contains the number of immune cells (eg, T cells) in a single dose, and the tumor cells in the treatment target, for example, pancreatic cancer cells, cervical cancer cells, mesothelioma cells. Alternatively, it may be included in an amount of 1 to 10 times the number of ovarian cancer cells.
용어 “종양”은 전형적으로 조절되지 않은 세포 성장/증식을 특징으로 하는 포유동물의 생리학적 상태를 지칭하거나 기재한다. 종양(암)의 예는 암종, 림프종(예를 들어, 호지킨 및 비-호지킨 림프종), 모세포종, 육종 및 백혈병을 포함하나, 이에 한정되지는 않는다. 보다 바람직한 암의 예는 편평세포암, 소세포 폐암, 비소세포 폐암, 폐의 선암종, 폐의 편평세포 암종, 복막암, 간세포성암, 위장암, 췌장암, 신경교종, 자궁경부암, 난소암, 간암, 방광암, 간세포암, 유방암, 결장암, 결장직장암, 자궁내막 또는 자궁 암종, 타액선 암종, 신장암, 간암, 전립선암, 외음부암, 갑상선암, 간 암종, 중피종, 백혈병 및 다른 림프구증식성 장애, 및 다양한 유형의 두경부암을 포함한다. 본 발명에서 상기 종양(암)은 바람직하게는 메소텔린-양성 암이고, 췌장암, 난소암, 폐암, 위암, 자궁내막암 및 중피종으로 구성된 군에서 선택되는 것을 특징으로 할 수 있다.The term “tumor” refers to or describes a mammalian physiological condition that is typically characterized by unregulated cell growth/proliferation. Examples of tumors (cancers) include, but are not limited to, carcinoma, lymphoma (eg, Hodgkin and non-Hodgkin's lymphoma), blastoma, sarcoma, and leukemia. Examples of more preferable cancers are squamous cell cancer, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell carcinoma of the lung, peritoneal cancer, hepatocellular carcinoma, gastrointestinal cancer, pancreatic cancer, glioma, cervical cancer, ovarian cancer, liver cancer, bladder cancer , Hepatocellular carcinoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, prostate cancer, vulvar cancer, thyroid cancer, liver carcinoma, mesothelioma, leukemia and other lymphoproliferative disorders, and various types of Includes head and neck cancer. In the present invention, the tumor (cancer) is preferably mesothelin-positive cancer, and may be characterized in that it is selected from the group consisting of pancreatic cancer, ovarian cancer, lung cancer, gastric cancer, endometrial cancer and mesothelioma.
또한 본 발명은 위에 기술한 본 발명에 따른 키메라 항원 수용체를 코딩하는 핵산 서열을 제공한다. 본 발명의 항원 수용체를 코딩하는 폴리뉴클레오타이드(핵산)는 코돈 최적화에 의해 변형될 수 있으며, 이는 코돈의 축퇴성(degeneracy)에서 기인한 것으로, 폴리펩타이드 또는 이의 변이체 단편을 코딩하는 많은 뉴클레오타이드 서열이 존재한다는 것은 통상의 기술자가 잘 이해할 수 있을 것이다. 이들 폴리뉴클레오타이드(핵산)의 일부는 임의의 자연 발생형 유전자의 뉴클레오타이드 서열과 최소 상동성을 보유한다. The present invention also provides a nucleic acid sequence encoding the chimeric antigen receptor according to the present invention described above. The polynucleotide (nucleic acid) encoding the antigen receptor of the present invention can be modified by codon optimization, which is due to codon degeneracy, and there are many nucleotide sequences encoding polypeptides or variant fragments thereof. It will be well understood by those skilled in the art. Some of these polynucleotides (nucleic acids) have minimal homology with the nucleotide sequence of any naturally occurring gene.
특히 코돈 활용법의 차이로 인해 가변적인 폴리뉴클레오타이드(핵산), 예를 들어 인간, 영장류 및/또는 포유동물의 코돈 선택에 최적화된 폴리뉴클레오타이드(핵산)가 바람직하다. In particular, variable polynucleotides (nucleic acids) due to differences in codon utilization are preferred, for example, polynucleotides (nucleic acids) optimized for codon selection in humans, primates and/or mammals.
본 발명의 일 실시예에 따르면, 핵산 서열은 서열번호 23, 25, 27, 29, 31, 33 및 35로 구성된 군으로부터 선택되는 하나 이상의 뉴클레오타이드 서열, 또는 상기 뉴클레오타이드 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열 동일성을 갖는 이의 변이체를 포함하는 것일 수 있다.According to an embodiment of the present invention, the nucleic acid sequence is at least one nucleotide sequence selected from the group consisting of SEQ ID NOs: 23, 25, 27, 29, 31, 33 and 35, or at least 80% of the nucleotide sequence, preferably It may include a variant thereof having a sequence identity of at least 90%, more preferably at least 95%, and most preferably at least 99%.
본 발명에 따른 키메라 항원 수용체에 포함되는, Contained in the chimeric antigen receptor according to the present invention,
CD8α 신호서열을 코딩하는 핵산 서열은 서열번호 7; The nucleic acid sequence encoding the CD8α signal sequence is SEQ ID NO: 7;
scFv를 코딩하는 핵산 서열은 서열번호 1, 3, 또는 5; The nucleic acid sequence encoding the scFv is SEQ ID NO: 1, 3, or 5;
CD28 힌지 및 CD8α 힌지를 코딩하는 핵산 서열은 서열번호 9 또는 15;The nucleic acid sequence encoding the CD28 hinge and the CD8α hinge is SEQ ID NO: 9 or 15;
CD28 막관통 도메인 및 CD8α 막관통 도메인을 코딩하는 핵산 서열은 서열번호 11 또는 17;The nucleic acid sequence encoding the CD28 transmembrane domain and the CD8α transmembrane domain is SEQ ID NO: 11 or 17;
CD28 세포 내 신호 도메인, 4-1BB 세포 내 신호 도메인 및 CD3ζ 세포 내 신호 도메인을 코딩하는 핵산 서열은 서열번호 13, 19 또는 21;The nucleic acid sequence encoding the signal domain in the CD28 cell, the signal domain in the 4-1BB cell and the signal domain in the CD3ζ cell is SEQ ID NO: 13, 19 or 21;
로 표시되는 것을 특징으로 하나, 이에 한정되는 것은 아니다.It is characterized by being represented by, but is not limited thereto.
본 발명은 본 발명에 따른 핵산 서열을 포함하는 벡터 및 본 발명에 따른 벡터를 포함하는 바이러스를 제공한다.The present invention provides a vector comprising the nucleic acid sequence according to the present invention and a virus comprising the vector according to the present invention.
또한 본 발명은 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포를 대상체에 투여하는 단계를 포함하는 종양의 치료방법 및 종양 전이의 예방 및 치료방법을 제공한다. 상기 대상체는 종양을 가진 포유류일 수 있으며, 구체적으로는 인간일 수 있으나, 이에 한정되는 것은 아니다.In addition, the present invention provides a method for treating a tumor and a method for preventing and treating tumor metastasis comprising administering to a subject an immune cell expressing a chimeric antigen receptor according to the present invention. The subject may be a tumor-bearing mammal, specifically, a human, but is not limited thereto.
본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포 또는 이를 포함하는 조성물은 경구투여, 주입(infusion), 정맥내 투여(intravenous injection), 근육내 투여(intramuscular injection), 피하 투여(subcutaneous injection), 복강내 투여(intraperitoneal injectoon), 직장내 투여(Intrarectal administration), 국소 투여(topical administration), 비내 투여(intranasal injection) 등으로 투여될 수 있지만, 이에 한정되는 것은 아니다.The immune cells expressing the chimeric antigen receptor according to the present invention or a composition comprising the same may be administered orally, infusion, intravenous injection, intramuscular injection, subcutaneous injection, and intraperitoneal administration. It may be administered as an intra-territoneal injectoon, intrarectal administration, topical administration, intranasal injection, or the like, but is not limited thereto.
이하, 본 발명을 실시예를 통하여 보다 상세하게 설명한다. 이들 실시예는 본 발명을 상세하게 설명하기 위한 것일 뿐 본 발명의 권리범위가 이들 실시예에 예시한 것들로 한정되는 것은 아니다.Hereinafter, the present invention will be described in more detail through examples. These examples are only for describing the present invention in detail, and the scope of the present invention is not limited to those illustrated in these examples.
실시예Example 1: One: 방법 및 시약Methods and reagents
1.1 세포주 및 세포주 배양1.1 Cell lines and cell line culture
인간 T-계열 세포주 Jurkat, 인간 췌장암 세포주 MIA PaCa2, 인간 자궁경부암 세포주 HeLa, 인간 난소암 세포주 OVCAR3, 인간 췌장암 세포주 CAPAN1, 인간 중피종 세포주 NCI-H226은 ATCC(American Type Culture Collection, Manassas, VA, USA)로부터 공급받아 사용하였다. Jurkat 및 형질전환 된 Jurkat 세포는 10% FBS를 포함하는 RPMI-1640(GIBCO, Grand Island, NY, USA)에서 유지되었다. MIA PaCa2는 10% FBS(fetal bovine serum; GIBCO, Grand Island, NY, USA)을 포함하는 DMEM(GIBCO, Grand Island, NY, USA)에서 유지되었다. HeLa는 10% FBS(GIBCO)가 포함된 DMEM(GIBCO)에서 유지되었다. OVCAR3는 20% FBS(GIBCO)가 포함된 RPMI-1640(GIBCO)에서 유지되었다. CAPAN1은 20% FBS(GIBCO)가 포함된 IMDM(ATCC)에서 유지되었다. NCI-H226은 10% FBS(GIBCO)가 포함된 RPMI-1640(GIBCO)에서 유지되었다. 인간 배아 신장 섬유아세포(Human embryonic kidney fibroblast)인 HEK293T 세포주는 ATCC로부터 공급받아 사용하였고 10% FBS(GIBCO, Grand Island, NY, USA)를 포함하는 DMEM(GIBCO)에서 유지되었다. 메소텔린 과발현 인간 췌장암 세포주 MIA PaCa2-MSLN은 목암연구소(GC녹십자, Korea)로 부터 공급받아 사용하였다. MIA PaCa2-MSLN은 10% FBS(GIBCO)와 200ug/ml Hygromycin B(GIBCO)를 포함하는 DMEM(GIBCO)에서 유지되었다.Human T-series cell line Jurkat, human pancreatic cancer cell line MIA PaCa2, human cervical cancer cell line HeLa, human ovarian cancer cell line OVCAR3, human pancreatic cancer cell line CAPAN1, human mesothelioma cell line NCI-H226 is ATCC (American Type Culture Collection, Manassas, VA, USA) It was supplied from and used. Jurkat and transformed Jurkat cells were maintained in RPMI-1640 (GIBCO, Grand Island, NY, USA) containing 10% FBS. MIA PaCa2 was maintained in DMEM (GIBCO, Grand Island, NY, USA) containing 10% FBS (fetal bovine serum; GIBCO, Grand Island, NY, USA). HeLa was maintained in DMEM (GIBCO) with 10% FBS (GIBCO). OVCAR3 was maintained in RPMI-1640 (GIBCO) with 20% FBS (GIBCO). CAPAN1 was maintained in IMDM (ATCC) with 20% FBS (GIBCO). NCI-H226 was maintained in RPMI-1640 (GIBCO) with 10% FBS (GIBCO). The HEK293T cell line, a human embryonic kidney fibroblast, was supplied from ATCC and used and was maintained in DMEM (GIBCO) containing 10% FBS (GIBCO, Grand Island, NY, USA). Mesothelin overexpressing human pancreatic cancer cell line MIA PaCa2-MSLN was supplied and used from Mok Cancer Research Institute (GC Green Cross, Korea). MIA PaCa2-MSLN was maintained in DMEM (GIBCO) containing 10% FBS (GIBCO) and 200 ug/ml Hygromycin B (GIBCO).
1.2 인간 T 세포 분리 및 배양1.2 Human T Cell Isolation and Culture
기관생명윤리위원회(Institutional review board, IRB, Korea)의 승인을 받아 공여자를 모집하여 말초혈 단핵세포(Peripheral blood mononuclear cell, PBMC)를 피콜-하이파크(Ficoll-Hypaque, GE healthcare)로 분리하였다. 분리된 PBMC는 바로 동결하였다. 해동한 PBMC는 음성선택(Negative selection)방법으로 Easy sep(Stem cell, Vancouver, BC, CA) 키트(Kit)로 인간 T 세포를 분리하였다. 인간 T 세포는 항-CD3/항-CD28 마그네틱 비드(CD3/CD28 Dynabead, GIBCO)와 1:3으로 섞어 20~24시간 활성화시킨다. 인간 T 세포 및 형질전환 된 인간 T 세포는 5% 인간혈청(Sigma-aldrich, Missouri, St.Louis, USA)과 50 IU/ml IL-2(Proleukin, Novartis)이 포함된 X-VIVO 15(LONZA, Basel, Switzerland)에서 유지되었다.Peripheral blood mononuclear cells (PBMCs) were separated into Ficoll-Hypaque (GE healthcare) by recruiting donors with approval from the Institutional Review Board (IRB, Korea). The separated PBMC were immediately frozen. The thawed PBMC were subjected to negative selection to isolate human T cells with Easy sep (Stem cell, Vancouver, BC, CA) kit. Human T cells are activated for 20 to 24 hours by mixing 1:3 with anti-CD3/anti-CD28 magnetic beads (CD3/CD28 Dynabead, GIBCO). Human T cells and transformed human T cells were X-VIVO 15 (LONZA) containing 5% human serum (Sigma-aldrich, Missouri, St.Louis, USA) and 50 IU/ml IL-2 (Proleukin, Novartis). , Basel, Switzerland).
1.3 재조합 인간 1.3 Recombinant human 메소텔린에Mesothelin 대한 About scFv의scFv 결합 확인 Bonding check
다음의 과정을 거쳐 재조합 인간 메소텔린에 본 발명에 따른 scFv가 결합하는 것을 확인하였다. It was confirmed that the scFv according to the present invention binds to recombinant human mesothelin through the following procedure.
(i) MS501 scFv 단백질, MS503 scFv 단백질 및 C2G4 scFv 단백질을 96-well immuno plate에 200 ng/ml로 24시간 코팅한다.(i) MS501 scFv protein, MS503 scFv protein and C2G4 scFv protein were coated on a 96-well immuno plate at 200 ng/ml for 24 hours.
(ⅱ) 세척용액으로 well을 세척한 후, 1% BSA(Bovine serum albumin, Sigma) 용액으로 1시간 블로킹(Blocking)하였다.(Ii) After washing the wells with a washing solution, blocking was performed for 1 hour with a 1% BSA (Bovine serum albumin, Sigma) solution.
(ⅲ) 세척용액으로 well을 세척한 후, 100ng/ml의 재조합 인간 메소텔린 단백질을 2시간 처리하였다.(Iii) After washing the wells with the washing solution, 100 ng/ml of recombinant human mesothelin protein was treated for 2 hours.
(ⅳ) 세척용액으로 well을 세척한 후, 재조합 인간 메소텔린 탐지 항체(Detection antibody)를 분석증명서에 따라 희석하여 well에 분주한 후 1시간 처리하였다.(Iv) After washing the wells with the washing solution, the recombinant human mesothelin detection antibody was diluted according to the analysis certificate, dispensed into the wells, and treated for 1 hour.
(ⅴ) 세척용액으로 well을 세척한 후, 스트렙타비딘-HRP (Streptavidin-HRP)이 30분간 처리되었다.(V) After washing the wells with a washing solution, streptavidin-HRP was treated for 30 minutes.
(ⅵ) 세척용액으로 well을 세척한 후, 기질 용액(Substrate solution)이 15분간 처리되었다.(Vi) After washing the wells with the washing solution, the substrate solution was treated for 15 minutes.
(ⅶ) 정지 용액(Stop solution)을 처리하고 450 nm 흡광도에서 측정되었다.(Vii) Stop solution was treated and measured at 450 nm absorbance.
1.4 1.4 메소텔린Mesothelin 과발현 세포와의 결합 확인 Confirmation of binding to overexpressing cells
MS501 scFv 단백질, MS503 scFv 단백질 및 C2G4 scFv 단백질의 메소텔린 과발현 세포주인 MIA PaCa2-MSLN에 대한 결합 정도를 확인한다. MIA PaCa2-MSLN 세포주를 1 x 105 cells/100 μl로 FACS 완충용액에 부유하여 준비한다. MS501 scFv 단백질, MS503 scFv 단백질 및 C2G4 scFv 단백질을 각각 1 μg 처리하였다. 세포들은 FACS 완충액을 이용하여 두 차례 세척되었다. 세포들은 항-6xHis tag 항체(Biolegend)를 사용하여 염색하였다. 양성대조군(positive control)시료는 항-메소텔린 항체(R&D system)로 염색하였다. 염색된 세포들의 발현비율 및 평균 형광강도(Mean fluorescence intensity, MFI)는 BD LSRFortessa 를 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.The degree of binding of the MS501 scFv protein, the MS503 scFv protein, and the C2G4 scFv protein to the mesothelin overexpressing cell line, MIA PaCa2-MSLN, was confirmed. Prepare MIA PaCa2-MSLN cell line by floating in FACS buffer at 1 x 10 5 cells/100 μl. MS501 scFv protein, MS503 scFv protein, and C2G4 scFv protein were each treated with 1 μg. Cells were washed twice using FACS buffer. Cells were stained with anti-6xHis tag antibody (Biolegend). Positive control samples were stained with an anti-mesothelin antibody (R&D system). The expression ratio and mean fluorescence intensity (MFI) of the stained cells were measured using BD LSRFortessa and analyzed in FlowJo software.
1.5 1.5 키메라chimera 항원 수용체 구축 Antigen receptor construction
본 발명의 키메라 항원 수용체들을 제작하기 위하여 표 1에 기재한 구성들은 SOE-PCR(Splicing by overlapping extension by polymerase chain reaction)을 통해 인공적으로 합성되었다. 좀 더 상세하게는, (1) 세포 외 도메인(extracellular domain); CD8α의 신호서열(signal peptide), scFv 서열 (MS501 scFv서열, MS503 scFv 서열 또는 C2G4 scFv 서열), CD28의 힌지(hinge) 또는 CD8α의 힌지(hinge),(2) 막관통 도메인(transmembrane domain); CD28, CD8α의 막관통 도메인,(3) 세포 내 도메인(intracellular domain); CD28, 4-1BB, CD3ζ 의 세포 내 신호전달 도메인(intracellular signaling domain)은 SOE-PCR(Splicing by overlapping extension by polymerase chain reaction)을 통해 인공적으로 합성되었다. 유전자 재조합 결과물은 직접 서열분석(direct sequencing)으로 확인되었다. 이들은 Nhe1 및 EcoRI으로 절단된 후 3세대 자가-불활성화 렌티바이러스 발현 벡터(third generation self-inactivating lentiviral expression vector)인 EF1α-MCS 벡터의 Nhe1 및 EcoRI 사이트에 삽입(ligation)되었다.In order to produce the chimeric antigen receptors of the present invention, the configurations described in Table 1 were artificially synthesized through SOE-PCR (Splicing by overlapping extension by polymerase chain reaction). In more detail, (1) an extracellular domain; Signal peptide of CD8α, scFv sequence (MS501 scFv sequence, MS503 scFv sequence or C2G4 scFv sequence), hinge of CD28 or hinge of CD8α, (2) transmembrane domain; CD28, the transmembrane domain of CD8α, (3) an intracellular domain; The intracellular signaling domains of CD28, 4-1BB, and CD3ζ were artificially synthesized through SOE-PCR (Splicing by overlapping extension by polymerase chain reaction). The gene recombination result was confirmed by direct sequencing. They were digested with Nhe1 and EcoRI and then ligated into the Nhe1 and EcoRI sites of the EF1α-MCS vector, a third generation self-inactivating lentiviral expression vector.
본 발명의 실시예에 따른 키메라 항원 수용체(chimeric antigen receptor, CAR)를 표 1에 정리하였다. 본 발명의 실시예에 따른 모든 CAR의 도메인들은 서로 직렬로(in tandem) 연결된 것이며, 또한 인프레임(in frame)으로 연결된 것이다. 501(28H)28z는 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); MS501 IgG의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD28 유래의 힌지, 막관통 도메인, 세포 내 신호전달 도메인(439-759 뉴클레오타이드, GenBank J02988.1); 및 CD3ζ 유래의 세포 내 신호전달 도메인(299-634 뉴클레오타이드, GenBank NM000734.3)과 stop codon TGA 가 연결된 것이다. 503(28H)28z는 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); MS503 IgG 의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD28 유래의 힌지, 막관통 도메인, 세포 내 신호전달 도메인(439-759 뉴클레오타이드, GenBank J02988.1); 및 CD3ζ 유래의 세포 내 신호전달 도메인(299-634 뉴클레오타이드, GenBank NM000734.3)과 stop codon TGA가 연결된 것이다. C2G4(28H)28z는 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); C2G4 IgG의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD28 유래의 힌지, 막관통 도메인, 세포 내 신호전달 도메인(439-759 뉴클레오타이드, GenBank J02988.1); 및 인간 CD3ζ 유래의 세포 내 신호전달 도메인(299-634 뉴클레오타이드, GenBank NM000734.3)과 stop codon TGA가 연결된 것이다. 501(8H)Δ는 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); MS501 IgG 의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD8α의 힌지, 막관통 도메인(1292-1507 뉴클레오타이드, GenBank NM 001768.6)과 stop codon TGA가 연결된 것이다. 501(8H)z 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); MS501 IgG 의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD8α의 힌지, 막관통 도메인(1292-1507 뉴클레오타이드, GenBank NM 001768.6); 및 CD3ζ 유래의 세포 내 신호전달 도메인(299-634 뉴클레오타이드, GenBank NM000734.3)과 stop codon TGA가 연결된 것이다. 501(8H)BBz는 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); MS501 IgG의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD8α의 힌지, 막관통 도메인(1292-1507 뉴클레오타이드, GenBank NM 001768.6)과 인간 4-1BB 유래의 세포 내 신호전달 도메인(901-1026 뉴클레오타이드, GenBank NM001561.5); 및 CD3ζ 유래의 세포 내 신호전달 도메인(299-634 뉴클레오타이드, GenBank NM000734.3)과 stop codon TGA가 연결된 것이다. 501(8H)28z 는 인간 CD8α의 신호서열 도메인(890-952 뉴클레오타이드, GenBank NM 001768.6); MS501 IgG 의 scFv 도메인(출원번호: 10-2015-0135755); 인간 CD8α의 힌지(1292-1435 뉴클레오타이드, GenBank NM001768.6); 인간 CD28 막관통 도메인, 세포 내 신호전달 도메인(556-759 뉴클레오타이드, GenBank J02988.1); 및 CD3ζ 유래의 세포 내 신호전달 도메인(299-634 뉴클레오타이드, GenBank NM000734.3)과 stop codon TGA가 연결된 것이다.Table 1 summarizes the chimeric antigen receptor (CAR) according to the embodiment of the present invention. The domains of all the CARs according to the embodiment of the present invention are connected in tandem to each other, and are connected in frame. 501(28H)28z is the signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of MS501 IgG (application number: 10-2015-0135755); Human CD28 derived hinge, transmembrane domain, intracellular signaling domain (439-759 nucleotides, GenBank J02988.1); And CD3ζ-derived intracellular signaling domain (299-634 nucleotides, GenBank NM000734.3) and stop codon TGA are linked. 503(28H)28z is the signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of MS503 IgG (application number: 10-2015-0135755); Human CD28 derived hinge, transmembrane domain, intracellular signaling domain (439-759 nucleotides, GenBank J02988.1); And CD3ζ-derived intracellular signaling domain (299-634 nucleotides, GenBank NM000734.3) and stop codon TGA. C2G4(28H)28z is the signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of C2G4 IgG (application number: 10-2015-0135755); Human CD28 derived hinge, transmembrane domain, intracellular signaling domain (439-759 nucleotides, GenBank J02988.1); And a human CD3ζ-derived intracellular signaling domain (299-634 nucleotides, GenBank NM000734.3) and a stop codon TGA. 501(8H)Δ is the signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of MS501 IgG (application number: 10-2015-0135755); The hinge, transmembrane domain (1292-1507 nucleotides, GenBank NM 001768.6) of human CD8α and stop codon TGA are linked. 501(8H)z signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of MS501 IgG (application number: 10-2015-0135755); The hinge, transmembrane domain of human CD8α (nucleotides 1292-1507, GenBank NM 001768.6); And CD3ζ-derived intracellular signaling domain (299-634 nucleotides, GenBank NM000734.3) and stop codon TGA. 501(8H)BBz is the signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of MS501 IgG (application number: 10-2015-0135755); The hinge of human CD8α, the transmembrane domain (1292-1507 nucleotides, GenBank NM 001768.6) and the intracellular signaling domain derived from human 4-1BB (901-1026 nucleotides, GenBank NM001561.5); And CD3ζ-derived intracellular signaling domain (299-634 nucleotides, GenBank NM000734.3) and stop codon TGA. 501(8H)28z is the signal sequence domain of human CD8α (890-952 nucleotides, GenBank NM 001768.6); ScFv domain of MS501 IgG (application number: 10-2015-0135755); The hinge of human CD8α (1292-1435 nucleotides, GenBank NM001768.6); Human CD28 transmembrane domain, intracellular signaling domain (556-759 nucleotides, GenBank J02988.1); And CD3ζ-derived intracellular signaling domain (299-634 nucleotides, GenBank NM000734.3) and stop codon TGA.
본 발명의 실시예에 따른 키메라 항원 수용체(chimeric antigen receptor, CAR) 및 그의 제조에 사용된 도메인들의 서열들의 정보를 표 2 및 표 3에 정리하였다.The information on the sequences of the chimeric antigen receptor (CAR) and the domains used in the preparation thereof according to the embodiment of the present invention is summarized in Tables 2 and 3.
본 발명의 실시예에 따른 키메라 항원 수용체(chimeric antigen receptor, CAR)의 제조에 사용된 scFv 가변영역의 중쇄, 경쇄, 및 CDRs의 서열목록을 표 4 내지 표 5에 정리하였다.The sequence lists of the heavy chain, light chain, and CDRs of the scFv variable region used in the production of chimeric antigen receptor (CAR) according to the embodiment of the present invention are summarized in Tables 4 to 5.
NSKNTLYLQMNSLRAEDTAVYYCARNIYTFDYWGQGTLVTVSSEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGIYPDSGSTYYADSVKGRFTISRD
NSKNTLYLQMNSLRAEDTAVYYCAKNAFTFDYWGQGTLVTVSSEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSSIYPGDGSTYYADSVKGRFTISRD
NSKNTLYLQMNSLRAEDTAVYYCAKNAFTFDYWGQGTLVTVSS
AISGLRSEDEADYYCGTWDSSLSGYVFGGGTKLTVLGQSVLTQPPSASGTPGQRVTISCSGSSSNIGSNAVSWYQQLPGTAPKLLIYYNSHRPSGVPDRFSGSKSGTSASL
AISGLRSEDEADYYCGTWDSSLSGYVFGGGTKLTVLG
DNSKNTLYLQMNSLRAEDTAVYYCAKNMLSFDYWGQGTLVTVSSEVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSGIPPDSGSKYYADSVRGRFTVSR
DNSKNTLYLQMNSLRAEDTAVYYCAKNMLSFDYWGQGTLVTVSS
AISGLRSEDEADYYCGSWDPSLNGYVFGGGTKVTVLGQSVLTQPPSASGTPGQRVTISCTGSSSNIGSNAVSWYQQLPGTAPKLLIYYNSKRPSGVPDRFSGSKSGTSASL
AISGLRSEDEADYYCGSWDPSLNGYVFGGGTKVTVLG
1.6 바이러스 생산 및 유전자 전달1.6 Virus production and gene transfer
유전자 전달을 위해 293T 세포를 사용하여 위형-VSVG 렌티바이러스(pseudotype-VSVG Lentivirus)를 제조하였다. HEK293T 세포는 10% FBS(GIBCO)가 포함된 DMEM(GIBCO) 배지에서 배양하였다. HEK293T 세포는 pCDH1-MSCV-MSLN CAR construct-EF1α-copGFP 벡터, EF1α-MSLN CAR construct 벡터 또는 pCDH1-MSCV-EF1α-copGFP 대조군 벡터; 및 HIV 기반 pPACKH1 렌티바이러스 패키지 키트(System Biosciences)와 공-형질감염(co-transfected)되었다. Vector 전달을 위해 리포펙타민 2000(Invitrogen, Carlsbad, CA)이 사용되었다. MSLN CAR construct 는 다음과 같다; 501(28H)28z, 503(28H)28z, C2G4(28H)28z, 501(8H)Δ, 501(8H)z, 501(8H)BBz 또는 501(8H)28z. 형질전환 48시간 후, 렌티바이러스를 포함하는 세포 상층액(Supernatant)을 수확하였다. 상층액은 0.45㎛ 필터 유닛(Millipore, Billerica, MA, USA)으로 세포 조각(cell debris)를 제거하였다. 10,600 rpm에서 90분간 ultracentrifugation 하여 바이러스를 1,500배 농축하였다. 농축된 바이러스는 -80℃에서 보관되었다. For gene transfer, 293T cells were used to prepare a pseudotype-VSVG Lentivirus. HEK293T cells were cultured in DMEM (GIBCO) medium containing 10% FBS (GIBCO). HEK293T cells include pCDH1-MSCV-MSLN CAR construct-EF1α-copGFP vector, EF1α-MSLN CAR construct vector or pCDH1-MSCV-EF1α-copGFP control vector; And HIV-based pPACKH1 Lentiviral Package Kit (System Biosciences) and co-transfected. Lipofectamine 2000 (Invitrogen, Carlsbad, CA) was used for vector delivery. The MSLN CAR construct is as follows; 501(28H)28z, 503(28H)28z, C2G4(28H)28z, 501(8H)Δ, 501(8H)z, 501(8H)BBz or 501(8H)28z. 48 hours after transformation, a cell supernatant containing lentivirus was harvested. The supernatant was removed from cell debris with a 0.45 μm filter unit (Millipore, Billerica, MA, USA). The virus was concentrated 1,500 times by ultracentrifugation at 10,600 rpm for 90 minutes. The concentrated virus was stored at -80°C.
Jurkat 세포는 10%를 포함하는 RPMI-1640 배지(GIBCO)를 사용하여 5 x 105 cells/ml 농도로 조절하였고, 5 MOI(Multiplicity of infection) 또는 10 MOI 렌티바이러스를 첨가하였다. 1,800 g 및 32℃에서 90분간 원심분리 되었다. 원심분리 후에, 상층액을 걷어내고 새로운 배지(fresh media)로 교체하였다. 세포들은 이후 37℃ 및 5% CO2 조건의 가습 인큐베이터에서 보관하였다. 대조군 세포들은 벡터만을 사용하여 형질도입 되었다.Jurkat cells were adjusted to a concentration of 5 x 10 5 cells/ml using RPMI-1640 medium (GIBCO) containing 10%, and 5 MOI (Multiplicity of infection) or 10 MOI lentivirus was added. It was centrifuged for 90 minutes at 1,800 g and 32°C. After centrifugation, the supernatant was removed and replaced with fresh media. The cells were then stored in a humidified incubator at 37° C. and 5% CO 2 . Control cells were transduced using only the vector.
인간 T 세포는 5% 인간 혈청(Sigma)과 50 IU/ml IL-2(Novartis)가 포함된 X-VIVO15(LONZA) 배지에서 5 x 105 cells/ml 농도로 부유하였다. 5 MOI 또는 10 MOI 렌티바이러스를 8 μg/ml 폴리브렌(Polybrene, Santa Cruz)와 함께 첨가하였다. 1,800 g 및 32℃에서 90분간 원심분리 되었다. 원심분리 후에, 상층액을 걷어내고 새로운 배지(fresh media)로 교체하였다. 세포들은 이후 37℃ 및 5% CO2 조건의 가습 인큐베이터에서 방치되었다. 대조군 세포들은 벡터만을 사용하여 형질도입 되었다.Human T cells were suspended at a concentration of 5 x 10 5 cells/ml in X-VIVO15 (LONZA) medium containing 5% human serum (Sigma) and 50 IU/ml IL-2 (Novartis). 5 MOI or 10 MOI lentivirus was added with 8 μg/ml polybrene (Santa Cruz). It was centrifuged for 90 minutes at 1,800 g and 32°C. After centrifugation, the supernatant was removed and replaced with fresh media. The cells were then left in a humidified incubator at 37° C. and 5% CO 2 . Control cells were transduced using only the vector.
1.7 1.7 MSLNMSLN CAR를CAR 포함하는 수용체 발현 및 T 세포 Receptor expression and T cells containing 활성마커Active marker 분석 analysis
501(28H)28z 형질도입 된 Jurkat 세포, 503(28H)28z 형질도입 된 Jurkat 세포, C2G4(28H)28z 형질도입 된 Jurkat 세포, 대조군 벡터 형질도입 된 Jurkat 세포 및 Jurkat 세포는 FACS 완충액을 사용하여 두 차례 세척하였다. 세포들은 항-CD3(BD Biosciences), 항-F(ab)2(Jackson Immuno research), 항-CD69(BD)hAbs를 사용하여 염색하였다. 염색된 세포들의 발현비율 및 평균 형광강도(Mean fluorescence intensity, MFI)는 BD LSRFortessa 를 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.501(28H)28z transduced Jurkat cells, 503(28H)28z transduced Jurkat cells, C2G4(28H)28z transduced Jurkat cells, control vector transduced Jurkat cells and Jurkat cells were used in FACS buffer. Washed in turn. Cells were stained using anti-CD3 (BD Biosciences), anti-F(ab)2 (Jackson Immuno research), and anti-CD69(BD)hAbs. The expression ratio and mean fluorescence intensity (MFI) of the stained cells were measured using BD LSRFortessa and analyzed in FlowJo software.
501(28H)28z 형질도입 된 인간 T 세포, C2G4(28H)28z 형질도입된 인간 T 세포 및 대조군 벡터 형질도입 된 인간 T 세포는 FACS 완충액을 사용하여 두 차례 세척하였다. 세포들은 항-CD3(BD Biosciences), 항-F(ab)2(Jackson Immuno research)를 사용하여 염색하였다. 염색된 세포들의 발현비율 및 평균 형광강도(Mean fluorescence intensity, MFI)는 BD LSRFortessa 를 사용하여 측정되었고, 플로우조(FlowJo) 소프트웨어에서 분석되었다.501(28H)28z transduced human T cells, C2G4(28H)28z transduced human T cells, and control vector transduced human T cells were washed twice using FACS buffer. Cells were stained using anti-CD3 (BD Biosciences), anti-F(ab)2 (Jackson Immuno research). The expression ratio and mean fluorescence intensity (MFI) of the stained cells were measured using BD LSRFortessa and analyzed in FlowJo software.
1.8 1.8 MSLNMSLN CARCAR 발현 T 세포의 Expression of T cells 표적세포Target cell 활성능Activity 확인 Confirm
다음 과정을 거쳐서, MSLN CAR 발현 T 세포의 표적세포, 즉 메소텔린을 발현하는 암세포에 대한 활성능을 확인하였다. Through the following process, the ability of the MSLN CAR-expressing T cells to target cells, that is, cancer cells expressing mesothelin, was confirmed.
(ⅰ) 표적 세포들은 96-well 플레이트에 1 x 104 cells/well로 분배하였다.(I) Target cells were distributed in a 96-well plate at 1 x 10 4 cells/well.
(ⅱ) 효과세포들 (501(28H)28z 형질도입 된 Jurkat 세포, 503(28H)28z 형질도입 된 Jurkat 세포, C2G4(28H)28z 형질도입 된 Jurkat 세포, 대조군 벡터 형질도입 된 Jurkat 세포 및 Jurkat 세포)은 수확(harvest)되고, RPMI-1640 배지로 세척된 후 다양한 E/T(effector-to-target) 비율 조건으로 첨가되었다.(Ii) Effect cells (501(28H)28z transduced Jurkat cells, 503(28H)28z transduced Jurkat cells, C2G4(28H)28z transduced Jurkat cells, control vector transduced Jurkat cells and Jurkat cells. ) Was harvested, washed with RPMI-1640 medium, and added at various E/T (effector-to-target) ratio conditions.
(ⅲ) 24 시간 후에, 플레이트들은 2,000 rpm에서 3분간 원심분리 되었으며, 100 μL의 상층액이 수집되었고, 원심분리 된 세포들은 FACS 완충액을 사용하여 두 차례 세척한 후, 활성마커를 분석하였다. 세포독성 에세이가 완료된 시료들은 -20℃에서 보관되었다.(Iii) After 24 hours, the plates were centrifuged at 2,000 rpm for 3 minutes, 100 μL of supernatant was collected, and the centrifuged cells were washed twice using FACS buffer, and then the activity markers were analyzed. Samples for which the cytotoxicity assay was completed were stored at -20°C.
1.9 1.9 칼세인Calcein 방출 세포독성 에세이 Release cytotoxicity assay
다음 과정을 거쳐서, MSLN CAR 발현 T 세포의 세포 독성을 확인하였다. Through the following process, the cytotoxicity of MSLN CAR-expressing T cells was confirmed.
(ⅰ) 표적 세포들은 10 μM 칼세인아세톡시메틸에스터(Calcein-acetoxymethyl ester, Calcein-AM; cell-permeant dye, Invitrogen)를 사용하여 37℃에서 30분 동안 표지(label)되었다.(I) Target cells were labeled with 10 μM calcein-acetoxymethyl ester (Calcein-AM; cell-permeant dye, Invitrogen) for 30 minutes at 37°C.
(ⅱ) 세척 후에, 표지된 표적 세포들은 96-well 플레이트에 1 x 104 cells/well로 분배되었다.(Ii) After washing, the labeled target cells were distributed in a 96-well plate at 1 x 10 4 cells/well.
(ⅲ) 효과세포들 (501(28H)28z 형질도입 된 인간 T 세포, C2G4(28H)28z 형질도입 된 인간 T 세포 및 대조군 벡터 형질도입 된 인간 T 세포)은 수확(harvest)되고, RPMI-1640 배지로 세척된 후 다양한 E/T(effector-to-target) 비율 조건으로 첨가되었다.(Iii) Effect cells (501(28H)28z transduced human T cells, C2G4(28H)28z transduced human T cells and control vector transduced human T cells) were harvested and RPMI-1640 After washing with a medium, it was added under various E/T (effector-to-target) ratio conditions.
(ⅳ) 4시간 후에, 플레이트들은 2,000 rpm에서 3분간 원심분리 되었으며, 100 μL의 상층액이 수집되었고, 형광 마이크로 플레이트 리더(Victor3, PerkinElmer)로 자극파장 485 nm 및 발광파장 535 nm에서 칼세인 방출을 측정하였다. 세포독성 에세이가 완료된 시료들은 -20℃에서 보관되었다.(Iv) After 4 hours, the plates were centrifuged at 2,000 rpm for 3 minutes, and 100 μL of the supernatant was collected, and calcein was released at a stimulation wavelength of 485 nm and an emission wavelength of 535 nm with a fluorescent microplate reader (Victor3, PerkinElmer). Was measured. Samples for which the cytotoxicity assay was completed were stored at -20°C.
1.10 사이토카인 측정을 위한 효소 결합 면역 침강 분석1.10 Enzyme-linked immunoprecipitation assay for cytokine determination
-20℃에서 보관된 상층액에서 사이토카인 측정을 위한 효소 결합 면역 침강 분석(Enzyme-linked immunosorbent assay, ELISA, R&D systems)을 진행하였다.Enzyme-linked immunosorbent assay (ELISA, R&D systems) was performed to measure cytokines in the supernatant stored at -20°C.
(ⅰ) 포획 항체(Capture antibody)를 분석증명서(Certificate of Analysis, CoA)에 따라 희석하여 96-well plate에 24시간 코팅한다.(I) Capture antibody is diluted according to the Certificate of Analysis (CoA) and coated on a 96-well plate for 24 hours.
(ⅱ) 세척용액으로 well을 세척한 후, 1% BSA(Bovine serum albumin, Sigma) 용액으로 1시간 블로킹(Blocking)하였다.(Ii) After washing the wells with a washing solution, blocking was performed for 1 hour with a 1% BSA (Bovine serum albumin, Sigma) solution.
(ⅲ) 세척용액으로 well을 세척한 후, 시료를 2시간 처리하였다.(Iii) After washing the well with the washing solution, the sample was treated for 2 hours.
(ⅳ) 세척용액으로 well을 세척한 후, 탐지 항체(Detection antibody)를 분석증명서에 따라 희석하여 well에 분주한 후 2시간 처리하였다.(Iv) After washing the well with the washing solution, the detection antibody was diluted according to the analysis certificate, dispensed into the well, and treated for 2 hours.
(ⅴ) 세척용액으로 well을 세척한 후, 스트렙타비딘-HRP (Streptavidin-HRP)이 20분간 처리되었다.(V) After washing the wells with a washing solution, streptavidin-HRP was treated for 20 minutes.
(ⅵ) 세척용액으로 well을 세척한 후, 기질 용액(Substrate solution)이 20분간 처리되었다.(Vi) After washing the well with the washing solution, the substrate solution was treated for 20 minutes.
(ⅶ) 정지 용액(Stop solution)을 처리하고 450 nm에서 흡광도를 측정하였다.(Vii) Stop solution was treated and absorbance was measured at 450 nm.
1.11 이종이식 마우스 모델 확립 및 1.11 xenograft mouse model establishment and MSLNMSLN CARCAR 발현 T 세포의 항종양 능력 평가 Evaluation of anti-tumor ability of expressing T cells
생명윤리위원회(Institutional animal care and use committee, IACUC, GC녹십자, Korea)의 승인을 받아 인비보(in vivo)를 진행하였다. 6 주령 암컷 NSG(NOD scid gamma) 마우스는 The Jackson laboratory(Bar Harbor, Maine, United States)에서 공급받아 사용하였다. NCI-H226 세포는 PBS(Phosphate-buffered saline, GIBCO)에 5 x 106 cells/100㎕ 농도로 부유되었다. 부유 된 세포와 같은 용량의 Matrigel basement membrane matrix(Corning, NY, United States)가 첨가되었다. 마우스의 오른쪽 옆구리에 NCI-H226 5 x 106 cells를 피하주사하였다. In vivo was conducted with the approval of the Institutional Animal Care and Use Committee (IACUC, GC Green Cross, Korea). Six-week-old female NSG (NOD scid gamma) mice were supplied and used from The Jackson laboratory (Bar Harbor, Maine, United States). NCI-H226 cells were suspended in PBS (Phosphate-buffered saline, GIBCO) at a concentration of 5 x 10 6 cells/100 μl. A Matrigel basement membrane matrix (Corning, NY, United States) of the same volume as the suspended cells was added. NCI-H226 5 x 10 6 cells were injected subcutaneously into the right flank of the mouse.
종양의 크기가 200 ~ 250 mm3에 도달하였을 때, 준비된 501(8H)Δ, 501(8H)z, 501(8H)BBz, 501(8H)28z 또는 501(28H)28z로 형질도입 된 인간 T 세포를 종양 내 5일 간격으로 2회 주사하였다. 마우스는 그룹별 10마리가 사용되었다. CAR-T 세포가 주사된 후, 2일 내지 3일 마다 종양의 크기와 몸무게를 측정하였다. 각 그룹별 4마리는 첫 종양 내 주사 후 20일 째에 IACUC 규정에 따른 처치방법을 통해 종양 조직을 수확(Harvest)하였다. 수확한 종양 조직은 전자저울로 무게가 측정되었다. 종양조직은 잘게 잘라 PBS로 세척하여 상층액은 IFN-γ 사이토카인 ELISA에 사용되었다. 마우스들은 첫 종양 내 CAR-T 세포를 주사 후 60일간 추적관찰 하였고, 종양의 장축 길이가 15mm이상일 경우나 몸무게가 20% 이상 줄었을 경우 죽은 것으로 간주하였다. Human T transduced with prepared 501(8H)Δ, 501(8H)z, 501(8H)BBz, 501(8H)28z or 501(28H)28z when the tumor size reached 200 ~ 250 mm 3 Cells were injected twice at 5-day intervals within the tumor. 10 mice were used per group. After CAR-T cells were injected, tumor size and weight were measured every 2 to 3 days. Four animals of each group were harvested (harvested) tumor tissue through the treatment method according to the IACUC regulation on the 20th day after the first intratumoral injection. The harvested tumor tissue was weighed on an electronic scale. The tumor tissue was cut finely and washed with PBS, and the supernatant was used for IFN-γ cytokine ELISA. Mice were followed up for 60 days after injection of CAR-T cells in the first tumor, and were considered dead if the length of the long axis of the tumor was more than 15 mm or the body weight decreased by more than 20%.
실시예Example 2: 2: 메소텔린Mesothelin 특이적인 Specific CAR를CAR 발현하는 Manifest JurkatJurkat 세포 및 인간 T 세포의 암 면역치료제로서의 평가 Evaluation of cells and human T cells as cancer immunotherapy
2.1 2.1 메소텔린을Mesothelin 특이적으로 Specifically 표적하는Targeting scFvscFv 평가 evaluation
MS501 IgG, MS503 IgG 및 C2G4 IgG는 기존의 특허(목암연구소, GC녹십자, KOREA)에서 발명되어 메소텔린 특이적인 결합을 할 수 있다고 알려져 있다. 본 발명자들은 MS501 IgG, MS503 IgG 및 C2G4 IgG를 scFv 형태로 제작하고 scFv 형태에서도 재조합 인간 메소텔린에 결합함을 면역 침강 분석으로 확인하였다(도 1A). 메소텔린을 과발현하는 세포주에 위 scFv 단백질을 결합하고, 유세포 분석을 통해 메소텔린 과발현 세포주에 68% 이상 결합함을 확인하였다(도 1B).MS501 IgG, MS503 IgG and C2G4 IgG were invented in the existing patents (Mokam Research Institute, GC Green Cross, KOREA) and are known to be capable of specific binding to mesothelin. The present inventors produced MS501 IgG, MS503 IgG, and C2G4 IgG in the form of scFv and confirmed that the scFv form also binds to recombinant human mesothelin by immunoprecipitation analysis (Fig. 1A). It was confirmed that the scFv protein was bound to the cell line overexpressing mesothelin, and 68% or more was bound to the cell line overexpressing mesothelin through flow cytometry (FIG. 1B).
2.2 2.2 메소텔린Mesothelin 특이적인 Specific CAR의CAR 발현 확인과 발현 Expression confirmation and expression 유지능Maintenance 평가 evaluation
MS501 scFv, MS503 scFv 및 C2G4 scFv는 CD8α의 신호서열; CD28 의 힌지, 막관통 도메인, 세포 내 신호전달 도메인; CD3ζ의 세포 내 신호전달 도메인과 결합시켰다[표 1](도 2A). 재조합된 키메라 항원 수용체(501(28H)28z, 503(28H)28z, C2G4(28H)28z)유전자는 MSCV 프로모터를 가지는 렌티바이러스 벡터를 이용하여 Jurkat 세포에서 발현되었다. 사용된 렌티바이러스 양은 10 감염 배수(Multiplicity of infection, MOI)가 사용되었다. 각각의 CAR는 항-F(ab)2 항체를 사용하여 검출되었다. 유세포 분석을 통해 Jurkat 세포에서 CAR가 55% 이상의 효율로 형질도입된 것이 확인되었다(도 2B). 2~3일에 한번 유세포 분석으로 50일 이상 CAR 발현이 유지되는 것을 확인하여 세포 밖 증식에도 형질도입 된 CAR 유전자의 발현을 지속할 수 있다는 것을 입증한다(도 2C).MS501 scFv, MS503 scFv and C2G4 scFv signal sequence of CD8α; The hinge of CD28, the transmembrane domain, the intracellular signaling domain; CD3ζ was bound to the intracellular signaling domain [Table 1] (Fig. 2A). Recombined chimeric antigen receptor (501(28H)28z, 503(28H)28z, C2G4(28H)28z) genes were expressed in Jurkat cells using a lentiviral vector having an MSCV promoter. The amount of lentivirus used was a multiple of 10 (Multiplicity of infection, MOI). Each CAR was detected using an anti-F(ab)2 antibody. Through flow cytometry, it was confirmed that CAR was transduced with an efficiency of 55% or more in Jurkat cells (FIG. 2B). Flow cytometry once every 2-3 days confirms that CAR expression is maintained for more than 50 days, demonstrating that expression of the transduced CAR gene can be sustained even in extracellular proliferation (Fig. 2C).
2.3 2.3 메소텔린Mesothelin 특이적인 Specific CAR를CAR 발현하는 Manifest JurkatJurkat 세포의 활성 증가 Increased cell activity
메소텔린(Mesothelin)은 중피암, 자궁암, 췌장암 등의 암종에서 과발현하며 암의 진행과 관련이 있다고 알려져 있음을 고려하여, 본 발명자들은 메소텔린을 표적하는 키메라 항원 수용체를 발현하는 Jurkat 세포의 항암효과 활성 여부를 시험하였다. 시험에 앞서, 형질도입 되지 않은 Jurkat 세포(Untransduced)와 벡터만으로 형질도입 된 Jurkat 세포(Mock)에서 T 세포를 활성화시킨다고 알려진 PMA 와 PHA 를 이용하여 Jurkat 세포의 활성을 확인하였다. PMA 와 PHA 를 처리하였을 때, Jurkat 세포의 활성이 증가되었다(도 3A).Mesothelin (Mesothelin) is overexpressed in carcinomas such as mesothelial cancer, uterine cancer, pancreatic cancer, etc., and considering that it is known to be related to the progression of cancer, the present inventors proposed the anticancer effect of Jurkat cells expressing chimeric antigen receptors targeting mesothelin. It was tested for activity. Prior to the test, the activity of Jurkat cells was confirmed using PMA and PHA, which are known to activate T cells in untransduced Jurkat cells (Untransduced) and Jurkat cells (Mock) transduced with only the vector. When PMA and PHA were treated, the activity of Jurkat cells was increased (Fig. 3A).
메소텔린 특이적인 키메라 항원 수용체를 코딩하는 유전자를 재조합하고 렌티바이러스를 사용하여 유전자를 Jurkat 세포에 전달하였다. 501(28H)28z 또는 C2G4(28H)28z 메소텔린 수용체가 형질도입 된 Jurkat 세포에서 키메라 항원 수용체 발현율이 503(28H)28z이 형질도입 된 Jurkat 세포에 비교하여 우수하였다(도 2C). 메소텔린의 발현이 높다고 알려진 HeLa, OVCAR3 및 CAPAN1 세포와 키메라 항원 수용체가 형질도입 된 Jurkat 세포를 공배양하여 본 발명의 메소텔린 수용체가 형질도입 된 Jurkat 세포의 활성을 평가하였다. 메소텔린 수용체가 형질도입된 Jurkat 세포에서 T 세포 활성마커인 CD69가 발현되는 것을 확인하였으며, 특히 MS501 과 MS503 메소텔린 수용체가 형질도입 된 Jurkat 세포에서 CD69가 높은 수준으로 발현하였다(도 3A). 또한, 표적세포 반응에 따른 사이토카인도 분비하는 것을 확인하였으며, 이 경우 501(28H)28z가 형질도입 된 Jurkat 세포가 가장 많은 양의 사이토카인을 분비하였다(도 3B). 이를 통해 본 발명의 메소텔린 특이적인 키메라 항원 수용체를 발현하는 Jurkat 세포 중 MS501 메소텔린 수용체가 형질도입 Jurkat 세포가 된 501(28H)28z가 MS503(28H)28z 또는 C2G4(28H)28z 형질도입 된 Jurkat 세포보다 더 높은 활성을 나타냄을 확인하였다.The gene encoding the mesothelin-specific chimeric antigen receptor was recombined and the gene was transferred to Jurkat cells using a lentivirus. In Jurkat cells transduced with 501(28H)28z or C2G4(28H)28z mesothelin receptor, the expression rate of chimeric antigen receptor was superior compared to that of Jurkat cells transduced with 503(28H)28z (Fig. 2C). HeLa, OVCAR3 and CAPAN1 cells known to have high mesothelin expression and Jurkat cells transduced with chimeric antigen receptor were co-cultured to evaluate the activity of Jurkat cells transduced with mesothelin receptor of the present invention. It was confirmed that CD69, a T cell activity marker, was expressed in Jurkat cells transduced with the mesothelin receptor. In particular, CD69 was expressed at a high level in Jurkat cells transduced with MS501 and MS503 mesothelin receptors (Fig. 3A). In addition, it was confirmed that cytokines were also secreted according to the target cell response, and in this case, Jurkat cells transduced with 501(28H)28z secreted the largest amount of cytokines (FIG. 3B). Through this, among Jurkat cells expressing the mesothelin-specific chimeric antigen receptor of the present invention, 501(28H)28z transduced Jurkat cells with MS501 mesothelin receptors were transduced with MS503(28H)28z or C2G4(28H)28z. It was confirmed that it showed higher activity than cells.
본 발명에 따른 세 가지 메소텔린 수용체 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z)를 발현하는 Jurkat 세포의 메소텔린 특이적인 활성을 확인하기 위하여, MIA PaCa2 세포 또는 MIA PaCa2-MSLN 세포를 각각 메소텔린 수용체가 형질도입된 Jurkat 세포와 공배양한 후 활성을 평가하였다. 메소텔린을 과발현시킨 세포인 MIA PaCa2-MSLN 세포와 메소텔린 수용체가 형질도입 된 Jurkat 세포를 공배양 후, 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z가 형질도입 된 Jurkat 세포에서 높은 수준으로 CD69가 발현되었다. 그 중 특히, 501(28H)28z와 503(28H)28z가 형질도입 된 Jurkat 세포가 C2G4(28H)28z가 형질도입 된 Jurkat 세포와 비교하여 더 높은 수준으로 CD69를 발현하였다(도 4A). 또한, 사이토카인 분비능을 통해 Jurkat 세포의 활성을 확인하기 위하여 IL-2의 양을 ELISA를 이용하여 평가하였다. 501(28H)28z, 503(28H)28z 또는 C2G4(28H)28z가 형질도입 된 Jurkat 세포에서 IL-2 사이토카인이 분비되는 것을 확인하였으며, 특히 501(28H)28z가 형질도입 된 Jurkat 세포에서 더 많은 양의 IL-2가 분비되었다(도 4B). 이를 통해 본 발명의 메소텔린 수용체를 발현하는 Jurkat 세포가 메소텔린에 특이적으로 활성을 나타냄을 확인하였다.In order to confirm the mesothelin-specific activity of Jurkat cells expressing three mesothelin receptors 501(28H)28z, 503(28H)28z or C2G4(28H)28z) according to the present invention, MIA PaCa2 cells or MIA PaCa2- MSLN cells were each co-cultured with mesothelin receptor-transduced Jurkat cells, and the activity was evaluated. Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z after co-culture with mesothelin overexpressing MIA PaCa2-MSLN cells and mesothelin receptor transduced Jurkat cells CD69 was expressed at a high level in. In particular, Jurkat cells transduced with 501(28H)28z and 503(28H)28z expressed CD69 at higher levels compared to Jurkat cells transduced with C2G4(28H)28z (Fig. 4A). In addition, the amount of IL-2 was evaluated using ELISA in order to confirm the activity of Jurkat cells through cytokine secretion ability. It was confirmed that IL-2 cytokines were secreted in Jurkat cells transduced with 501(28H)28z, 503(28H)28z or C2G4(28H)28z, especially in Jurkat cells transduced with 501(28H)28z. A large amount of IL-2 was secreted (Fig. 4B). Through this, it was confirmed that the Jurkat cells expressing the mesothelin receptor of the present invention exhibit specific activity on mesothelin.
2.4 인간 T 세포에서 2.4 in human T cells 메소텔린Mesothelin 특이적인 Specific CAR의CAR 발현 확인 평가 Expression confirmation evaluation
503(28H)28z 형질전환 된 Jurkat 세포를 501(28H)28z 또는 C2G4(28H)28z Jurkat 세포와 비교하였을 때, MSLN CAR 발현 유지능이 뒤떨어지고(도 2C), 표적세포와 공배양 했을 때 활성마커의 발현 대비 사이토카인 분비능이 부족한 것을 확인하였다(도 3A, 3B). 본 발명자들은 이후 실험에서 503(28H)28z는 제외하였다. 재조합 된 키메라 항원 수용체(501(28H)28z 또는 C2G4(28H)28z) 유전자는 MSCV 프로모터를 가지는 렌티바이러스 벡터를 이용하여 인간 T 세포에서 발현되었다. 사용된 렌티바이러스 양은 5~10 감염 배수(Multiplicity of infection, MOI)가 사용되었다. 각각의 CAR는 항-F(ab)2 항체를 사용하여 검출되었다. 유세포 분석을 통해 인간 T 세포에서 CAR가 80% 이상의 효율로 형질도입된 것이 확인되었다(도 5A).When comparing 503(28H)28z transformed Jurkat cells with 501(28H)28z or C2G4(28H)28z Jurkat cells, the ability to maintain MSLN CAR expression is inferior (Fig. 2C), and when co-cultured with target cells, active markers It was confirmed that the cytokine secretion ability was insufficient compared to the expression of (Fig. 3A, 3B). The present inventors excluded 503(28H)28z in subsequent experiments. The recombinant chimeric antigen receptor (501(28H)28z or C2G4(28H)28z) gene was expressed in human T cells using a lentiviral vector having an MSCV promoter. The amount of lentivirus used was 5-10 Multiplicity of infection (MOI). Each CAR was detected using an anti-F(ab)2 antibody. Through flow cytometry, it was confirmed that the CAR was transduced with an efficiency of 80% or more in human T cells (FIG. 5A).
2.5 2.5 메소텔린Mesothelin 특이적인 Specific CAR를CAR 발현하는 인간 T 세포의 항암 능력 평가 Evaluation of anticancer ability of expressing human T cells
본 발명에 따른 두 가지 메소텔린 키메라 항원 수용체(501(28H)28z 또는 C2G4(28H)28z)를 발현하는 인간 T세포의 메소텔린 특이적인 항암능력을 평가하기 위하여, MIA PaCa2 세포 또는 MIA PaCa2-MSLN 세포를 각각 메소텔린 수용체가 형질도입 된 인간 T 세포와 공배양 후 표적세포 살해능을 평가하였다. 메소텔린 수용체를 발현하는 인간 T 세포가 MIA PaCa2 세포에 대해 살해능을 보이지 않았지만, 메소텔린을 발현하는 MIA PaCa2-MSLN 세포에서는 살해능이 확인되었다(도 5B). 또한, IFN-γ 사이토카인 분비능을 통해 메소텔린 CAR가 형질전환 된 인간 T 세포의 활성을 확인하였다(도 5C). 이를 통해 본 발명의 메소텔린 수용체를 발현하는 인간 T 세포가 메소텔린 특이적으로 항암능을 나타냄을 확인하였다.In order to evaluate the mesothelin-specific anticancer ability of human T cells expressing two mesothelin chimeric antigen receptors (501(28H)28z or C2G4(28H)28z) according to the present invention, MIA PaCa2 cells or MIA PaCa2-MSLN The cells were co-cultured with human T cells transduced with mesothelin receptors, respectively, and the ability to kill target cells was evaluated. Human T cells expressing the mesothelin receptor did not show killer ability against MIA PaCa2 cells, but the killing ability was confirmed in MIA PaCa2-MSLN cells expressing mesothelin (FIG. 5B). In addition, the activity of human T cells transformed with mesothelin CAR was confirmed through IFN-γ cytokine secretion ability (FIG. 5C). Through this, it was confirmed that human T cells expressing the mesothelin receptor of the present invention exhibit anticancer activity specifically for mesothelin.
메소텔린의 발현이 높다고 알려진 OVCAR3 및 CAPAN1 세포와 본 발명에 따른 두 가지 메소텔린 키메라 항원 수용체(501(28H)28z 또는 C2G4(28H)28z)가 형질도입 된 인간 T 세포를 공배양하여 표적세포 살해능을 평가하였다. 메소텔린 키메라 항원 수용체를 발현하는 인간 T 세포가 OVCAR3 및 CAPAN1 세포에 대한 살해능이 확인되었다(도 5B).Killing target cells by co-culturing OVCAR3 and CAPAN1 cells, which are known to have high mesothelin expression, and human T cells transduced with two mesothelin chimeric antigen receptors (501(28H)28z or C2G4(28H)28z) according to the present invention. The ability was evaluated. Human T cells expressing the mesothelin chimeric antigen receptor were found to have killer ability against OVCAR3 and CAPAN1 cells (Fig. 5B).
2.6 다양한 조합을 가지는 2.6 Various combinations 메소텔린Mesothelin 특이적인 Specific CAR의CAR 스크리닝과 마우스 모델에서의 암 면역치료제로서의 평가 Screening and Evaluation of Cancer Immunotherapy in Mouse Models
C2G4(28H)28z 형질전환 된 인간 T 세포를 501(28H)28z 인간 T 세포와 비교하였을 때, 메소텔린을 발현하는 표적세포에 대한 살해능이 부족한 것을 확인하였다(도 5D). 본 발명자들은 이후 실험에서 C2G4(28H)28z는 제외하였다. 다양한 조합을 가지는 메소텔린 특이적인 CAR 후보군들의 스크리닝을 위해 추가로 MS501 scFv를 바탕으로 키메라 항원 수용체 501(8H)Δ, 501(8H)z, 501(8H)BBz, 501(8H)28z 또는 501(28H)28z 유전자를 재조합하였다. [표 1](도 6A). 재조합된 CAR 유전자는 EF1α 프로모터를 가지는 렌티바이러스 벡터를 이용하여 인간 T 세포에서 발현되었다. 사용된 렌티바이러스 양은 5~10 감염 배수(Multiplicity of infection, MOI)가 사용되었다. 각각의 CAR는 항-F(ab)2 항체를 사용하여 검출되었다. 유세포 분석을 통해 CAR 양성 비율을 확인하여 CAR 양성 세포수를 계산하였다. When C2G4(28H)28z transformed human T cells were compared with 501(28H)28z human T cells, it was confirmed that the killer ability against target cells expressing mesothelin was insufficient (Fig. 5D). The present inventors excluded C2G4(28H)28z in subsequent experiments. For screening of mesothelin-specific CAR candidates having various combinations, chimeric antigen receptor 501(8H)Δ, 501(8H)z, 501(8H)BBz, 501(8H)28z or 501( 28H)28z gene was recombined. [Table 1] (Fig. 6A). The recombinant CAR gene was expressed in human T cells using a lentiviral vector having an EF1α promoter. The amount of lentivirus used was 5-10 Multiplicity of infection (MOI). Each CAR was detected using an anti-F(ab)2 antibody. The number of CAR positive cells was calculated by confirming the CAR positive rate through flow cytometry.
NCI-H226 세포가 이종이식(Xenograft)된 마우스의 종양크기가 200 ~ 250 mm3에 도달하였을 때 다양한 조합을 가지는 메소텔린 특이적인 CAR 로 형질전환 된 인간 T 세포를 종양 내 주사하여 마우스모델에서의 항암능력을 두 달간 평가하였고, 종양 내 주사를 받기 전 종양 크기 대비 크기의 증가 및 감소를 비율로서 나타내었다(도 6B). 다양한 조합을 가진 메소텔린 특이적인 키메라 항원 수용체로 형질전환 된 인간 T 세포 중 501(28H)28z 구조의 메소텔린 특이적인 키메라 항원 수용체가 형질전환 된 인간 T 세포를 종양 내 주사되었을 때, 종료시점에서 종양의 크기가 PBS 대조군 대비 270% 감소함을 확인하였다. 501(8H)28z 그룹과 비교하였을 때, 501(28H)28z 그룹에서 종양크기가 150% 감소함을 확인하였다. CAR-T 세포 첫 종양 내 주사 후 20일 째에 각 그룹별 4마리로부터 종양조직을 분리하여 그룹별 상대적인 종양조직 무게를 비교하였다(도 6C). 501(28H)28z 그룹에서 종양의 무게가 다른 그룹과 비교하여 제일 가벼움을 확인하였고, 항암효과가 뛰어남을 보여주었다. 또한, 종양 내 IFN-γ 사이토카인 분비능을 통해 501(28H)28z로 형질전환 된 인간 T 세포의 활성에 따른 항암효과임을 확인하였다(도 6D). 메소텔린 특이적인 CAR로 형질전환 된 인간 T 세포를 종양 내 주사하고 이에 따른 부작용을 몸무게 변화로 나타내었다(도 6E). CAR-T 세포 주사 후 부작용이 없음을 확인하였다. 종료시점에서 마우스모델의 생존율을 확인하여 나타내었다(도 6F). PBS 그룹 29% 생존율; Mock 그룹 11% 생존율; 501(8H)Δ 그룹 17% 생존율; 501(8H)z 그룹은 0% 생존율; 501(8H)BBz 그룹은 33% 생존율; 501(8H)28z 그룹은 50% 생존율을 보이는 반면, 501(28H)28z 그룹에서 100% 생존율을 보였다. When the tumor size of NCI-H226 cells xenografted mice reached 200 ~ 250 mm 3 , human T cells transformed with mesothelin-specific CARs having various combinations were injected intratumorally in a mouse model. The anticancer ability was evaluated for two months, and the increase and decrease in size compared to the tumor size before receiving intratumoral injection were shown as a ratio (FIG. 6B). When the human T cells transformed with the mesothelin-specific chimeric antigen receptor of the 501(28H)28z structure among human T cells transformed with the mesothelin-specific chimeric antigen receptor with various combinations were injected into the tumor, at the end point. It was confirmed that the tumor size decreased by 270% compared to the PBS control group. When compared with the 501(8H)28z group, it was confirmed that the tumor size decreased by 150% in the 501(28H)28z group. On the 20th day after the first intratumoral injection of CAR-T cells, tumor tissues were separated from 4 mice for each group, and the relative tumor tissue weights for each group were compared (FIG. 6C). In the 501(28H)28z group, the weight of the tumor was the lightest compared to other groups, and the anticancer effect was excellent. In addition, it was confirmed that it was an anticancer effect according to the activity of human T cells transformed with 501(28H)28z through the ability to secrete IFN-γ cytokines in the tumor (Fig. 6D). Human T cells transformed with mesothelin-specific CAR were injected into the tumor, and the side effects thereof were represented by weight change (Fig. 6E). It was confirmed that there were no side effects after CAR-T cell injection. At the end point, the survival rate of the mouse model was confirmed and shown (Fig. 6F).
위의 실험 결과들은 본 발명이 메소텔린 특이적인 암 면역세포치료제로 사용될 수 있으며 본 발명의 메소텔린 키메라 항원 수용체 중 MS501 메소텔린 수용체를 이용한 T 세포가 보다 우수한 항암 효과를 나타낼 수 있고, 특히 501(28H)28z 구조를 가질 때 뛰어난 항암 효과를 나타낼 수 있다는 사실을 보여준다. The above experimental results show that the present invention can be used as a mesothelin-specific cancer immunocytotherapy agent, and T cells using the MS501 mesothelin receptor among the mesothelin chimeric antigen receptors of the present invention can exhibit more excellent anticancer effects, especially 501 ( It shows that it can exhibit excellent anticancer effects when it has a 28H)28z structure.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시양태일 뿐이며, 이에 의해 본 발명의 범위가 한정되는 것이 아닌 점은 명백할 것이다. 따라서 본 발명의 실질적인 범위는 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.As described above, specific parts of the present invention have been described in detail, and for those of ordinary skill in the art, it is obvious that these specific techniques are only preferred embodiments, and the scope of the present invention is not limited thereby. something to do. Therefore, it will be said that the practical scope of the present invention is defined by the claims and their equivalents.
<110> Green Cross Cell <120> Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor <130> P19-B174 <160> 62 <170> KoPatentIn 3.0 <210> 1 <211> 727 <212> DNA <213> Artificial Sequence <220> <223> MS501 scFv nucleotide <400> 1 gaggtgcagc tgttggagtc cgggggaggc ttggtacagc ctggggggtc cctgagactc 60 tcctgtgcag cctctggatt cacctttagc aattatgcta tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg ggtctcaggg atctatcccg atagtggtag tacatattac 180 gctgattctg taaaaggtcg gttcaccatc tccagagaca attccaagaa cacgctgtat 240 ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc gagaaatatt 300 tatacgttcg actactgggg ccagggtaca ctggtcaccg tgagctcagg tggaggcggt 360 tcaggcggag gtggatccgg cggtggcgga tcgcagtctg tgctgactca gccaccctca 420 gcgtctggga cccccgggca gagggtcacc atctcttgta gtggctcttc atctaatatt 480 ggcagtaatg ctgtctcctg gtaccagcag ctcccaggaa cggcccccaa actcctcatc 540 tattataata atcagcggcc aagcggggtc cctgaccgat tctctggctc caagtctggc 600 acctcagcct ccctggccat cagtgggctc cggtccgagg atgaggctga ttattactgt 660 ggttcttggg attctagcct gagtggatat gtcttcggcg gaggcaccaa gctgacggtc 720 ctaggca 727 <210> 2 <211> 242 <212> PRT <213> Artificial Sequence <220> <223> MS501 scFv amino acid <400> 2 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr 130 135 140 Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile 145 150 155 160 Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro 165 170 175 Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro Ser Gly Val Pro Asp 180 185 190 Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser 195 200 205 Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp 210 215 220 Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val 225 230 235 240 Leu Gly <210> 3 <211> 726 <212> DNA <213> Artificial Sequence <220> <223> MS503 scFv nucleotide <400> 3 gaggtgcagc tgttggagtc cgggggaggc ttggtacagc ctggggggtc cctgagactc 60 tcctgtgcag cctctggatt cacctttagc aattatgcta tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg ggtctcatcg atctatcctg gtgatggtag tacatattac 180 gctgattctg taaaaggtcg gttcaccatc tccagagaca attccaagaa cacgctgtat 240 ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc gaaaaatgcg 300 tttacgttcg actactgggg ccagggtaca ctggtcaccg tgagctcagg tggaggcggt 360 tcaggcggag gtggatccgg cggtggcgga tcgcagtctg tgctgactca gccaccctca 420 gcgtctggga cccccgggca gagggtcacc atctcttgta gtggctcttc atctaatatt 480 ggcagtaatg ctgtctcctg gtaccagcag ctcccaggaa cggcccccaa actcctcatc 540 tattataata gtcatcggcc aagcggggtc cctgaccgat tctctggctc caagtctggc 600 acctcagcct ccctggccat cagtgggctc cggtccgagg atgaggctga ttattactgt 660 ggtacttggg attctagcct gagtggttat gtcttcggcg gaggcaccaa gctgacggtc 720 ctaggc 726 <210> 4 <211> 242 <212> PRT <213> Artificial Sequence <220> <223> MS503 scFv amino acid <400> 4 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Ala Phe Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr 130 135 140 Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile 145 150 155 160 Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro 165 170 175 Lys Leu Leu Ile Tyr Tyr Asn Ser His Arg Pro Ser Gly Val Pro Asp 180 185 190 Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser 195 200 205 Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Thr Trp Asp 210 215 220 Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val 225 230 235 240 Leu Gly <210> 5 <211> 726 <212> DNA <213> Artificial Sequence <220> <223> C2G4 scFv nucleotide <400> 5 gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60 tcctgtgcgg cctctggatt cacctttagc aattatgcta tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg ggtctcaggg atccctcctg atagtggtag taaatattac 180 gctgattctg taagaggtcg gttcaccgtc tccagagaca attccaagaa cacgctgtat 240 ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc gaaaaatatg 300 ctgtcgttcg actactgggg ccagggtaca ctggtcaccg tgagctcagg tggaggcggt 360 tcaggcggag gtggatccgg cggtggcgga tcgcagtctg tgctgactca gccaccctca 420 gcgtctggga cccccgggca gagggtcacc atctcttgta ctggctcttc atctaatatt 480 ggctccaatg ctgtctcctg gtaccagcag ctcccaggaa cggcccccaa actcctcatc 540 tattataata gtaagcggcc aagcggggtc cctgaccgat tctctggctc caagtctggc 600 acctcagcct ccctggccat cagtgggctc cggtccgagg atgaggctga ttattactgt 660 ggttcttggg atcctagcct gaatggttat gtcttcggcg gaggcaccaa ggtgaccgtc 720 ctaggt 726 <210> 6 <211> 242 <212> PRT <213> Artificial Sequence <220> <223> C2G4 scFv amino acid <400> 6 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Arg Gly Arg Phe Thr Val Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Met Leu Ser Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr 130 135 140 Pro Gly Gln Arg Val Thr Ile Ser Cys Thr Gly Ser Ser Ser Asn Ile 145 150 155 160 Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro 165 170 175 Lys Leu Leu Ile Tyr Tyr Asn Ser Lys Arg Pro Ser Gly Val Pro Asp 180 185 190 Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser 195 200 205 Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp 210 215 220 Pro Ser Leu Asn Gly Tyr Val Phe Gly Gly Gly Thr Lys Val Thr Val 225 230 235 240 Leu Gly <210> 7 <211> 63 <212> DNA <213> Artificial Sequence <220> <223> CD8 alpha signal sequence nucleotide <400> 7 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccg 63 <210> 8 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> CD8 alpha signal sequence amino acid <400> 8 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro 20 <210> 9 <211> 402 <212> DNA <213> Artificial Sequence <220> <223> CD28 Hinge nucleotide <400> 9 aacaagattt tggtgaagca gtcgcccatg cttgtagcgt acgacaatgc ggtcaacctt 60 agctgcaagt attcctacaa tctcttctca agggagttcc gggcatccct tcacaaagga 120 ctggatagtg ctgtggaagt ctgtgttgta tatgggaatt actcccagca gcttcaggtt 180 tactcaaaaa cggggttcaa ctgtgatggg aaattgggca atgaatcagt gacattctac 240 ctccagaatt tgtatgttaa ccaaacagat atttacttct gcaaaattga agttatgtat 300 cctcctcctt acctagacaa tgagaagagc aatggaacca ttatccatgt gaaagggaaa 360 cacctttgtc caagtcccct atttcccgga ccttctaagc cc 402 <210> 10 <211> 39 <212> PRT <213> Artificial Sequence <220> <223> CD28 Hinge amino acid <400> 10 Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn 1 5 10 15 Gly Thr Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu 20 25 30 Phe Pro Gly Pro Ser Lys Pro 35 <210> 11 <211> 81 <212> DNA <213> Artificial Sequence <220> <223> CD28 TM nucleotide <400> 11 ttttgggtgc tggtggtggt tggtggagtc ctggcttgct atagcttgct agtaacagtg 60 gcctttatta ttttctgggt g 81 <210> 12 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> CD28 TM amino acid <400> 12 Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu 1 5 10 15 Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val 20 25 <210> 13 <211> 123 <212> DNA <213> Artificial Sequence <220> <223> CD28 SD nucleotide <400> 13 aggagtaaga ggagcaggct cctgcacagt gactacatga acatgactcc ccgccgcccc 60 gggcccaccc gcaagcatta ccagccctat gccccaccac gcgacttcgc agcctatcgc 120 tcc 123 <210> 14 <211> 41 <212> PRT <213> Artificial Sequence <220> <223> CD28 SD amino acid <400> 14 Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr 1 5 10 15 Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro 20 25 30 Pro Arg Asp Phe Ala Ala Tyr Arg Ser 35 40 <210> 15 <211> 144 <212> DNA <213> Artificial Sequence <220> <223> CD8 alpha Hinge nucleotide <400> 15 gcgaagccca ccacgacgcc agcgccgcga ccaccaacac cggcgcccac catcgcgtcg 60 cagcccctgt ccctgcgccc agaggcgtgc cggccagcgg cggggggcgc agtgcacacg 120 agggggctgg acttcgcctg tgat 144 <210> 16 <211> 48 <212> PRT <213> Artificial Sequence <220> <223> CD8 alpha Hinge amino acid <400> 16 Ala Lys Pro Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro 1 5 10 15 Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro 20 25 30 Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp 35 40 45 <210> 17 <211> 72 <212> DNA <213> Artificial Sequence <220> <223> CD8 alpha TM nucleotide <400> 17 atctacatct gggcgccctt ggccgggact tgtggggtcc ttctcctgtc actggttatc 60 accctttact gc 72 <210> 18 <211> 24 <212> PRT <213> Artificial Sequence <220> <223> CD8 alpha TM amino acid <400> 18 Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu 1 5 10 15 Ser Leu Val Ile Thr Leu Tyr Cys 20 <210> 19 <211> 126 <212> DNA <213> Artificial Sequence <220> <223> 4-1BB SD nucleotide <400> 19 aaacggggca gaaagaaact cctgtatata ttcaaacaac catttatgag accagtacaa 60 actactcaag aggaagatgg ctgtagctgc cgatttccag aagaagaaga aggaggatgt 120 gaactg 126 <210> 20 <211> 42 <212> PRT <213> Artificial Sequence <220> <223> 4-1BB SD amino acid <400> 20 Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met 1 5 10 15 Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe 20 25 30 Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu 35 40 <210> 21 <211> 336 <212> DNA <213> Artificial Sequence <220> <223> CD3 zeta nucleotide <400> 21 agagtgaagt tcagcaggag cgcagacgcc cccgcgtacc agcagggcca gaaccagctc 60 tataacgagc tcaatctagg acgaagagag gagtacgatg ttttggacaa gagacgtggc 120 cgggaccctg agatgggggg aaagccgaga aggaagaacc ctcaggaagg cctgtacaat 180 gaactgcaga aagataagat ggcggaggcc tacagtgaga ttgggatgaa aggcgagcgc 240 cggaggggca aggggcacga tggcctttac cagggtctca gtacagccac caaggacacc 300 tacgacgccc ttcacatgca ggccctgccc cctcgc 336 <210> 22 <211> 112 <212> PRT <213> Artificial Sequence <220> <223> CD3 zeta amino acid <400> 22 Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly 1 5 10 15 Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr 20 25 30 Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35 40 45 Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys 50 55 60 Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg 65 70 75 80 Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala 85 90 95 Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 100 105 110 <210> 23 <211> 1734 <212> DNA <213> Artificial Sequence <220> <223> 501(28H)28z nucleotide <400> 23 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggca acaagatttt ggtgaagcag tcgcccatgc ttgtagcgta cgacaatgcg 840 gtcaacctta gctgcaagta ttcctacaat ctcttctcaa gggagttccg ggcatccctt 900 cacaaaggac tggatagtgc tgtggaagtc tgtgttgtat atgggaatta ctcccagcag 960 cttcaggttt actcaaaaac ggggttcaac tgtgatggga aattgggcaa tgaatcagtg 1020 acattctacc tccagaattt gtatgttaac caaacagata tttacttctg caaaattgaa 1080 gttatgtatc ctcctcctta cctagacaat gagaagagca atggaaccat tatccatgtg 1140 aaagggaaac acctttgtcc aagtccccta tttcccggac cttctaagcc cttttgggtg 1200 ctggtggtgg ttggtggagt cctggcttgc tatagcttgc tagtaacagt ggcctttatt 1260 attttctggg tgaggagtaa gaggagcagg ctcctgcaca gtgactacat gaacatgact 1320 ccccgccgcc ccgggcccac ccgcaagcat taccagccct atgccccacc acgcgacttc 1380 gcagcctatc gctccagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1440 ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1500 gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1560 gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1620 atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1680 gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg ctga 1734 <210> 24 <211> 482 <212> PRT <213> Artificial Sequence <220> <223> 501(28H)28z amino acid <400> 24 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ile Glu Val Met Tyr Pro Pro Pro Tyr 260 265 270 Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys 275 280 285 His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp 290 295 300 Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val 305 310 315 320 Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu 325 330 335 Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr 340 345 350 Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr 355 360 365 Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln 370 375 380 Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu 385 390 395 400 Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly 405 410 415 Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu 420 425 430 Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly 435 440 445 Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser 450 455 460 Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro 465 470 475 480 Pro Arg <210> 25 <211> 1734 <212> DNA <213> Artificial Sequence <220> <223> 503(28H)28z nucleotide <400> 25 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca tcgatctatc ctggtgatgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgaaaaat 360 gcgtttacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata atagtcatcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggtactt gggattctag cctgagtggt tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggca acaagatttt ggtgaagcag tcgcccatgc ttgtagcgta cgacaatgcg 840 gtcaacctta gctgcaagta ttcctacaat ctcttctcaa gggagttccg ggcatccctt 900 cacaaaggac tggatagtgc tgtggaagtc tgtgttgtat atgggaatta ctcccagcag 960 cttcaggttt actcaaaaac ggggttcaac tgtgatggga aattgggcaa tgaatcagtg 1020 acattctacc tccagaattt gtatgttaac caaacagata tttacttctg caaaattgaa 1080 gttatgtatc ctcctcctta cctagacaat gagaagagca atggaaccat tatccatgtg 1140 aaagggaaac acctttgtcc aagtccccta tttcccggac cttctaagcc cttttgggtg 1200 ctggtggtgg ttggtggagt cctggcttgc tatagcttgc tagtaacagt ggcctttatt 1260 attttctggg tgaggagtaa gaggagcagg ctcctgcaca gtgactacat gaacatgact 1320 ccccgccgcc ccgggcccac ccgcaagcat taccagccct atgccccacc acgcgacttc 1380 gcagcctatc gctccagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1440 ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1500 gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1560 gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1620 atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1680 gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg ctga 1734 <210> 26 <211> 482 <212> PRT <213> Artificial Sequence <220> <223> 503(28H)28z amino acid <400> 26 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Lys Asn Ala Phe Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Ser His Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Thr Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ile Glu Val Met Tyr Pro Pro Pro Tyr 260 265 270 Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys 275 280 285 His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp 290 295 300 Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val 305 310 315 320 Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu 325 330 335 Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr 340 345 350 Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr 355 360 365 Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln 370 375 380 Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu 385 390 395 400 Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly 405 410 415 Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu 420 425 430 Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly 435 440 445 Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser 450 455 460 Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro 465 470 475 480 Pro Arg <210> 27 <211> 1734 <212> DNA <213> Artificial Sequence <220> <223> C2G4(28H)28z nucleotide <400> 27 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtctggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cggcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatccctc ctgatagtgg tagtaaatat 240 tacgctgatt ctgtaagagg tcggttcacc gtctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgaaaaat 360 atgctgtcgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtactggctc ttcatctaat 540 attggctcca atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata atagtaagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggatcctag cctgaatggt tatgtcttcg gcggaggcac caaggtgacc 780 gtcctaggta acaagatttt ggtgaagcag tcgcccatgc ttgtagcgta cgacaatgcg 840 gtcaacctta gctgcaagta ttcctacaat ctcttctcaa gggagttccg ggcatccctt 900 cacaaaggac tggatagtgc tgtggaagtc tgtgttgtat atgggaatta ctcccagcag 960 cttcaggttt actcaaaaac ggggttcaac tgtgatggga aattgggcaa tgaatcagtg 1020 acattctacc tccagaattt gtatgttaac caaacagata tttacttctg caaaattgaa 1080 gttatgtatc ctcctcctta cctagacaat gagaagagca atggaaccat tatccatgtg 1140 aaagggaaac acctttgtcc aagtccccta tttcccggac cttctaagcc cttttgggtg 1200 ctggtggtgg ttggtggagt cctggcttgc tatagcttgc tagtaacagt ggcctttatt 1260 attttctggg tgaggagtaa gaggagcagg ctcctgcaca gtgactacat gaacatgact 1320 ccccgccgcc ccgggcccac ccgcaagcat taccagccct atgccccacc acgcgacttc 1380 gcagcctatc gctccagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1440 ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1500 gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1560 gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1620 atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1680 gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg ctga 1734 <210> 28 <211> 482 <212> PRT <213> Artificial Sequence <220> <223> C2G4(28H)28z amino acid <400> 28 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr 65 70 75 80 Tyr Ala Asp Ser Val Arg Gly Arg Phe Thr Val Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Lys Asn Met Leu Ser Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Thr Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Ser Lys Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Pro Ser Leu Asn Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Val Thr Val Leu Gly Ile Glu Val Met Tyr Pro Pro Pro Tyr 260 265 270 Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys 275 280 285 His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp 290 295 300 Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val 305 310 315 320 Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu 325 330 335 Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr 340 345 350 Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr 355 360 365 Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln 370 375 380 Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu 385 390 395 400 Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly 405 410 415 Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu 420 425 430 Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly 435 440 445 Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser 450 455 460 Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro 465 470 475 480 Pro Arg <210> 29 <211> 1008 <212> DNA <213> Artificial Sequence <220> <223> 501(8H) delta nucleotide <400> 29 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatatctaca tctgggcgcc cttggccggg 960 acttgtgggg tccttctcct gtcactggtt atcacccttt actgctga 1008 <210> 30 <211> 335 <212> PRT <213> Artificial Sequence <220> <223> 501(8H) delta amino acid <400> 30 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly 305 310 315 320 Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys 325 330 335 <210> 31 <211> 1344 <212> DNA <213> Artificial Sequence <220> <223> 501(8H)z nucleotide <400> 31 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatatctaca tctgggcgcc cttggccggg 960 acttgtgggg tccttctcct gtcactggtt atcacccttt actgcagagt gaagttcagc 1020 aggagcgcag acgcccccgc gtaccagcag ggccagaacc agctctataa cgagctcaat 1080 ctaggacgaa gagaggagta cgatgttttg gacaagagac gtggccggga ccctgagatg 1140 gggggaaagc cgagaaggaa gaaccctcag gaaggcctgt acaatgaact gcagaaagat 1200 aagatggcgg aggcctacag tgagattggg atgaaaggcg agcgccggag gggcaagggg 1260 cacgatggcc tttaccaggg tctcagtaca gccaccaagg acacctacga cgcccttcac 1320 atgcaggccc tgccccctcg ctga 1344 <210> 32 <211> 447 <212> PRT <213> Artificial Sequence <220> <223> 501(8H)z amino acid <400> 32 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly 305 310 315 320 Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys Arg 325 330 335 Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln 340 345 350 Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp 355 360 365 Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro 370 375 380 Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp 385 390 395 400 Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg 405 410 415 Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr 420 425 430 Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 435 440 445 <210> 33 <211> 1470 <212> DNA <213> Artificial Sequence <220> <223> 501(8H)BBz nucleotide <400> 33 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatatctaca tctgggcgcc cttggccggg 960 acttgtgggg tccttctcct gtcactggtt atcacccttt actgcaaacg gggcagaaag 1020 aaactcctgt atatattcaa acaaccattt atgagaccag tacaaactac tcaagaggaa 1080 gatggctgta gctgccgatt tccagaagaa gaagaaggag gatgtgaact gagagtgaag 1140 ttcagcagga gcgcagacgc ccccgcgtac cagcagggcc agaaccagct ctataacgag 1200 ctcaatctag gacgaagaga ggagtacgat gttttggaca agagacgtgg ccgggaccct 1260 gagatggggg gaaagccgag aaggaagaac cctcaggaag gcctgtacaa tgaactgcag 1320 aaagataaga tggcggaggc ctacagtgag attgggatga aaggcgagcg ccggaggggc 1380 aaggggcacg atggccttta ccagggtctc agtacagcca ccaaggacac ctacgacgcc 1440 cttcacatgc aggccctgcc ccctcgctga 1470 <210> 34 <211> 489 <212> PRT <213> Artificial Sequence <220> <223> 501(8H)BBz amino acid <400> 34 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly 305 310 315 320 Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys Lys 325 330 335 Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg 340 345 350 Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro 355 360 365 Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Val Lys Phe Ser Arg Ser 370 375 380 Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu 385 390 395 400 Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg 405 410 415 Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln 420 425 430 Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr 435 440 445 Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp 450 455 460 Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala 465 470 475 480 Leu His Met Gln Ala Leu Pro Pro Arg 485 <210> 35 <211> 1476 <212> DNA <213> Artificial Sequence <220> <223> 501(8H)28z nucleotide <400> 35 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatttttggg tgctggtggt ggttggtgga 960 gtcctggctt gctatagctt gctagtaaca gtggccttta ttattttctg ggtgaggagt 1020 aagaggagca ggctcctgca cagtgactac atgaacatga ctccccgccg ccccgggccc 1080 acccgcaagc attaccagcc ctatgcccca ccacgcgact tcgcagccta tcgctccaga 1140 gtgaagttca gcaggagcgc agacgccccc gcgtaccagc agggccagaa ccagctctat 1200 aacgagctca atctaggacg aagagaggag tacgatgttt tggacaagag acgtggccgg 1260 gaccctgaga tggggggaaa gccgagaagg aagaaccctc aggaaggcct gtacaatgaa 1320 ctgcagaaag ataagatggc ggaggcctac agtgagattg ggatgaaagg cgagcgccgg 1380 aggggcaagg ggcacgatgg cctttaccag ggtctcagta cagccaccaa ggacacctac 1440 gacgcccttc acatgcaggc cctgccccct cgctga 1476 <210> 36 <211> 491 <212> PRT <213> Artificial Sequence <220> <223> 501(8H)28z amino acid <400> 36 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Phe Trp Val Leu Val Val Val Gly Gly 305 310 315 320 Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe 325 330 335 Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn 340 345 350 Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr 355 360 365 Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Arg Val Lys Phe Ser 370 375 380 Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr 385 390 395 400 Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys 405 410 415 Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys Asn 420 425 430 Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu 435 440 445 Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly 450 455 460 His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr 465 470 475 480 Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 485 490 <210> 37 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Linker nucleotide <400> 37 ggtggaggcg gttcaggcgg aggtggatcc ggcggtggcg gatcg 45 <210> 38 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Linker amino acid <400> 38 Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 15 <210> 39 <211> 116 <212> PRT <213> Artificial Sequence <220> <223> MS501 scFv_heavy chain <400> 39 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 <210> 40 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> MS501 scFv_light chain <400> 40 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Asn Asn Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp Ser Ser Leu 85 90 95 Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110 <210> 41 <211> 116 <212> PRT <213> Artificial Sequence <220> <223> MS503 scFv_heavy chain <400> 41 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Ala Phe Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 <210> 42 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> MS503 scFv_light chain <400> 42 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Asn Ser His Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Thr Trp Asp Ser Ser Leu 85 90 95 Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110 <210> 43 <211> 116 <212> PRT <213> Artificial Sequence <220> <223> C2G4 scFv_heavy chain <400> 43 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Arg Gly Arg Phe Thr Val Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Met Leu Ser Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 <210> 44 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> C2G4 scFv_light chain <400> 44 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Thr Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Asn Ser Lys Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp Pro Ser Leu 85 90 95 Asn Gly Tyr Val Phe Gly Gly Gly Thr Lys Val Thr Val Leu Gly 100 105 110 <210> 45 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable heavy chain CDR1 <400> 45 Asn Tyr Ala Met Ser 1 5 <210> 46 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable heavy chain CDR2 <400> 46 Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys 1 5 10 15 Gly <210> 47 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable heavy chain CDR3 <400> 47 Asn Ile Tyr Thr Phe Asp Tyr 1 5 <210> 48 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable light chain CDR1 <400> 48 Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser 1 5 10 <210> 49 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable light chain CDR2 <400> 49 Tyr Asn Asn Gln Arg Pro Ser 1 5 <210> 50 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable light chain CDR3 <400> 50 Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val 1 5 10 <210> 51 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable heavy chain CDR1 <400> 51 Asn Tyr Ala Met Ser 1 5 <210> 52 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable heavy chain CDR2 <400> 52 Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys 1 5 10 15 Gly <210> 53 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable heavy chain CDR3 <400> 53 Asn Ala Phe Thr Phe Asp Tyr 1 5 <210> 54 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable light chain CDR1 <400> 54 Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser 1 5 10 <210> 55 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable light chain CDR2 <400> 55 Tyr Asn Ser His Arg Pro Ser 1 5 <210> 56 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable light chain CDR3 <400> 56 Gly Thr Trp Asp Ser Ser Leu Ser Gly Tyr Val 1 5 10 <210> 57 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable heavy chain CDR1 <400> 57 Asn Tyr Ala Met Ser 1 5 <210> 58 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable heavy chain CDR2 <400> 58 Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr Tyr Ala Asp Ser Val Arg 1 5 10 15 Gly <210> 59 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable heavy chain CDR3 <400> 59 Asn Met Leu Ser Phe Asp Tyr 1 5 <210> 60 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable light chain CDR1 <400> 60 Thr Gly Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser 1 5 10 <210> 61 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable light chain CDR2 <400> 61 Tyr Asn Ser Lys Arg Pro Ser 1 5 <210> 62 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable light chain CDR3 <400> 62 Gly Ser Trp Asp Pro Ser Leu Asn Gly Tyr Val 1 5 10 <110> Green Cross Cell <120> Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor <130> P19-B174 <160> 62 <170> KoPatentIn 3.0 <210> 1 <211> 727 <212> DNA <213> Artificial Sequence <220> <223> MS501 scFv nucleotide <400> 1 gaggtgcagc tgttggagtc cgggggaggc ttggtacagc ctggggggtc cctgagactc 60 tcctgtgcag cctctggatt cacctttagc aattatgcta tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg ggtctcaggg atctatcccg atagtggtag tacatattac 180 gctgattctg taaaaggtcg gttcaccatc tccagagaca attccaagaa cacgctgtat 240 ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc gagaaatatt 300 tatacgttcg actactgggg ccagggtaca ctggtcaccg tgagctcagg tggaggcggt 360 tcaggcggag gtggatccgg cggtggcgga tcgcagtctg tgctgactca gccaccctca 420 gcgtctggga cccccgggca gagggtcacc atctcttgta gtggctcttc atctaatatt 480 ggcagtaatg ctgtctcctg gtaccagcag ctcccaggaa cggcccccaa actcctcatc 540 tattataata atcagcggcc aagcggggtc cctgaccgat tctctggctc caagtctggc 600 acctcagcct ccctggccat cagtgggctc cggtccgagg atgaggctga ttattactgt 660 ggttcttggg attctagcct gagtggatat gtcttcggcg gaggcaccaa gctgacggtc 720 ctaggca 727 <210> 2 <211> 242 <212> PRT <213> Artificial Sequence <220> <223> MS501 scFv amino acid <400> 2 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr 130 135 140 Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile 145 150 155 160 Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro 165 170 175 Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro Ser Gly Val Pro Asp 180 185 190 Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser 195 200 205 Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp 210 215 220 Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val 225 230 235 240 Leu Gly <210> 3 <211> 726 <212> DNA <213> Artificial Sequence <220> <223> MS503 scFv nucleotide <400> 3 gaggtgcagc tgttggagtc cgggggaggc ttggtacagc ctggggggtc cctgagactc 60 tcctgtgcag cctctggatt cacctttagc aattatgcta tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg ggtctcatcg atctatcctg gtgatggtag tacatattac 180 gctgattctg taaaaggtcg gttcaccatc tccagagaca attccaagaa cacgctgtat 240 ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc gaaaaatgcg 300 tttacgttcg actactgggg ccagggtaca ctggtcaccg tgagctcagg tggaggcggt 360 tcaggcggag gtggatccgg cggtggcgga tcgcagtctg tgctgactca gccaccctca 420 gcgtctggga cccccgggca gagggtcacc atctcttgta gtggctcttc atctaatatt 480 ggcagtaatg ctgtctcctg gtaccagcag ctcccaggaa cggcccccaa actcctcatc 540 tattataata gtcatcggcc aagcggggtc cctgaccgat tctctggctc caagtctggc 600 acctcagcct ccctggccat cagtgggctc cggtccgagg atgaggctga ttattactgt 660 ggtacttggg attctagcct gagtggttat gtcttcggcg gaggcaccaa gctgacggtc 720 ctaggc 726 <210> 4 <211> 242 <212> PRT <213> Artificial Sequence <220> <223> MS503 scFv amino acid <400> 4 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Ala Phe Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr 130 135 140 Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile 145 150 155 160 Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro 165 170 175 Lys Leu Leu Ile Tyr Tyr Asn Ser His Arg Pro Ser Gly Val Pro Asp 180 185 190 Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser 195 200 205 Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Thr Trp Asp 210 215 220 Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val 225 230 235 240 Leu Gly <210> 5 <211> 726 <212> DNA <213> Artificial Sequence <220> <223> C2G4 scFv nucleotide <400> 5 gaggtgcagc tgttggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60 tcctgtgcgg cctctggatt cacctttagc aattatgcta tgagctgggt ccgccaggct 120 ccagggaagg ggctggagtg ggtctcaggg atccctcctg atagtggtag taaatattac 180 gctgattctg taagaggtcg gttcaccgtc tccagagaca attccaagaa cacgctgtat 240 ctgcaaatga acagcctgag agccgaggac acggccgtgt attactgtgc gaaaaatatg 300 ctgtcgttcg actactgggg ccagggtaca ctggtcaccg tgagctcagg tggaggcggt 360 tcaggcggag gtggatccgg cggtggcgga tcgcagtctg tgctgactca gccaccctca 420 gcgtctggga cccccgggca gagggtcacc atctcttgta ctggctcttc atctaatatt 480 ggctccaatg ctgtctcctg gtaccagcag ctcccaggaa cggcccccaa actcctcatc 540 tattataata gtaagcggcc aagcggggtc cctgaccgat tctctggctc caagtctggc 600 acctcagcct ccctggccat cagtgggctc cggtccgagg atgaggctga ttattactgt 660 ggttcttggg atcctagcct gaatggttat gtcttcggcg gaggcaccaa ggtgaccgtc 720 ctaggt 726 <210> 6 <211> 242 <212> PRT <213> Artificial Sequence <220> <223> C2G4 scFv amino acid <400> 6 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Arg Gly Arg Phe Thr Val Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Met Leu Ser Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 115 120 125 Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr 130 135 140 Pro Gly Gln Arg Val Thr Ile Ser Cys Thr Gly Ser Ser Ser Asn Ile 145 150 155 160 Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro 165 170 175 Lys Leu Leu Ile Tyr Tyr Asn Ser Lys Arg Pro Ser Gly Val Pro Asp 180 185 190 Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser 195 200 205 Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp 210 215 220 Pro Ser Leu Asn Gly Tyr Val Phe Gly Gly Gly Thr Lys Val Thr Val 225 230 235 240 Leu Gly <210> 7 <211> 63 <212> DNA <213> Artificial Sequence <220> <223> CD8 alpha signal sequence nucleotide <400> 7 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccg 63 <210> 8 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> CD8 alpha signal sequence amino acid <400> 8 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro 20 <210> 9 <211> 402 <212> DNA <213> Artificial Sequence <220> <223> CD28 Hinge nucleotide <400> 9 aacaagattt tggtgaagca gtcgcccatg cttgtagcgt acgacaatgc ggtcaacctt 60 agctgcaagt attcctacaa tctcttctca agggagttcc gggcatccct tcacaaagga 120 ctggatagtg ctgtggaagt ctgtgttgta tatgggaatt actcccagca gcttcaggtt 180 tactcaaaaa cggggttcaa ctgtgatggg aaattgggca atgaatcagt gacattctac 240 ctccagaatt tgtatgttaa ccaaacagat atttacttct gcaaaattga agttatgtat 300 cctcctcctt acctagacaa tgagaagagc aatggaacca ttatccatgt gaaagggaaa 360 cacctttgtc caagtcccct atttcccgga ccttctaagc cc 402 <210> 10 <211> 39 <212> PRT <213> Artificial Sequence <220> <223> CD28 Hinge amino acid <400> 10 Ile Glu Val Met Tyr Pro Pro Pro Tyr Leu Asp Asn Glu Lys Ser Asn 1 5 10 15 Gly Thr Ile Ile His Val Lys Gly Lys His Leu Cys Pro Ser Pro Leu 20 25 30 Phe Pro Gly Pro Ser Lys Pro 35 <210> 11 <211> 81 <212> DNA <213> Artificial Sequence <220> <223> CD28 TM nucleotide <400> 11 ttttgggtgc tggtggtggt tggtggagtc ctggcttgct atagcttgct agtaacagtg 60 gcctttatta ttttctgggt g 81 <210> 12 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> CD28 TM amino acid <400> 12 Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu 1 5 10 15 Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val 20 25 <210> 13 <211> 123 <212> DNA <213> Artificial Sequence <220> <223> CD28 SD nucleotide <400> 13 aggagtaaga ggagcaggct cctgcacagt gactacatga acatgactcc ccgccgcccc 60 gggcccaccc gcaagcatta ccagccctat gccccaccac gcgacttcgc agcctatcgc 120 tcc 123 <210> 14 <211> 41 <212> PRT <213> Artificial Sequence <220> <223> CD28 SD amino acid <400> 14 Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr 1 5 10 15 Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro 20 25 30 Pro Arg Asp Phe Ala Ala Tyr Arg Ser 35 40 <210> 15 <211> 144 <212> DNA <213> Artificial Sequence <220> <223> CD8 alpha Hinge nucleotide <400> 15 gcgaagccca ccacgacgcc agcgccgcga ccaccaacac cggcgcccac catcgcgtcg 60 cagcccctgt ccctgcgccc agaggcgtgc cggccagcgg cggggggcgc agtgcacacg 120 agggggctgg acttcgcctg tgat 144 <210> 16 <211> 48 <212> PRT <213> Artificial Sequence <220> <223> CD8 alpha Hinge amino acid <400> 16 Ala Lys Pro Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro 1 5 10 15 Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro 20 25 30 Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp 35 40 45 <210> 17 <211> 72 <212> DNA <213> Artificial Sequence <220> <223> CD8 alpha TM nucleotide <400> 17 atctacatct gggcgccctt ggccgggact tgtggggtcc ttctcctgtc actggttatc 60 accctttact gc 72 <210> 18 <211> 24 <212> PRT <213> Artificial Sequence <220> <223> CD8 alpha TM amino acid <400> 18 Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu 1 5 10 15 Ser Leu Val Ile Thr Leu Tyr Cys 20 <210> 19 <211> 126 <212> DNA <213> Artificial Sequence <220> <223> 4-1BB SD nucleotide <400> 19 aaacggggca gaaagaaact cctgtatata ttcaaacaac catttatgag accagtacaa 60 actactcaag aggaagatgg ctgtagctgc cgatttccag aagaagaaga aggaggatgt 120 gaactg 126 <210> 20 <211> 42 <212> PRT <213> Artificial Sequence <220> <223> 4-1BB SD amino acid <400> 20 Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met 1 5 10 15 Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe 20 25 30 Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu 35 40 <210> 21 <211> 336 <212> DNA <213> Artificial Sequence <220> <223> CD3 zeta nucleotide <400> 21 agagtgaagt tcagcaggag cgcagacgcc cccgcgtacc agcagggcca gaaccagctc 60 tataacgagc tcaatctagg acgaagagag gagtacgatg ttttggacaa gagacgtggc 120 cgggaccctg agatgggggg aaagccgaga aggaagaacc ctcaggaagg cctgtacaat 180 gaactgcaga aagataagat ggcggaggcc tacagtgaga ttgggatgaa aggcgagcgc 240 cggaggggca aggggcacga tggcctttac cagggtctca gtacagccac caaggacacc 300 tacgacgccc ttcacatgca ggccctgccc cctcgc 336 <210> 22 <211> 112 <212> PRT <213> Artificial Sequence <220> <223> CD3 zeta amino acid <400> 22 Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly 1 5 10 15 Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr 20 25 30 Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35 40 45 Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys 50 55 60 Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg 65 70 75 80 Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala 85 90 95 Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 100 105 110 <210> 23 <211> 1734 <212> DNA <213> Artificial Sequence <220> <223> 501(28H)28z nucleotide <400> 23 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggca acaagatttt ggtgaagcag tcgcccatgc ttgtagcgta cgacaatgcg 840 gtcaacctta gctgcaagta ttcctacaat ctcttctcaa gggagttccg ggcatccctt 900 cacaaaggac tggatagtgc tgtggaagtc tgtgttgtat atgggaatta ctcccagcag 960 cttcaggttt actcaaaaac ggggttcaac tgtgatggga aattgggcaa tgaatcagtg 1020 acattctacc tccagaattt gtatgttaac caaacagata tttacttctg caaaattgaa 1080 gttatgtatc ctcctcctta cctagacaat gagaagagca atggaaccat tatccatgtg 1140 aaagggaaac acctttgtcc aagtccccta tttcccggac cttctaagcc cttttgggtg 1200 ctggtggtgg ttggtggagt cctggcttgc tatagcttgc tagtaacagt ggcctttatt 1260 attttctggg tgaggagtaa gaggagcagg ctcctgcaca gtgactacat gaacatgact 1320 ccccgccgcc ccgggcccac ccgcaagcat taccagccct atgccccacc acgcgacttc 1380 gcagcctatc gctccagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1440 ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1500 gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1560 gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1620 atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1680 gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg ctga 1734 <210> 24 <211> 482 <212> PRT <213> Artificial Sequence <220> <223> 501(28H)28z amino acid <400> 24 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ile Glu Val Met Tyr Pro Pro Pro Tyr 260 265 270 Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys 275 280 285 His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp 290 295 300 Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val 305 310 315 320 Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu 325 330 335 Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr 340 345 350 Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr 355 360 365 Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln 370 375 380 Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu 385 390 395 400 Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly 405 410 415 Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu 420 425 430 Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly 435 440 445 Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser 450 455 460 Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro 465 470 475 480 Pro Arg <210> 25 <211> 1734 <212> DNA <213> Artificial Sequence <220> <223> 503(28H)28z nucleotide <400> 25 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca tcgatctatc ctggtgatgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgaaaaat 360 gcgtttacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata atagtcatcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggtactt gggattctag cctgagtggt tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggca acaagatttt ggtgaagcag tcgcccatgc ttgtagcgta cgacaatgcg 840 gtcaacctta gctgcaagta ttcctacaat ctcttctcaa gggagttccg ggcatccctt 900 cacaaaggac tggatagtgc tgtggaagtc tgtgttgtat atgggaatta ctcccagcag 960 cttcaggttt actcaaaaac ggggttcaac tgtgatggga aattgggcaa tgaatcagtg 1020 acattctacc tccagaattt gtatgttaac caaacagata tttacttctg caaaattgaa 1080 gttatgtatc ctcctcctta cctagacaat gagaagagca atggaaccat tatccatgtg 1140 aaagggaaac acctttgtcc aagtccccta tttcccggac cttctaagcc cttttgggtg 1200 ctggtggtgg ttggtggagt cctggcttgc tatagcttgc tagtaacagt ggcctttatt 1260 attttctggg tgaggagtaa gaggagcagg ctcctgcaca gtgactacat gaacatgact 1320 ccccgccgcc ccgggcccac ccgcaagcat taccagccct atgccccacc acgcgacttc 1380 gcagcctatc gctccagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1440 ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1500 gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1560 gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1620 atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1680 gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg ctga 1734 <210> 26 <211> 482 <212> PRT <213> Artificial Sequence <220> <223> 503(28H)28z amino acid <400> 26 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Lys Asn Ala Phe Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Ser His Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Thr Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ile Glu Val Met Tyr Pro Pro Pro Tyr 260 265 270 Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys 275 280 285 His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp 290 295 300 Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val 305 310 315 320 Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu 325 330 335 Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr 340 345 350 Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr 355 360 365 Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln 370 375 380 Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu 385 390 395 400 Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly 405 410 415 Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu 420 425 430 Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly 435 440 445 Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser 450 455 460 Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro 465 470 475 480 Pro Arg <210> 27 <211> 1734 <212> DNA <213> Artificial Sequence <220> <223> C2G4(28H)28z nucleotide <400> 27 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtctggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cggcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatccctc ctgatagtgg tagtaaatat 240 tacgctgatt ctgtaagagg tcggttcacc gtctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgaaaaat 360 atgctgtcgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtactggctc ttcatctaat 540 attggctcca atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata atagtaagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggatcctag cctgaatggt tatgtcttcg gcggaggcac caaggtgacc 780 gtcctaggta acaagatttt ggtgaagcag tcgcccatgc ttgtagcgta cgacaatgcg 840 gtcaacctta gctgcaagta ttcctacaat ctcttctcaa gggagttccg ggcatccctt 900 cacaaaggac tggatagtgc tgtggaagtc tgtgttgtat atgggaatta ctcccagcag 960 cttcaggttt actcaaaaac ggggttcaac tgtgatggga aattgggcaa tgaatcagtg 1020 acattctacc tccagaattt gtatgttaac caaacagata tttacttctg caaaattgaa 1080 gttatgtatc ctcctcctta cctagacaat gagaagagca atggaaccat tatccatgtg 1140 aaagggaaac acctttgtcc aagtccccta tttcccggac cttctaagcc cttttgggtg 1200 ctggtggtgg ttggtggagt cctggcttgc tatagcttgc tagtaacagt ggcctttatt 1260 attttctggg tgaggagtaa gaggagcagg ctcctgcaca gtgactacat gaacatgact 1320 ccccgccgcc ccgggcccac ccgcaagcat taccagccct atgccccacc acgcgacttc 1380 gcagcctatc gctccagagt gaagttcagc aggagcgcag acgcccccgc gtaccagcag 1440 ggccagaacc agctctataa cgagctcaat ctaggacgaa gagaggagta cgatgttttg 1500 gacaagagac gtggccggga ccctgagatg gggggaaagc cgagaaggaa gaaccctcag 1560 gaaggcctgt acaatgaact gcagaaagat aagatggcgg aggcctacag tgagattggg 1620 atgaaaggcg agcgccggag gggcaagggg cacgatggcc tttaccaggg tctcagtaca 1680 gccaccaagg acacctacga cgcccttcac atgcaggccc tgccccctcg ctga 1734 <210> 28 <211> 482 <212> PRT <213> Artificial Sequence <220> <223> C2G4(28H)28z amino acid <400> 28 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr 65 70 75 80 Tyr Ala Asp Ser Val Arg Gly Arg Phe Thr Val Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Lys Asn Met Leu Ser Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Thr Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Ser Lys Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Pro Ser Leu Asn Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Val Thr Val Leu Gly Ile Glu Val Met Tyr Pro Pro Pro Tyr 260 265 270 Leu Asp Asn Glu Lys Ser Asn Gly Thr Ile Ile His Val Lys Gly Lys 275 280 285 His Leu Cys Pro Ser Pro Leu Phe Pro Gly Pro Ser Lys Pro Phe Trp 290 295 300 Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu Val 305 310 315 320 Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg Leu 325 330 335 Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro Thr 340 345 350 Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr 355 360 365 Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln 370 375 380 Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu 385 390 395 400 Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly 405 410 415 Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu 420 425 430 Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly 435 440 445 Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser 450 455 460 Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro 465 470 475 480 Pro Arg <210> 29 <211> 1008 <212> DNA <213> Artificial Sequence <220> <223> 501(8H) delta nucleotide <400> 29 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatatctaca tctgggcgcc cttggccggg 960 acttgtgggg tccttctcct gtcactggtt atcacccttt actgctga 1008 <210> 30 <211> 335 <212> PRT <213> Artificial Sequence <220> <223> 501(8H) delta amino acid <400> 30 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly 305 310 315 320 Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys 325 330 335 <210> 31 <211> 1344 <212> DNA <213> Artificial Sequence <220> <223> 501(8H)z nucleotide <400> 31 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatatctaca tctgggcgcc cttggccggg 960 acttgtgggg tccttctcct gtcactggtt atcacccttt actgcagagt gaagttcagc 1020 aggagcgcag acgcccccgc gtaccagcag ggccagaacc agctctataa cgagctcaat 1080 ctaggacgaa gagaggagta cgatgttttg gacaagagac gtggccggga ccctgagatg 1140 gggggaaagc cgagaaggaa gaaccctcag gaaggcctgt acaatgaact gcagaaagat 1200 aagatggcgg aggcctacag tgagattggg atgaaaggcg agcgccggag gggcaagggg 1260 cacgatggcc tttaccaggg tctcagtaca gccaccaagg acacctacga cgcccttcac 1320 atgcaggccc tgccccctcg ctga 1344 <210> 32 <211> 447 <212> PRT <213> Artificial Sequence <220> <223> 501(8H)z amino acid <400> 32 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly 305 310 315 320 Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys Arg 325 330 335 Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln 340 345 350 Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp 355 360 365 Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro 370 375 380 Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp 385 390 395 400 Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg 405 410 415 Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr 420 425 430 Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 435 440 445 <210> 33 <211> 1470 <212> DNA <213> Artificial Sequence <220> <223> 501(8H)BBz nucleotide <400> 33 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatatctaca tctgggcgcc cttggccggg 960 acttgtgggg tccttctcct gtcactggtt atcacccttt actgcaaacg gggcagaaag 1020 aaactcctgt atatattcaa acaaccattt atgagaccag tacaaactac tcaagaggaa 1080 gatggctgta gctgccgatt tccagaagaa gaagaaggag gatgtgaact gagagtgaag 1140 ttcagcagga gcgcagacgc ccccgcgtac cagcagggcc agaaccagct ctataacgag 1200 ctcaatctag gacgaagaga ggagtacgat gttttggaca agagacgtgg ccgggaccct 1260 gagatggggg gaaagccgag aaggaagaac cctcaggaag gcctgtacaa tgaactgcag 1320 aaagataaga tggcggaggc ctacagtgag attgggatga aaggcgagcg ccggaggggc 1380 aaggggcacg atggccttta ccagggtctc agtacagcca ccaaggacac ctacgacgcc 1440 cttcacatgc aggccctgcc ccctcgctga 1470 <210> 34 <211> 489 <212> PRT <213> Artificial Sequence <220> <223> 501(8H)BBz amino acid <400> 34 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly 305 310 315 320 Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu Tyr Cys Lys 325 330 335 Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg 340 345 350 Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro 355 360 365 Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Val Lys Phe Ser Arg Ser 370 375 380 Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu 385 390 395 400 Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg 405 410 415 Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln 420 425 430 Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr 435 440 445 Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp 450 455 460 Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala 465 470 475 480 Leu His Met Gln Ala Leu Pro Pro Arg 485 <210> 35 <211> 1476 <212> DNA <213> Artificial Sequence <220> <223> 501(8H)28z nucleotide <400> 35 atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60 ccggaggtgc agctgttgga gtccggggga ggcttggtac agcctggggg gtccctgaga 120 ctctcctgtg cagcctctgg attcaccttt agcaattatg ctatgagctg ggtccgccag 180 gctccaggga aggggctgga gtgggtctca gggatctatc ccgatagtgg tagtacatat 240 tacgctgatt ctgtaaaagg tcggttcacc atctccagag acaattccaa gaacacgctg 300 tatctgcaaa tgaacagcct gagagccgag gacacggccg tgtattactg tgcgagaaat 360 atttatacgt tcgactactg gggccagggt acactggtca ccgtgagctc aggtggaggc 420 ggttcaggcg gaggtggatc cggcggtggc ggatcgcagt ctgtgctgac tcagccaccc 480 tcagcgtctg ggacccccgg gcagagggtc accatctctt gtagtggctc ttcatctaat 540 attggcagta atgctgtctc ctggtaccag cagctcccag gaacggcccc caaactcctc 600 atctattata ataatcagcg gccaagcggg gtccctgacc gattctctgg ctccaagtct 660 ggcacctcag cctccctggc catcagtggg ctccggtccg aggatgaggc tgattattac 720 tgtggttctt gggattctag cctgagtgga tatgtcttcg gcggaggcac caagctgacg 780 gtcctaggcg cgaagcccac cacgacgcca gcgccgcgac caccaacacc ggcgcccacc 840 atcgcgtcgc agcccctgtc cctgcgccca gaggcgtgcc ggccagcggc ggggggcgca 900 gtgcacacga gggggctgga cttcgcctgt gatttttggg tgctggtggt ggttggtgga 960 gtcctggctt gctatagctt gctagtaaca gtggccttta ttattttctg ggtgaggagt 1020 aagaggagca ggctcctgca cagtgactac atgaacatga ctccccgccg ccccgggccc 1080 acccgcaagc attaccagcc ctatgcccca ccacgcgact tcgcagccta tcgctccaga 1140 gtgaagttca gcaggagcgc agacgccccc gcgtaccagc agggccagaa ccagctctat 1200 aacgagctca atctaggacg aagagaggag tacgatgttt tggacaagag acgtggccgg 1260 gaccctgaga tggggggaaa gccgagaagg aagaaccctc aggaaggcct gtacaatgaa 1320 ctgcagaaag ataagatggc ggaggcctac agtgagattg ggatgaaagg cgagcgccgg 1380 aggggcaagg ggcacgatgg cctttaccag ggtctcagta cagccaccaa ggacacctac 1440 gacgcccttc acatgcaggc cctgccccct cgctga 1476 <210> 36 <211> 491 <212> PRT <213> Artificial Sequence <220> <223> 501(8H)28z amino acid <400> 36 Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu 1 5 10 15 His Ala Ala Arg Pro Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu 20 25 30 Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe 35 40 45 Thr Phe Ser Asn Tyr Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys 50 55 60 Gly Leu Glu Trp Val Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr 65 70 75 80 Tyr Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser 85 90 95 Lys Asn Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr 100 105 110 Ala Val Tyr Tyr Cys Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly 115 120 125 Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly 130 135 140 Gly Gly Ser Gly Gly Gly Gly Ser Gln Ser Val Leu Thr Gln Pro Pro 145 150 155 160 Ser Ala Ser Gly Thr Pro Gly Gln Arg Val Thr Ile Ser Cys Ser Gly 165 170 175 Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser Trp Tyr Gln Gln Leu 180 185 190 Pro Gly Thr Ala Pro Lys Leu Leu Ile Tyr Tyr Asn Asn Gln Arg Pro 195 200 205 Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Lys Ser Gly Thr Ser Ala 210 215 220 Ser Leu Ala Ile Ser Gly Leu Arg Ser Glu Asp Glu Ala Asp Tyr Tyr 225 230 235 240 Cys Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val Phe Gly Gly Gly 245 250 255 Thr Lys Leu Thr Val Leu Gly Ala Lys Pro Thr Thr Thr Pro Ala Pro 260 265 270 Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu 275 280 285 Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr Arg 290 295 300 Gly Leu Asp Phe Ala Cys Asp Phe Trp Val Leu Val Val Val Gly Gly 305 310 315 320 Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe 325 330 335 Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn 340 345 350 Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr 355 360 365 Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Arg Val Lys Phe Ser 370 375 380 Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr 385 390 395 400 Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys 405 410 415 Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys Asn 420 425 430 Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu 435 440 445 Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly 450 455 460 His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr 465 470 475 480 Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 485 490 <210> 37 <211> 45 <212> DNA <213> Artificial Sequence <220> <223> Linker nucleotide <400> 37 ggtggaggcg gttcaggcgg aggtggatcc ggcggtggcg gatcg 45 <210> 38 <211> 15 <212> PRT <213> Artificial Sequence <220> <223> Linker amino acid <400> 38 Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 15 <210> 39 <211> 116 <212> PRT <213> Artificial Sequence <220> <223> MS501 scFv_heavy chain <400> 39 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asn Ile Tyr Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 <210> 40 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> MS501 scFv_light chain <400> 40 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Asn Asn Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp Ser Ser Leu 85 90 95 Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110 <210> 41 <211> 116 <212> PRT <213> Artificial Sequence <220> <223> MS503 scFv_heavy chain <400> 41 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Ala Phe Thr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 <210> 42 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> MS503 scFv_light chain <400> 42 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Asn Ser His Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Thr Trp Asp Ser Ser Leu 85 90 95 Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110 <210> 43 <211> 116 <212> PRT <213> Artificial Sequence <220> <223> C2G4 scFv_heavy chain <400> 43 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Arg Gly Arg Phe Thr Val Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asn Met Leu Ser Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 <210> 44 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> C2G4 scFv_light chain <400> 44 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Thr Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Ala Val Ser Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Asn Ser Lys Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp Pro Ser Leu 85 90 95 Asn Gly Tyr Val Phe Gly Gly Gly Thr Lys Val Thr Val Leu Gly 100 105 110 <210> 45 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable heavy chain CDR1 <400> 45 Asn Tyr Ala Met Ser 1 5 <210> 46 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable heavy chain CDR2 <400> 46 Gly Ile Tyr Pro Asp Ser Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys 1 5 10 15 Gly <210> 47 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable heavy chain CDR3 <400> 47 Asn Ile Tyr Thr Phe Asp Tyr 1 5 <210> 48 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable light chain CDR1 <400> 48 Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser 1 5 10 <210> 49 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable light chain CDR2 <400> 49 Tyr Asn Asn Gln Arg Pro Ser 1 5 <210> 50 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> MS501_variable light chain CDR3 <400> 50 Gly Ser Trp Asp Ser Ser Leu Ser Gly Tyr Val 1 5 10 <210> 51 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable heavy chain CDR1 <400> 51 Asn Tyr Ala Met Ser 1 5 <210> 52 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable heavy chain CDR2 <400> 52 Ser Ile Tyr Pro Gly Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys 1 5 10 15 Gly <210> 53 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable heavy chain CDR3 <400> 53 Asn Ala Phe Thr Phe Asp Tyr 1 5 <210> 54 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable light chain CDR1 <400> 54 Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser 1 5 10 <210> 55 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable light chain CDR2 <400> 55 Tyr Asn Ser His Arg Pro Ser 1 5 <210> 56 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> MS503_variable light chain CDR3 <400> 56 Gly Thr Trp Asp Ser Ser Leu Ser Gly Tyr Val 1 5 10 <210> 57 <211> 5 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable heavy chain CDR1 <400> 57 Asn Tyr Ala Met Ser 1 5 <210> 58 <211> 17 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable heavy chain CDR2 <400> 58 Gly Ile Pro Pro Asp Ser Gly Ser Lys Tyr Tyr Ala Asp Ser Val Arg 1 5 10 15 Gly <210> 59 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable heavy chain CDR3 <400> 59 Asn Met Leu Ser Phe Asp Tyr 1 5 <210> 60 <211> 13 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable light chain CDR1 <400> 60 Thr Gly Ser Ser Ser Asn Ile Gly Ser Asn Ala Val Ser 1 5 10 <210> 61 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable light chain CDR2 <400> 61 Tyr Asn Ser Lys Arg Pro Ser 1 5 <210> 62 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> C2G4_variable light chain CDR3 <400> 62 Gly Ser Trp Asp Pro Ser Leu Asn Gly Tyr Val 1 5 10
Claims (26)
A binding domain that specifically binds to mesothelin (MSLN); Signal sequence; Hinge; Transmembrane domain; And a chimeric antigen receptor (CAR) comprising an intracellular domain, wherein the chimeric antigen receptor comprises an amino acid sequence represented by SEQ ID NO: 34.
A nucleic acid encoding the chimeric antigen receptor of claim 1, wherein the nucleic acid comprises a nucleotide sequence represented by SEQ ID NO: 33. A nucleic acid encoding a chimeric antigen receptor.
An expression vector comprising the nucleic acid of claim 2.
A virus comprising the expression vector of claim 3.
An immune cell expressing the chimeric antigen receptor of claim 1 on the surface.
The immune cell according to claim 5, wherein the immune cell is a T cell, an NK cell, or an NKT cell.
A composition for treating cancer or tumor comprising the immune cells of claim 5.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020190077161A KR102216225B1 (en) | 2019-06-27 | 2019-06-27 | Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020190077161A KR102216225B1 (en) | 2019-06-27 | 2019-06-27 | Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020190007422A Division KR102070016B1 (en) | 2019-01-21 | 2019-01-21 | Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20200090598A KR20200090598A (en) | 2020-07-29 |
KR102216225B1 true KR102216225B1 (en) | 2021-02-17 |
Family
ID=71893727
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020190077161A KR102216225B1 (en) | 2019-06-27 | 2019-06-27 | Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR102216225B1 (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102309543B1 (en) * | 2020-08-04 | 2021-10-07 | 주식회사 셀렌진 | Anti-mesothelin chimeric antibody receptor specifically binding to mesothelin |
AU2021245153B2 (en) | 2020-08-04 | 2022-06-30 | Cellengene Inc | Anti-mesothelin chimeric antigen receptor specifically binding to mesothelin |
JP7487989B2 (en) | 2021-05-26 | 2024-05-21 | セレンジーン インコーポレイテッド | Chimeric antigen receptor containing anti-mesothelin scFv and uses thereof |
WO2024096592A1 (en) * | 2022-11-02 | 2024-05-10 | 주식회사 셀렌진 | Chimeric antigen receptor with increased affinity for methothelin and use thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101782487B1 (en) * | 2015-09-24 | 2017-09-27 | 재단법인 목암생명과학연구소 | Novel Antibody Binding to Mesothelin(MSLN), and Composition Comprising the Same |
CN107793483A (en) | 2016-09-06 | 2018-03-13 | 伍志强 | Chimeric antigen receptor and its gene and recombinant expression carrier, CARMSLN NKT cells and its preparation method and application |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20160098259A (en) * | 2013-12-19 | 2016-08-18 | 노파르티스 아게 | Human mesothelin chimeric antigen receptors and uses thereof |
-
2019
- 2019-06-27 KR KR1020190077161A patent/KR102216225B1/en active IP Right Grant
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR101782487B1 (en) * | 2015-09-24 | 2017-09-27 | 재단법인 목암생명과학연구소 | Novel Antibody Binding to Mesothelin(MSLN), and Composition Comprising the Same |
CN107793483A (en) | 2016-09-06 | 2018-03-13 | 伍志强 | Chimeric antigen receptor and its gene and recombinant expression carrier, CARMSLN NKT cells and its preparation method and application |
Also Published As
Publication number | Publication date |
---|---|
KR20200090598A (en) | 2020-07-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102070016B1 (en) | Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor | |
JP6923714B2 (en) | T cell receptor that recognizes MHC class II restrictive MAGE-A3 | |
JP7004470B2 (en) | Chimeric antigen receptor targeting CD-19 | |
KR102216225B1 (en) | Mesothelin-specific chimeric antigen receptor and T lymphocyte expressing this chimeric antigen receptor | |
EP3645568B1 (en) | Anti-b-cell maturation antigen chimeric antigen receptors with human domains | |
US11034763B2 (en) | Flag tagged CD19-CAR-T cells | |
CN108884164B (en) | Modified cells for immunotherapy | |
WO2017219937A1 (en) | Car-t cell for efficiently and stably expressing inhibiting antibody and application thereof | |
JP2022169543A (en) | Improved adoptive T-cell therapy | |
WO2017219936A1 (en) | Car-t cell capable of efficiently and stably expressing activated antibody, and uses thereof | |
CN110300603B (en) | CD47-CAR-T cells | |
WO2022078286A1 (en) | Chimeric antigen receptor which specifically binds to msln, and application thereof | |
KR102157701B1 (en) | Chimeric antibody receptor to which anti-cotinine antibody is linked and uses thereof | |
KR20180131557A (en) | Inhibition of TGF beta in immunotherapy | |
KR20160016725A (en) | CHIMERIC ANTIGEN RECEPTOR-MODIFIED T CELLS TARGETING IL13Rα2 ON TUMORS | |
CN114729026B (en) | Chimeric Antigen Receptor (CAR) T cells for stabilization of immune synapses | |
CN115397867A (en) | EPCAM antibodies and CAR-T cells | |
KR20210108290A (en) | Mesothelin-specific chimeric antigen receptor and Uses Thereof | |
KR20210098148A (en) | Fusion protein comprising anti-tumor-associated antigen antibody, anti-pd-l1 antibody and il-2 and uses thereof | |
EP4047021A1 (en) | Ox40/pd-l1 bispecific antibody | |
WO2023186077A1 (en) | Anti-pd-1 monoclonal antibody, derivative thereof and use thereof | |
RU2777573C2 (en) | Antibodies against human 4-1bb and their use | |
KR20190141511A (en) | New peptide, chemeric antigen receptor and immune cell expressing the same | |
KR20230033097A (en) | Novel Chimeric Antigen Receptor(CAR) with Enhanced Function | |
JP2022526194A (en) | FLT3-specific chimeric antigen receptor and its usage |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |