KR102195957B1 - Anti-Ang2 antibody inducing binding to Tie2 receptor - Google Patents

Abstract

Anti-Ang2 antibody or antigen-binding fragment thereof, which specifically binds to angiopoietin-2 (Ang2), an angiogenesis inducer, and binds to Tie2 receptor with Ang2, and uses thereof are provided. .

Description

Anti-Ang2 antibody inducing binding to Tie2 receptor}

Anti-Ang2 antibody or antigen-binding fragment thereof, which specifically binds to angiopoietin-2 (Ang2), an angiogenesis inducer, and binds to Tie2 receptor with Ang2, and uses thereof are provided. .

Angiopoietin-2 (Ang2) is an antagonistic ligand of Tie2 receptor present in vascular endothelial cells, and angiopoietin-1 (Angiopoietin-1), an agonist of Tie2. ; It acts to inhibit signaling by Tie2 by competing for Ang1) and Tie2 binding. Ang1, a ligand that activates the Tie2 receptor, acts as a key regulator that maintains stabilization of blood vessels by maintaining the barrier function of vascular endothelial cells. In the state of overexpression or inflammation of VEGF, vascular endothelial cells are activated, and vascular permeability is increased. At this time, Ang1 promotes the junctional integrity of vascular endothelial cells, thereby inducing stabilization of vascular endothelial cells and reducing vascular permeability, while Ang2 increased in activated vascular endothelial cells competes with Ang1, resulting in blood vessels caused by Ang1. It plays a role in inhibiting endothelial cell stabilization. Therefore, Ang2 inhibits Ang1-Tie2 binding, which maintains the stability of vascular endothelial cells, and signaling through it, as a result, promotes angiogenesis through dynamic rearrangement of blood vessels.

Since the neovascularization process is an essential element in the growth of cancer, it is known by the studies of several preclinical models that it can prevent the further growth of cancer by inhibiting the angiogenesis by inhibiting the above Tie2-dependent Ang2 function. Various attempts have been made to prevent the progression of cancer using anti-Ang2 antibodies.

Ang2 overexpression has been reported in various solid and hematologic cancers, and the level of Ang2 expression in serum is also a biomarker of poor prognosis. In addition to cancer, overexpression of Ang2 has been reported in various diseases such as sepsis, bacterial infection, lung injury, and kidney injury. Among them, there is a relationship with vascular leakage. It has been studied a lot. Due to its association with these pathological conditions, Ang2 has been considered as an important target in therapeutic intervention. Currently, a number of drugs are being developed in the clinical or preclinical stage, and their forms are diverse, such as peptibody, bispecific antibody, and monoclonal antibody.

However, most of these Ang2 targeting drugs have a mechanism of action that inhibits the activation of Tie2 receptors and downstream signaling by inhibiting the binding of Ang2 to the Tie2 receptor.

An example of the present invention is an anti-Ang2 antibody or antigen-binding fragment thereof that specifically binds to Ang2 (Angiopoietin-2), an angiogenesis inducer, and binds to Tie2 receptor with Ang2 to induce activation of Tie2 receptor. to provide.

Another example provides a hybridoma cell line that produces a monoclonal antibody of the anti-Ang2 antibody.

Another example provides an anti-Ang2 antibody-Ang2 complex in which the anti-Ang2 antibody or antigen-binding fragment thereof and Ang2 are bound.

Another example provides a composition for activating Tie2 receptors comprising the anti-Ang2 antibody-Ang2 complex as an active ingredient.

Another example provides a pharmaceutical composition for inhibiting angiogenesis, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient.

Another example provides a pharmaceutical composition for reducing vascular permeability comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient.

Another example provides a pharmaceutical composition for inducing normal angiogenesis, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient.

Another example provides a pharmaceutical composition for the treatment of diseases associated with neovascularization, vascular permeability, and/or reduction of normal angiogenesis, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient.

Another example provides a pharmaceutical composition for Ang2 inhibition and/or Tie2 receptor activation comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient.

Another example provides a composition for diagnosis of diseases related to Ang2 overexpression, including the anti-Ang2 antibody or antigen-binding fragment thereof.

Another example provides a complex to which the anti-Ang2 antibody or antigen-binding fragment thereof, Ang2, and Tie2 receptors are bound.

The present inventors specifically bind Ang2, but do not inhibit the binding of Ang2 and Tie2 receptors, and the antibody that forms a complex (antibody/Ang2/Tie2) with Ang2 and Tie2 receptors induces dimerization of the antibody. And it was confirmed that the Tie2 receptor complexed thereto can be effectively clustered, thereby inducing activation of the Tie2 receptor and its downstream signaling. Antibodies with this mechanism of action inhibit Ang2 function by inducing intracellular migration and degradation by binding with Ang2 to lower the circulating Ang2 level. At the same time, it binds to the Tie2 receptor with Ang2 and binds to the Tie2 receptor like Ang1. It has a dual function of inducing Tie2 downstream signaling by activating Tie2 and inducing stabilization of vascular endothelial cells.

The present invention relates to a therapeutic antibody targeting Ang2, an angiogenesis inducer, which inhibits the function of Ang2 by specifically binding to Ang2, and binds to Tie2 together with Ang2 to induce the activation of Tie2. It relates to anti-Ang2 antibodies. The anti-Ang2 antibody binds to the Tei2 receptor with Ang2 and activates the Tei2 receptor together with Ang2 downregulation in diseases related to abnormal activation and dysfunction of blood vessels such as cancer, sepsis, and eye disease. It has the effect of treating diseases by inducing structural/functional normalization of

Specifically, an example of the present invention provides an anti-Ang2 antibody or an antigen-binding fragment thereof that specifically binds (recognizes) to Ang2 (Angiopoietin-2), an angiogenesis inducer, and binds to the Tie2 receptor together with Ang2. do. That is, the anti-Ang2 antibody or antigen-binding fragment thereof may specifically recognize Ang2 and bind to both Ang2 and Tie2 receptors. In addition, the anti-Ang2 antibody or antigen-binding fragment thereof may induce activation of the Tie2 receptor. Such activation of Tie2 receptor increases phosphorylation of Tie2 receptor and/or phosphorylation of at least one selected from the group consisting of proteins related to signaling pathways below it, such as Akt (NM_005163), eNOS (NM_000603), 42/44 (NM_002745), etc. Can be induced by In addition, the anti-Ang2 antibody or antigen-binding fragment thereof may be one that induces intracellular migration of Tie2 receptors (internalization). That is, the anti-Ang2 antibody or antigen-binding fragment thereof specifically binds to Ang2, but unlike conventional anti-Ang2 antibodies, it does not inhibit the binding of Ang2 and Tie2 receptors, thereby binding to the Tie2 receptor with Ang2 The Ang2 protein, which acts as an antigen of the antibody provided in the present invention, is closely related to the formation of angiogenesis and is a soluble ligand that exists in the blood, and can be used to induce the activation of the Tie2 receptor. ), cancer metastasis (metastasis), cancer cell invasion (invasion) extensively. The Ang2 may be derived from mammals such as humans, primates such as monkeys, rodents such as mice and rats, for example, human Ang2 (eg, NCBI Accession No. O15123, etc.), monkey Ang2 (eg, NCBI Accession No. Q8MIK6) Etc.), mouse Ang2 (eg, NCBI Accession No. O35608, etc.), rat Ang2 (eg, NCBI Accession No. O35462, etc.), but is not limited thereto.

Tie2 receptor (TEK tyrosine kinase) is an angiopoietin-1 receptor, and is expressed in endothelial cells of various mammals such as mice (NM_013690; NP_038718), rats, humans (NM_000459; NP_000450), and various It is involved in downstream signaling.

As described above, the anti-Ang2 antibody or antigen-binding fragment thereof provided in the present invention binds specifically to Ang2, but does not inhibit the binding of Ang2 and Tie2 receptors, and complexes with Ang2 and Tie2 receptors (antibody/Ang2/Tie2) The antibody constituting the Tie2 has the property of inducing dimerization of the antibody, through which the Tie2 receptor complexed thereto are effectively clustered, thereby activating the Tie2 receptor and its downstream signaling. It is characterized in that it can induce. Due to this mechanism of action, the antibody or antigen-binding fragment thereof of the present invention inhibits Ang2 function by binding to Ang2 and inducing intracellular migration (internalization) and degradation, thereby lowering the circulating Ang2 level, together with Ang2. By binding to Tie2 receptor and activating Tie2 receptor like Ang1, it has a dual function that induces stabilization of vascular endothelial cells, resulting in symptoms (diseases) caused by Ang2 overexpression, as well as decreased stabilization of vascular endothelial cells, that is, vascular permeability It can also be usefully used to treat symptoms (diseases) caused by increase.

The anti-Ang2 antibody or antigen-binding fragment thereof is all or part of (e.g., a loop) of loop 1 (a site from the 417th amino acid to the 434th amino acid in SEQ ID NO: 11) of human Ang2 (hAng2; SEQ ID NO: 11; Accession # O15123) One or more amino acid residues selected from the group consisting of amino acid residues exposed to the outside) or 2 to 20 consecutive or non-contiguous 2 to 20 containing at least one amino acid residue exposed to the outside of loop 1 in SEQ ID NO: 11 An amino acid sequence site including from 15 to 15, 2 to 10, or 2 to 5 amino acids may be recognized as an epitope, or may be specifically binding to this site.

Ang2 (SEQ ID NO: 11)

MWQIVFFTLS CDLVLAAAYN NFRKSMDSIG KKQYQVQHGS CSYTFLLPEM DNCRSSSSPY

VSNAVQRDAP LEYDDSVQRL QVLENIMENN TQWLMKLENY IQDNMKKEMV EIQQNAVQNQ

TAVMIEIGTN LLNQTAEQTR KLTDVEAQVL NQTTRLELQL LEHSLSTNKL EKQILDQTSE

INKLQDKNSF LEKKVLAMED KHIIQLQSIK EEKDQLQVLV SKQNSIIEEL EKKIVTATVN

NSVLQKQQHD LMETVNNLLT MMSTSNSAKD PTVAKEEQIS FRDCAEVFKS GHTTNGIYTL

TFPNSTEEIK AYCDMEAGGG GWTIIQRRED GSVDFQRTWK EYKVGFGNPS GEYWLGNEFV

SQLTNQQRYV LKIHLKDWEG NEAYSLYEHF YLSSEELNYR IHLKGLTGTA GKISSISQPG

NDFSTKDGDN DKCICKCSQM LTGGWWFDAC GPSNLNGMYY PQRQNTNKFN GIKWYYWKGS

GYSLKATTMM IRPADF

For example, the anti-Ang2 antibody is contiguous or non-contiguous comprising amino acid residues of Q418, P419, Q418 and P419 located in loop 1 of SEQ ID NO: 11, or a combination of Q418, P419, Q418 and P419 in SEQ ID NO: 11 The amino acid sequence region including 2 to 20, 2 to 15, 2 to 10, or 2 to 5 amino acids that is not recognized as an epitope may be recognized as an epitope or specifically bind to this site. In one example, the anti-Ang2 antibody may recognize amino acid residues of Q418 and P419 of SEQ ID NO: 11 as an epitope, or specifically bind to this portion.

Q418, P419, or an amino acid moiety including the same, which is a site to which the anti-Ang2 antibody specifically binds, is an exposed amino acid residue located in loop 1 of the three-dimensional structure of Ang2, and is directly involved in the binding between Ang2 and Tie2 receptors or , It is believed to be the site that regulates it.

In Q418, P419, or an amino acid moiety containing the anti-Ang2 antibody specifically binding sites, "non-contiguous amino acids" are adjacent to each other in the secondary or tertiary structure of the protein, but are not contiguous in the amino acid sequence. It may mean an amino acid that is not. Therefore, in the present specification, "contiguous or non-contiguous amino acid residues" may mean consecutive amino acid residues on the primary, secondary or tertiary structure of a protein.

In addition, not only the anti-Ang2 antibody that recognizes and/or specifically binds the site, but also the antibody or antigen-binding fragment thereof competitively binding with the anti-Ang2 antibody inhibits Ang2 and at the same time forms a complex with Ang2 and Tie2 receptors. (Ie, antibody-Ang2 binds to the Tie2 receptor), Tie2 can be activated. The antibody that binds competitively as described above may be an antibody that recognizes a region adjacent to the aforementioned region and a three-dimensional structure as an epitope and/or a specific binding region. The competitively binding antibody may have a binding affinity with Ang2 of 0.1 pM to 50 nM, specifically 1 pM to 30 nM, 2 pM to 20 nM, or 1 nM to 10 nM.

Accordingly, the anti-Ang2 antibody or antigen-binding fragment thereof of the present invention may be one or more selected from the group consisting of an antibody or antigen-binding fragment that recognizes the above-described site as an epitope or specifically binds thereto.

In an embodiment, the anti-Ang2 antibody or antigen-binding fragment thereof,

A polypeptide comprising the amino acid sequence of SEQ ID NO: 1 (CDR-H1), a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 (CDR-H2), and a polypeptide comprising the amino acid sequence of SEQ ID NO: 3 (CDR-H3 ) A heavy chain complementarity determining region (CDR) comprising at least one selected from the group consisting of, or a heavy chain variable region comprising the heavy chain complementarity determining region:

A polypeptide comprising the amino acid sequence of SEQ ID NO: 4 (CDR-L1), a polypeptide comprising the amino acid sequence of SEQ ID NO: 5 (CDR-L2), and a polypeptide comprising the amino acid sequence of SEQ ID NO: 6 (CDR-L3 ) A light chain complementarity determining region including at least one selected from the group consisting of, or a light chain variable region including the light chain complementarity determining region;

A combination of the at least one heavy chain complementarity determining region and at least one light chain complementarity determining region; or

Combination of the heavy chain variable region and light chain variable region

It may include:

More specifically, the anti-Ang2 antibody or antigen-binding fragment thereof

A polypeptide comprising the amino acid sequence of SEQ ID NO: 1 (CDR-H1), a polypeptide comprising the amino acid sequence of SEQ ID NO: 2 (CDR-H2), and a polypeptide comprising the amino acid sequence of SEQ ID NO: 3 (CDR-H3 ) A heavy chain complementarity determining region, or a heavy chain variable region comprising the heavy chain complementarity determining region: and

A polypeptide comprising the amino acid sequence of SEQ ID NO: 4 (CDR-L1), a polypeptide comprising the amino acid sequence of SEQ ID NO: 5 (CDR-L2), and a polypeptide comprising the amino acid sequence of SEQ ID NO: 6 (CDR-L3 ) Light chain complementarity determining region, or light chain variable region including the light chain complementarity determining region

It may be to include.

Specifically, the heavy chain complementarity determining site of the anti-Ang2 antibody or antigen-binding fragment thereof may be, for example, one having the amino acid sequence shown in Table 1 below.

Heavy chain CDR amino acid sequence CDRH1-KABAT CDRH2-KABAT CDRH3-KABAT SDYAWN
(SEQ ID NO: 1) YINYSGNTDYNPSLKS
(SEQ ID NO: 2) GNFEGAMDY
(SEQ ID NO:3)

In addition, the light chain complementarity determining site of the anti-Ang2 antibody or antigen-binding fragment thereof may be, for example, one having the amino acid sequence shown in Table 2 below.

Light chain CDR amino acid sequence CDRL1-KABAT CDRL2-KABAT CDRL3-KABAT KASQSVSNDVA
(SEQ ID NO: 4) YASNRYP
(SEQ ID NO: 5) QQDYSSPWT
(SEQ ID NO: 6)

In one embodiment, the heavy chain variable region of the antibody or antigen-binding fragment thereof may include the amino acid sequence of SEQ ID NO: 7:

VQLQESGPGLVKPSQSLSLTCTVTGYSIT SDYAWN WIRQFPGNKLEWMG YINYSGNTDYNPSLKS RSSITRDTSKNQFFLQLNSVTTGDTATYYCAR GNFEGAMDY WG (SEQ ID NO: 7)

(In SEQ ID NO: 7, the underlined bold letters are CDRH1, CDRH2, CDRH3 in order)

The light chain of the antibody according to one embodiment may include the amino acid sequence of SEQ ID NO: 9.

SIVMTQTPKFLLVSAGDRVTITC KASQSVSNDVA WYQQKPGQSPKLLIY YASNRYP GVPDRFTGSGYGTDFTFTISTVQAEDLAVYFC QQDYSSPWT FGGGTKLEIK (SEQ ID NO: 9)

(In SEQ ID NO: 9, the underlined bold letters are CDRL1, CDRL2, CDRL3 in order)

Therefore, the anti-Ang2 antibody or antigen-binding fragment thereof is a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7, a light chain variable region comprising the amino acid sequence of SEQ ID NO: 9, or a combination of the heavy chain variable region and the light chain variable region It may be included.

For example, the anti-Ang2 antibody or antigen-binding fragment thereof may include a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 9.

In one example, the anti-Ang-2 antibody or antigen-binding fragment thereof may not be composed of only one or more amino acid sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 5.

In another example, candidate substances, such as anti-Ang2 antibodies, for diagnosis, prevention and/or treatment of diseases associated with Ang2 overexpression, neovascularization, vascular permeability, and/or reduction of normal angiogenesis, using the epitope described above. A method of screening is provided. The screening method,

(a) contacting the candidate compound with the epitope of the tertiary structure of angiopoietin-2 described above; And

(b) measuring the binding force between the epitope and the candidate compound

It may include.

The screening method may further include the step of (c) confirming the binding between Ang2 and Tie2 receptors. The step (c) is to determine whether the candidate compound inhibits the binding between the Ang2 and Tie2 receptors, and may be performed before, after, or simultaneously with the step (b). Through the step c), it is possible to screen an anti-Ang2 antibody that does not inhibit the binding between Ang2 and Tie2 receptors while binding to Ang2, that is, has a property of inducing binding between Ang2 and Tie2 receptors.

In addition, the screening method may further include the step of (d) confirming the inhibition of Ang2 and/or the activation of the Tie2 receptor, and the order in which it is included is not limited. Through the step d), it binds to Ang2 and inhibits its activity, but it binds to Ang2 to induce binding between Ang2 and Tie2 receptors, and an anti-Ang2 antibody that exhibits an effect of activating Tie2 receptors such as Ang1 can be screened.

In the above screening method. When the epitope and the candidate compound exhibit a binding force (kd) of 10 nM or less, for example, in the range of 0.1 pM to 10 nM, or in the range of 10 pM to 10 nM, or 100 pM to 10 nM, or the epitope and the candidate compound are When the binding between Ang2 and Tie2 receptors is confirmed while showing the same avidity (i.e., the candidate compound does not inhibit the binding between Ang2 and Tie2 receptors), the candidate compound is overexpressed in Ang2, angiogenesis, vascular permeability enhancement, and / Or can be determined as a candidate substance for diagnosis, prevention, and / or treatment of a disease associated with reduction of normal angiogenesis, such as an anti-Ang2 antibody candidate substance.

The epitope is all, part (e.g., outside of loop 1) of loop 1 (a site from the 417th amino acid to the 434th amino acid in SEQ ID NO: 11) of human Ang-2 (hAng-2; SEQ ID NO: 11; Accession # O15123) At least one selected from the group consisting of amino acid residue sites exposed to), or 2 to 20, 2 to 15 consecutive or non-contiguous including at least one amino acid residue exposed to the outside of loop 1 in SEQ ID NO: 11 , Or may be an amino acid sequence site comprising 2 to 10 amino acids, for example, a combination of Q418, P419, Q418 and P419 located in loop 1 of SEQ ID NO: 11, or two consecutive or non-contiguous It may be one or more selected from the group consisting of an amino acid sequence portion comprising from 20 to 20, 2 to 15, 2 to 10, or 2 to 5 amino acids.

The candidate compounds are artificially synthesized or natural various compounds, polypeptides, oligopeptides, peptides or protein structures (e.g., antibodies, peptibodies, nanobodies, etc.), polynucleotides, oligonucleotides, antisense-RNA, shRNA (short hairpin RNA), siRNA (small interference RNA), aptamer, may be one or more selected from the group consisting of natural extracts.

The step of measuring the binding force between the epitope and the candidate compound may be performed through various methods known in the art. For example, the bonding force can be measured using a Biacore device. In general, as a therapeutic drug, the range in which the binding force is recognized may be defined as a KD value, which is a binding constant, of 10 nM or less. That is, for example, when the binding force of the epitope of angiopoietin-2 described above and the sample to be analyzed (eg, antibody) is measured by a Surface Plasmon Resonance method such as a Biacore device, In the case of 0.1 pM to 50 nM, specifically 0.5 pM to 35 nM, and more specifically 1 pM to 10 nM, the sample (e.g., antibody) is subjected to Ang2 overexpression, neovascularization, vascular permeability enhancement, and/or reduction of normal angiogenesis. It can be determined as a candidate substance for diagnosis, prevention and/or treatment of related diseases.

Confirmation of the binding between Ang2 and Tie2, inhibition of Ang2, and activation of the Tie2 receptor will be described later.

In another example, a heavy chain complementarity determining site, a light chain complementarity determining site, or a combination thereof of the anti-Ang2 antibody described above; Alternatively, a polypeptide molecule comprising a heavy chain variable region, a light chain variable region, or a combination thereof is provided. The polypeptide molecule can function as a precursor or constituent of an antagonist for Ang2, as well as for the production of an antibody or antigen-binding fragment thereof. For example, the polypeptide molecule may serve as an Ang2 antigen binding site, and a protein scaffold having a structure similar to an antibody (such as a peptibody, a nanobody, etc.), a bispecific antibody, a multispecific antibody, etc. It can be included as an ingredient.

The term “antagonist” is to be interpreted as a concept to include any molecule that partially or completely blocks, inhibits or neutralizes one or more of the biological activities of a target (eg, Ang2).

The term "peptide + antibody" is a fusion protein in which all or part of a constant region such as an Fc portion of a peptide and an antibody is fused, and the peptide is an antigen binding site (heavy and/or light chain CDRs or variable regions). By acting, it refers to a protein that has a similar framework and function to an antibody.

The term "nanobody" is also referred to as a single-domain antibody, and refers to an antibody fragment containing a single variable domain of an antibody in a monomeric form, and selectively binds to a specific antigen similar to a complete antibody It has the characteristics of The molecular weight of the Nanobody is generally about 12 kDa to about 15 kDa, which is very small compared to the typical molecular weight (about 150 kDa to about 160 kDa) of a complete antibody (including two heavy and two light chains), and in some cases Is smaller than the Fab fragment or scFv fragment.

The term “bispecific antibody” or “multispecific antibody” recognizes and/or binds two (bispecific antibodies) or more (multispecific antibodies) different antigens, or recognizes different sites of the same antigen and/or It refers to an antibody that binds, and one of the bispecific antibodies or multispecific antibodies may include the polypeptide.

In an embodiment, the polypeptide molecule is

At least one selected from the group consisting of a polypeptide comprising the amino acid sequence of SEQ ID NO: 1, a polypeptide comprising the amino acid sequence of SEQ ID NO: 2, and a polypeptide comprising the amino acid sequence of SEQ ID NO: 3;

At least one selected from the group consisting of a polypeptide comprising the amino acid sequence of SEQ ID NO: 4, a polypeptide comprising the amino acid sequence of SEQ ID NO: 6, and a polypeptide comprising the amino acid sequence of SEQ ID NO: 6; or

A combination of these

It may be to include.

In an embodiment, the polypeptide molecule may include the amino acid sequence of SEQ ID NO: 8, the amino acid sequence of SEQ ID NO: 9, or a combination thereof.

In one example, the polypeptide molecule may not consist of only one or more amino acid sequences selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 5.

As described above, the bispecific antibody or multispecific antibody is an antibody that simultaneously recognizes and/or binds two or more antigens, including respective antigen binding sites for two or more different antigens. As, one of the antigen-binding sites may include the aforementioned polypeptide molecule. Specifically, the polypeptide molecule serving as the Ang2 antigen-binding site may form a dimer or multimer with an antigen-binding site for another antigen to form a bispecific antibody or a multispecific antibody. Thus, in one embodiment, a bispecific antibody or a multispecific antibody comprising the polypeptide molecule as an Ang2 antigen binding site is provided.

In another example, a polypeptide having a structural function with one or more polypeptide molecules described above or a repeat (hereinafter, referred to as'first peptide') in which the polypeptide molecules are repeatedly linked by a linker (hereinafter, referred to as'second peptide') ; For example, one or more peptide complexes (e.g. 1 to 5, or 2 to 4) containing the constant region of the heavy or light chain of an antibody (IgG, IgA, IgE, IgD, IgM, etc.), or an Fc fragment of an antibody ), and the one or more peptide complexes are bound in a second peptide (eg, an Fc fragment) to provide a protein skeleton having a multimeric structure.

In the present invention, the antibody includes all of animal-derived antibodies, chimeric antibodies, humanized antibodies, and human antibodies. Animal-derived antibodies produced by immunizing a desired antigen to an immunized animal can generally cause an immune rejection reaction when administered to humans for therapeutic purposes, and a chimeric antibody has been developed to suppress this immune rejection reaction. Chimeric antibodies are those obtained by substituting a constant region of an animal-derived antibody that causes an anti-isotype reaction with a constant region of a human antibody using a genetic engineering method. Chimeric antibodies are significantly improved in anti-isotype response compared to animal-derived antibodies, but animal-derived amino acids are still present in the variable region, implying side effects for potential anti-idiotypic reactions. Are doing. Humanized antibodies were developed to improve these side effects. This is produced by grafting complementaritiy determining regions (CDRs), which play an important role in antigen binding among the variable regions of a chimeric antibody, into a human antibody framework.

The most important thing in the CDR grafting technology for producing humanized antibodies is to select an optimized human antibody that can best accept the CDR regions of an animal-derived antibody, and for this purpose, the use of an antibody database and crystal structure structure) and molecular modeling techniques are used. However, even if the CDR regions of an animal-derived antibody are transplanted into the optimized human antibody skeleton, there are cases where amino acids that are located in the skeleton of the animal-derived antibody and affect antigen binding are present. Therefore, it can be said that the application of additional antibody engineering techniques to restore antigen binding capacity is essential.

According to one embodiment, the antibody may be a mouse-derived antibody, a mouse-human chimeric antibody, a humanized antibody, or a human antibody.

In the present invention, the term "antibody" refers to a substance produced by stimulation of an antigen in the immune system, and its kind is not particularly limited. Antibodies have recently been widely used as therapeutic agents for diseases. Antibodies are very stable in vitro as well as in vivo and have a long half-life, which is advantageous for mass expression and production. In addition, since the antibody essentially has a dimer structure, the avidity is very high.

A complete antibody has two full-length light chains and two full-length heavy chains, and each light chain is linked to a heavy chain by a disulfide bond. The constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region has gamma (γ), mu (μ), alpha (α), delta (δ), and epsilon (ε) types, and subclasses It has gamma 1 (γ1), gamma 2 (γ2), gamma 3 (γ3), gamma 4 (γ4), alpha 1 (α1) and alpha 2 (α2). The constant region of the light chain has kappa (κ) and lambda (λ) types.

The term "heavy chain" refers to a variable region domain V _H and three constant region domains C _H1 , C _H2 and C _H3 comprising an amino acid sequence having a sufficient variable region sequence to confer antigen specificity and a hinge ( hinge), and its fragments. In addition, the term "light chain" refers to both a full-length light chain and fragments thereof comprising a variable region domain V _L and a constant region domain C _L comprising an amino acid sequence having a sufficient variable region sequence to confer antigen specificity. It is interpreted to mean including.

The term "complementarity determining region (CDR)" refers to an amino acid sequence of a hypervariable region of an immunoglobulin heavy and light chain. Each of the heavy and light chains may comprise three CDRs (CDRH1, CDRH2, CDRH3 and CDRL1, CDRL2, CDRL3). The CDRs can provide key contact residues for the antibody to bind to an antigen or epitope. On the other hand, in the present specification, the terms "specifically bind" or "specifically recognize" are the same as those commonly known to those skilled in the art, and the antigen and antibody specifically interact to cause an immunological reaction. Means that.

The antigen-binding fragment of the antibody provided in the present invention may be a fragment including one or more of the complementarity determining regions.

The term "antigen-binding fragment" refers to a fragment thereof for the entire structure of an immunoglobulin, and refers to a portion of a polypeptide including a portion to which an antigen can bind. For example, it may be scFv, (scFv) ₂ , scFv-Fc, Fab, Fab' or F(ab') ₂ , but is not limited thereto.

Among the antigen-binding fragments, Fab has a structure having a variable region of a light chain and a heavy chain, a constant region of a light chain, and a first constant region of a heavy chain (C _H1 ), and has one antigen-binding site. Fab' differs from Fab in that it has a hinge region containing at least one cysteine residue at the C-terminus of the heavy chain C _H1 domain. F(ab') ₂ antibodies are produced by disulfide bonds between cysteine residues in the hinge region of Fab'. Fv is the smallest antibody fragment having only a heavy chain variable region and a light chain variable region. Recombination techniques for generating Fv fragments are well known in the art. The double-chain Fv (two-chain Fv) is a non-covalent bond where the heavy chain variable region and the light chain variable region are connected, and the single-chain Fv (single-chain Fv) is generally shared by the variable region of the heavy chain and the variable region of the single chain through a peptide linker. It is linked by a bond or is directly linked at the C-terminus to form a dimer-like structure such as a double-chain Fv. The linker may be a peptide linker consisting of 1 to 100 or 2 to 50 amino acids, and suitable sequences are known in the art. The antigen-binding fragment can be obtained using proteolytic enzymes (e.g., Fab can be obtained by restriction digestion of the whole antibody with papain, and F(ab') ₂ fragment can be obtained by digestion with pepsin), It can be produced through gene recombination technology.

The term "hinge region" refers to a region included in the heavy chain of an antibody, which exists between the CH1 and CH2 regions, and functions to provide flexibility of the antigen-binding site in the antibody. For example, the hinge may be derived from a human antibody, and specifically, may be derived from IgA, IgE, or IgG, such as IgG1, IgG2, IgG 3, or IgG4.

When an animal-derived antibody undergoes a chimerization process, the animal-derived IgG1 hinge is replaced with a human IgG1 hinge, but the animal-derived IgG1 hinge is shorter than that of the human IgG1 hinge, and the disulfide bond between the two heavy chains ( disulfide bond) decreases from 3 to 2, resulting in different effects of the rigidity of the hinge. Therefore, modification of the hinge region can increase the antigen binding efficiency of the humanized antibody. Methods for deletion, addition or substitution of amino acids to modify the amino acid sequence of the hinge region are well known to those skilled in the art.

The portion excluding the variable region of the anti-Ang2　 antibody may be a constant region derived from a human antibody, and specifically, may be a constant region derived from IgA, IgE, or IgG, such as IgG1, IgG2, IgG 3, or IgG4. .

The anti-Ang2? antibody may be a monoclonal antibody. Monoclonal antibodies can be prepared according to methods well known in the art. For example, it can be manufactured using a phage display technique. Alternatively, the anti-Ang2 antibody can be prepared as a mouse-derived monoclonal antibody by the method described in Schwaber et al. using a mouse monoclonal antibody (Schwaber, J and Cohen, EP, "Human x Mouse Somatic Cell Hybrid Clones Secreting Immunoglobulins of Both Parental Types," Nature, 244 (1973), 444-447).

Meanwhile, individual monoclonal antibodies can be screened based on the ability to bind to Ang2 using a typical ELISA (Enzyme-Linked ImmunoSorbent Assay) format. Inhibitory activity can be assayed for inhibitory activity through functional assays, such as competitive ELISA (Competitive ELISA), or functional assays such as cell-based assays to assay molecular interactions for conjugates. Then, each affinity (Kd values) for Ang2 is assayed for selected monoclonal antibody members based on strong inhibitory activity.

The final selected antibodies can be prepared and used as humanized antibodies as well as human immunoglobulin antibodies in the remaining portions except for the antigen-binding portion. Methods for preparing humanized antibodies are well known in the art (Almagro, J. C. and Fransson, J., "Humanization of antibodies," Frontiers in Bioscience, 13(2008), 1619-1633).

Another example provides a hybridoma cell line that produces a monoclonal antibody of the anti-Ang2 antibody. The hybridoma cell line may be a cell line having an accession number (KCLRF-BP-00295).

As described above, the anti-Ang2 antibody or antigen-binding fragment thereof proposed in the present invention is characterized by inducing the binding of Ang2 and Tie2 receptors without inhibiting Ang2 binding to Tie2 receptors while binding to Ang2. In addition, the conjugate of the anti-Ang2 antibody or antigen-binding fragment thereof and Ang2 thus bound, acts like Ang1, binds to the Tie2 receptor (the Ang2 portion of the complex binds), and activates the Tie2 receptor. It is characterized by having a function.

Thus, another example provides an anti-Ang2 antibody-Ang2 complex in which the anti-Ang2 antibody or antigen-binding fragment thereof and Ang2 are bound. Another example provides a composition for inducing binding of Ang2 to Tie2 receptors comprising the anti-Ang2 antibody-Ang2 complex as an active ingredient. Another example provides a method for inducing the binding of Ang2 to Tie2 receptors, comprising administering the anti-Ang2 antibody-Ang2 complex to a patient in need of binding Ang2 to Tie2 receptors. The method of inducing the binding of Ang2 to the Tie2 receptor may further include the step of identifying a patient in need of binding Ang2 to the Tie2 receptor before the administering step. Another example provides a composition for activating Tie2 receptors comprising the anti-Ang2 antibody-Ang2 complex as an active ingredient. Another example provides a method for activating Tie2 receptors, comprising administering the anti-Ang2 antibody-Ang2 complex to a patient in need of activation of the Tie2 receptor. The Tie2 receptor activation method may further include the step of identifying a patient in need of activation of the Tie2 receptor prior to the administering step. The patient may be a mammal, including humans, primates including monkeys, rodents including mice, rats, etc., or cells, tissues, body fluids, etc. isolated or artificially cultured therefrom. Another example is the use of the anti-Ang2 antibody-Ang2 complex for activating the Tie2 receptor is provided.

As described above, the anti-Ang2 antibody or antigen-binding fragment thereof proposed in the present invention has a function of inhibiting abnormal angiogenesis by inhibiting the function of Ang2, thus preventing various diseases (eg, cancer) related to abnormal angiogenesis. , Alleviation, improvement and/or treatment (see Example 13). In addition, the anti-Ang2 antibody or antigen-binding fragment thereof does not inhibit the binding between Ang2 and Tie2 (see Example 3 and Fig. 1), thereby activating Tie2 (see Example 5 and Fig. 2), thereby preventing Tie2 signaling. By activating (see Example 6 and Fig. 3), promoting the production of vascular endothelium or lymphatic endothelium and increasing mobility (see Example 10), inhibiting an increase in vascular permeability (see Example 11), It is also applicable to the prevention, alleviation, improvement and/or treatment of various diseases (eg sepsis, ocular diseases, etc.). In addition, as described above, the anti-Ang2 antibody or antigen-binding fragment thereof promotes the formation of vascular endothelium or lymphatic endothelium, thereby increasing the formation of healthy blood vessels and normalizing blood vessels, thus forming healthy blood vessels such as wound healing or ischemic disease. It can also be applied to the prevention, alleviation, amelioration and/or treatment of various diseases or symptoms that require, and reduces the likelihood of cancer growth and metastasis by changing the abnormally formed cancer vessels to a normal structural and functional state. In addition, the anti-Ang2 antibody or antigen-binding fragment thereof has an effect of suppressing the inflammatory response (see Example 12), and thus can be applied to the prevention, alleviation, improvement and/or treatment of various inflammatory diseases.

Another example provides a pharmaceutical composition for inhibiting angiogenesis, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example provides a method for inhibiting angiogenesis, comprising administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need of inhibition of angiogenesis. The method for inhibiting angiogenesis may further include identifying a patient in need of inhibition of angiogenesis before the administering step.

Another example provides a pharmaceutical composition for reducing vascular permeability comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example provides a method for reducing vascular permeability comprising administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need thereof. The method for reducing vascular permeability may further include identifying a patient in need of reducing vascular permeability prior to the administering step.

Another example provides a pharmaceutical composition for the prevention and/or treatment of diseases associated with Ang2 overexpression, angiogenesis, and/or increased vascular permeability, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example comprises administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need of prevention and/or treatment of diseases associated with Ang2 overexpression, angiogenesis and/or increased vascular permeability. It provides a method of preventing and/or treating diseases associated with Ang2 overexpression, angiogenesis and/or increased vascular permeability. The prevention and/or treatment method may further include identifying a patient in need of prevention and/or treatment of a disease associated with Ang2 overexpression, angiogenesis and/or increased vascular permeability prior to the administering step. have.

Another example provides a pharmaceutical composition for inducing normal angiogenesis, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example provides a method for increasing normal angiogenesis, comprising administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need of induction of normal angiogenesis. The method for reducing vascular permeability may further include the step of identifying a patient in need of induction of normal angiogenesis prior to the administering step.

Another example provides a pharmaceutical composition for the prevention and/or treatment of diseases associated with reduction of normal angiogenesis, comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example is the treatment of a disease associated with reduction of normal angiogenesis, comprising administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need of prevention and/or treatment of a disease associated with reduction of normal angiogenesis. Prophylaxis and/or treatment methods are provided. The prevention and/or treatment method may further include the step of identifying a patient in need of prevention and/or treatment of a disease associated with reduction of normal angiogenesis before the administering step.

Another example provides a pharmaceutical composition for tissue regeneration and/or wound healing comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example provides a method of tissue regeneration and/or wound healing comprising administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need of tissue regeneration and/or wound healing. The method may further comprise identifying a patient in need of tissue regeneration and/or wound healing prior to the administering step. The patient to be administered the active ingredient may be, for example, a patient who has damaged skin tissue or organ tissue, or has undergone a skin transplant.

Another example provides a pharmaceutical composition for Ang2 inhibition and/or Tie2 receptor activation comprising the anti-Ang2 antibody or antigen-binding fragment thereof as an active ingredient. Another example provides a method of inhibiting Ang2 and/or activating Tie2 receptors comprising administering a pharmaceutically effective amount of the anti-Ang2 antibody or antigen-binding fragment thereof to a patient in need of Ang2 inhibition and/or Tie2 receptor activation. The Ang2 inhibition and/or Tie2 receptor activation method may further include identifying a patient in need of Ang2 inhibition and/or Tie2 receptor activation prior to the administering step. The anti-Ang2 antibody or antigen-binding fragment thereof may be in a state of being bound to the antigen, Ang2.

Since the anti-Ang2 antibody or antigen-binding fragment thereof, which is an active ingredient of the pharmaceutical composition, is activated by binding to Ang2, in order to further enhance the function of the antibody or antigen-binding fragment, the pharmaceutical composition further contains Ang2 It can be. In addition, the method may further include administering a pharmaceutically effective amount of Ang2 to the patient.

Another example provides a composition for diagnosing a disease associated with angiogenesis and/or an increase in vascular permeability and/or a decrease in normal angiogenesis, including the antibody or antigen-binding fragment thereof.

The pharmaceutical composition may further include a pharmaceutically acceptable carrier, and the carrier is commonly used in the formulation of drugs, lactose, dextrose, sucrose, sorbitol, mannitol, starch, gum acacia, calcium phosphate , Alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, mineral oil, etc. It may be one or more selected from the group consisting of, but is not limited thereto. The pharmaceutical composition may further include one or more selected from the group consisting of diluents, excipients, lubricants, wetting agents, sweetening agents, flavoring agents, emulsifying agents, suspending agents, preservatives, and the like, which are commonly used in the manufacture of pharmaceutical compositions.

The pharmaceutical composition, or a pharmaceutically effective amount of the antibody or antigen-binding fragment thereof may be administered orally or parenterally. In the case of parenteral administration, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, and rectal administration may be used. When administered orally, since the protein or peptide is digested, the oral composition may be coated with an active agent or formulated to protect it from degradation in the stomach. In addition, the composition can be administered by any device capable of moving the active substance to the target cell.

The content of the anti-Ang2 antibody or antigen-binding fragment thereof in the pharmaceutical composition may include the formulation method, the mode of administration, the patient's age, weight, sex, pathological condition, food, administration time, administration interval, route of administration, excretion rate and response sensitivity. It can be prescribed in various ways depending on factors. For example, the daily dosage of the anti-Ang2 antibody or antigen-binding fragment thereof may range from 0.001 to 1000 mg/kg, specifically 0.01 to 100 mg/kg, and more specifically 0.1 to 50 mg/kg, but is limited thereto. no. The daily dosage may be formulated as a single formulation in a unit dosage form, formulated in an appropriate amount, or prepared by incorporating into a multi-dose container. The "pharmaceutically effective amount" may mean the content or dosage of an active ingredient capable of exhibiting a desired pharmacological effect, and the formulation method, the mode of administration, the patient's age, weight, sex, pathological condition, food, administration time , Administration interval, route of administration, excretion rate, and response sensitivity.

The pharmaceutical composition may be in the form of a solution, suspension, syrup, or emulsion in an oil or aqueous medium, or may be formulated in the form of an extract, powder, powder, granule, tablet, or capsule. Topics may additionally be included.

In particular, since the pharmaceutical composition containing the anti-Ang2 antibody or antigen-binding fragment thereof contains the antibody or antigen-binding fragment, it can be formulated as an immunoliposome. Liposomes containing antibodies can be prepared according to methods well known in the art. The immune liposome is a lipid composition comprising phosphatidylcholine, cholesterol, and polyethylene glycol-derived phosphatidylethanolamine, and may be prepared by reverse phase evaporation. For example, Fab' fragments of an antibody can be conjugated to liposomes via a disulfide-replacement reaction.

On the other hand, since the anti-Ang2 antibody or antigen-binding fragment thereof specifically binds to Ang2, it is possible to detect Ang2 using this, and through this, it is possible to confirm whether or not Ang2 is overexpressed. Accordingly, another example of the present invention provides a composition for detecting Ang2 including the anti-Ang2 antibody or antigen-binding fragment thereof and a composition for diagnosing diseases related to Ang2 overexpression.

In another example, treating a biological sample obtained (or isolated) from a patient with the anti-Ang2 antibody or antigen-binding fragment thereof; And there is provided a method for detecting Ang2 comprising the step of determining whether the antigen-antibody reaction. In addition, treating a biological sample obtained from a patient with the anti-Ang2 antibody or antigen-binding fragment thereof; And there is provided a method for providing information on the diagnosis of a disease associated with Ang2 overexpression comprising the step of determining whether the antigen-antibody reaction. The method of providing information for the diagnosis may be to determine that the patient has an Ang2 overexpression symptom or has an Ang2 overexpression-related disease when an antigen-antibody reaction is detected in the step of determining whether the antigen-antibody reaction. . The biological sample may be selected from the group consisting of (or isolated) cells, tissues, body fluids, etc. obtained from a patient.

The step of determining whether the antigen-antibody reaction may be performed may be performed through various methods known in the art. For example, it can be measured through conventional enzymatic reaction, fluorescence, luminescence and/or radiation detection, and specifically, immunochromatography, immunohistochemistry, enzyme-linked immunosorbent assay. assay: ELISA), radioimmunoassay (RIA), enzyme immunoassay (EIA), fluorescence immunoassay (FIA), luminescence immunoassay (LIA), Western blotting ), etc. may be measured by a method selected from the group consisting of, but is not limited thereto.

Patients subject to administration or diagnosis of the pharmaceutical composition or antibody or antigen-binding fragment are mammals, including primates including humans, monkeys, rodents including mice, rats, etc., or cells isolated or artificially cultured therefrom, It may be tissue, body fluid, etc.

Diseases associated with the neovascularization and/or increased vascular permeability and/or Ang2 overexpression include cancer; Cancer metastasis; Ocular vascular diseases such as retinopathy of prematurity, macular degeneration (eg, age-related macular degeneration), diabetic retinopathy, and angiogenic glaucoma; Inflammatory diseases such as psoriasis, asthma, rheumatoid arthritis, pneumonia, and chronic inflammation; Infectious disease (infection); Cardiovascular diseases such as hypertension and arteriosclerosis; Kidney disease; blood poisoning; asthma; edema; Hereditary hemorrhagic telangiectasia (HHT) and the like. The cancer is overexpressing Ang2, and may be solid cancer or blood cancer, but is not limited thereto, but is not limited to squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, squamous cell carcinoma of the lung, peritoneal cancer, skin cancer, skin or eye Inner melanoma, rectal cancer, anal cancer, esophageal cancer, small intestine cancer, endocrine adenocarcinoma, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, chronic or acute leukemia, lymphocyte lymphoma, hepatocellular carcinoma, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer , Ovarian cancer, liver cancer, bladder cancer, liver tumor, breast cancer, colon cancer, colon cancer, endometrial or uterine cancer, salivary gland cancer, kidney cancer, prostate cancer, vulvar cancer, thyroid cancer, head and neck cancer, brain cancer, osteosarcoma, etc. 1 selected from the group consisting of It can be more than a species.

The diseases associated with the reduction of normal angiogenesis are diseases that require induction of normal angiogenesis, and arechemic diseases such as myocardial infarction, angina pectoris, cerebral infarction, stroke (cerebral ischemia), Berger's disease (obstructive thromboangiitis), avascular necrosis ( avascular necrosis), foot ulcers (eg, diabetic foot ulcers, etc.), erectile dysfunction, etc. may be selected from the group consisting of.

Another example provides a complex to which the anti-Ang2 antibody or antigen-binding fragment thereof, Ang2, and Tie2 receptors are bound. The complex may exist in a living body or may exist in a cell separated from the living body. In addition, the antibody in the complex may form a dimer with the antibody in the adjacent complex, thereby clustering two or more complexes, thereby forming a cluster comprising two or more complexes (see Example 8). This action is related to the Tie2 receptor activation function of the anti-Ang2 antibody. The complex may be used to monitor the action of the anti-Ang2 antibody, that is, whether to inhibit Ang2 and/or activate the Tie2 receptor, or by itself to inhibit Ang2 and/or activate the Tie2 receptor.

Another example is a method of screening for candidate substances for the prevention and/or treatment of diseases related to the formation of angiogenesis and/or enhancement of vascular permeability by confirming the formation of the complex and/or the inhibition of Ang2 and/or activation of the Tie2 receptor. to provide.

In one embodiment, the screening method,

Contacting a candidate compound with a sample containing Ang2 and Tie2 receptors; And

Confirming the formation of a complex in which the candidate compound, Ang2, and Tie2 receptors are bound

It may include.

The step of confirming the formation of the complex to which the candidate compound, Ang2, and Tie2 receptor is bound, is to confirm the presence of the candidate compound, Ang2, and the complex to which the Tie2 receptor is bound, or whether the candidate compound is bound to Ang2, and Ang2 It can be carried out by checking the binding between the Tie2 receptor and The screening method may further include the step of confirming the formation of a complex in which the candidate compound, Ang2, and Tie2 receptor is bound, before, after, or at the same time, confirming Ang2 inhibition and/or activation of the Tie2 receptor. have.

In the screening method, when the formation of a complex in which the candidate compound, Ang2, and Tie2 receptor is bound, that is, the presence of a complex in which the candidate compound, Ang2, and Tie2 receptor is bound, is confirmed, or the candidate compound and Ang2 When hepatic binding and binding between Ang2 and Tie2 receptors are confirmed, the candidate compound is used as a candidate for the prevention and/or treatment of diseases associated with Ang2 overexpression, angiogenesis, vascular permeability enhancement, and/or reduction in normal angiogenesis. I can judge.

In another example, the screening method,

Contacting a candidate compound with a sample containing Ang2 and Tie2 receptors; And

Confirming Ang2 inhibition and/or activation of Tie2 receptor

It may include. In the screening method, when Ang2 inhibition and/or Tie2 receptor activation is confirmed, the candidate compound is used to prevent and/or prevent diseases associated with Ang2 overexpression, neovascularization, vascular permeability, and/or reduction of normal angiogenesis. It can be judged as a candidate substance for treatment. The inhibition (decomposition) of Ang2 is by measuring the level of Ang2 before and after treatment with the candidate compound for the same sample, or measuring the level of Ang2 by dividing the same sample into a treated group and an untreated group of the candidate compound. It can be confirmed by comparing the level of Ang2 before and after treatment or in the treated and untreated groups. Alternatively, at this time, when the level of Ang2 in the treatment group or before the treatment of the candidate compound decreases compared to the treatment group or in the untreated group, it may be determined that Ang2 is inhibited. In addition, the activation of the Tie2 receptor is the degree of phosphorylation of the Tie2 receptor and/or the degree of phosphorylation of one or more of the proteins (eg, Akt, eNOS, 42/44, etc.) involved in downstream signaling of the Tie2 receptor. It can be measured before and after the treatment of the compound, or by dividing the same sample into a treated group and an untreated group of the candidate compound, and comparing the degree of phosphorylation of the protein before and after treatment with the candidate compound or between the treated and untreated groups. In this case, when the degree of phosphorylation of the candidate compound after treatment or in the treatment group is increased compared to the treatment group before or without treatment with the candidate compound, it may be determined that the Tie2 receptor is activated. Alternatively, activation of the Tie2 receptor can be determined by confirming whether the Tie2 receptor is internalized.

In another example, the screening method,

Contacting a candidate compound with a sample containing Ang2 and Tie2 receptors; And

Formation of a complex in which the candidate compound, Ang2, and Tie2 receptors are bound, and confirming Ang2 inhibition and/or activation of Tie2 receptors

It may include. Details of the formation of the complex, inhibition of Ang2, and activation of the Tie2 receptor are as described above.

Confirmation of the formation of the complex, measurement of the level of Ang2, measurement of the degree of phosphorylation of Tie2, measurement of the degree of phosphorylation of proteins involved in downstream signaling, and/or confirmation of intracellular migration of Tie2 receptors are known in the art. It can be carried out through various methods, for example, it can be measured through conventional enzymatic reactions, fluorescence, luminescence and/or radiation detection, and specifically, immunochromatography, immunohistochemical staining (Immunohistochemistry), Enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), enzyme immunoassay (EIA), fluorescence immunoassay (FIA), luminescence immunoassay: LIA), Western blotting, etc. may be measured by a method selected from the group consisting of, but is not limited thereto.

The candidate compounds are artificially synthesized or natural various compounds, polypeptides, oligopeptides, peptide structures or protein structures (e.g., antibodies, peptibodies, nanobodies, etc.), polynucleotides, oligonucleotides, antisense-RNA, shRNA ( short hairpin RNA), siRNA (small interference RNA), aptamer, may be one or more selected from the group consisting of natural extracts.

The sample containing the Ang2 and Tie2 receptors is cells or tissues isolated or artificially cultured in a living body, and inherently contains (expresses) Ang2 and Tie2 receptors, or Ang2 and/or Tie2 receptors are treated, or Ang2 and/or It may be engineered to express the Tie2 receptor.

Previously, attempts have been made to inhibit the angiogenesis by Ang2 by inhibiting the binding of Ang2 to its receptor, Tie2, but by specifically binding to Ang2, it induces intracellular migration and degradation of Ang2, and the interaction between Ang2 and Tie2 receptors. Antibodies that act to activate Tie2 receptors while maintaining the binding ability to form an antibody-Ang2-Tie2 receptor complex have not been known to date. In this situation, the present invention proposes an antibody that inhibits Ang2 and at the same time activates the Tie2 receptor to promote downstream signaling, thereby suggesting a novel method capable of inhibiting angiogenesis by Ang2 and reducing vascular permeability. In addition, the antibody proposed in the present invention is expected to be applied to diagnosis and treatment of abnormal angiogenesis-related diseases other than cancer and/or diseases caused by increased vascular permeability. The antibody can be used in combination therapy with chemical medicines and other anticancer therapeutics, and is expected to be used for antibody fragments, bi- or multi-specific antibodies, protein scaffolds, etc. using Ang2 specific recognition.

1 is an Ang2-Tie2 competition ELISA result showing the degree of inhibition of binding between Tie2 receptor and Ang2 according to the concentration of anti-Ang2 antibody treatment according to an embodiment.
2 is a result of immunoblotting showing changes in the levels of Tie2 receptor and phosphorylated Tie2 receptor according to the treatment concentration of the anti-Ang2 antibody according to an embodiment.
3 is a result of immunoblotting showing the degree of phosphorylation of proteins involved in downstream signaling of Tie2 receptors during treatment with an anti-Ang2 antibody according to an embodiment.
4 is an ELISA result showing the degree to which an anti-Ang2 antibody according to an embodiment forms a complex by binding to Ang2 and Tie2.
5 is a result of immunoblotting showing the degree of phosphorylation of a Tie2 receptor of a monomeric anti-Ang2 antibody and a protein involved in downstream signaling of the Tie2 receptor according to an embodiment.
6 is a result of immune cell staining showing intracellular internalization of Tie2 receptors in which Ang1 and anti-Ang2 antibodies are similar according to an embodiment.
7 is a result showing the effect of the anti-Ang2 antibody on the proliferation of vascular and lymphatic endothelial cells according to an embodiment.
8 is a result showing the effect of the anti-Ang2 antibody on the movement of endothelial cells in the lymphatic vessel according to an embodiment.
Figure 9 is a result showing the degree of inhibition of cell permeability induced by TNF or LPS when Ang1 or Ang2 antibody treatment according to an embodiment.
Figure 10 is a result showing the mRNA expression level of the inflammation-related cell adhesion substances (ICAM-1, E-selectin) induced by LPS stimulation during Ang1 or Ang2 antibody treatment according to the embodiment.
11 is a graph showing the intensity of fluorescence obtained from inflammatory cells during treatment with an anti-Ang2 antibody according to an embodiment as a relative fold, showing the number of inflammatory cells attached to vascular endothelial cells.
12 is a result showing the efficacy of an anti-Ang2 antibody in a Colo205 tumor model according to an embodiment.

Hereinafter, the present invention will be described in more detail by way of examples, but these are only illustrative and are not intended to limit the scope of the present invention. It is obvious to those skilled in the art that the embodiments described below may be modified within the scope of the essential gist of the invention.

Example 1. Clause Ang2 Antibody production

Anti-Ang2 antibody was administered to 5-week-old BALB/c mice by administering human Ang2 protein (R&D systems; 623-AN-025/CF) with adjuvant to induce an immune response, and then by a known method described in Schwaber et al. Hybridomas producing individual antibodies were prepared (Schwaber, J and Cohen, EP, "Human x Mouse Somatic Cell Hybrid Clones Secreting Immunoglobulins of Both Parental Types," Nature, 244 (1973), 444-447).

More specifically, in order to obtain the immunized mice required for the development of hybridoma cell lines, 5 5 week old BALB/c mice (Japan SLC, Inc.) 100 ug of human Ang2 protein per animal (R&D Systems) An equal amount of complete Freund's adjuvant was mixed and injected into the abdominal cavity of 4-6 week old BALB/c mice (Japan SLC, Inc.). After 2 weeks, the antigen (half of the amount injected first) was mixed with incomplete Freund's adjuvant in the same manner as above and injected into the intraperitoneal cavity of the mouse. One week later, the last boosting was performed, and 3 days later, blood was collected from the tail of the mouse to obtain serum, and then diluted in PBS at 1/1000 to confirm that the titer of the antibody recognizing Ang2 was increased by ELISA. As a result of the above, a mouse having a sufficient amount of antibody was selected and a cell fusion process was performed.

Three days before the cell fusion experiment, a mixture of 100 ug of human Ang2 protein (R&D systems) in 50 ug of PBS was injected into the abdominal cavity of BALB/c mice (Japan SLC, Inc.), and the immunized mice were anesthetized and the trunk The spleen located on the left side of was excised. The extracted spleen was ground with a mesh to separate cells, and mixed with a culture medium (DMEM, Hyclon) to prepare a splenocyte suspension. The suspension was centrifuged to recover the cell layer. The obtained splenocytes 1× ^{10 8} and myeloma cells (Sp2/0) 1×10 ⁷ were mixed and then centrifuged to precipitate the cells. The centrifuged precipitate was slowly dispersed, treated with 1 ml of 45% polyethylene glycol (PEG 1500) contained in the culture medium (DMEM), maintained at 37° C. for 1 minute, and then 1 ml of the culture medium (DMEM) was added. I did. Thereafter, 10 ml of the culture medium (DMEM) was added for 1 minute, left to stand in water at 37° C. for 5 minutes, adjusted to 50 ml, and centrifuged again. Cell sediment was resuspended in a separation medium (HAT medium) at about 1~2×10 ⁵ /ml, and 0.1 ml each was dispensed into a 96-well plate and cultured in a carbon dioxide incubator at 37°C to prepare a hybridoma cell group. I did.

Example 2. Anti- Ang2 Antibody production

2.1. term- Ang2 Antibody production clones 　Selection and antibody purification

Hybridomas producing 95 anti-Ang2 monoclonal antibodies were selected from hybridomas differentiated from parent hybridomas based on Ang2 binding ability from the obtained antibody-producing hybridomas using a typical ELISA format.

More specifically, in order to select hybridoma cells that specifically react only to Ang2 protein from the hybridoma cell group prepared in Example 1, it was screened by ELISA analysis using human Ang2 protein as an antigen.

Human Ang2 protein was added to the microtiter plate at 100 ng per well and attached to the plate surface, and unreacted antigens were washed away. 50 µl of the hybridoma cell culture solution obtained in Example 1 was added to each well and reacted for 1 hour, and then sufficiently washed with a phosphate buffer solution-Tween 20 (TBST) solution to remove the unreacted culture solution. To this, goat anti-mouse IgG-horseradish peroxidase (goat anti-mouse IgG-HRP) was added to react at room temperature for 1 hour, and then sufficiently washed with TBST solution. Subsequently, a substrate solution (OPD) of peroxidase was added to react, and the degree of reaction was measured by measuring the absorbance at 450 nm with an ELISA Reader, which secretes antibodies that have high binding power specifically only for human Ang2 protein. Bridoma cell lines were repeatedly selected. By limiting dilution of the hybridoma cell line obtained through repeated selection, 58 hybridoma cell lines producing monoclonal antibodies were finally obtained. The produced hybridoma was deposited with the Korea Cell Line Bank located in Yeongeon-dong, Jongno-gu, Seoul, Korea on May 13, 2013, and was given accession number KCLRF-BP-00295.

Each of the hybridomas obtained above was cultured in DMEM (Dulbeco's Modified Eagle's Medium), and then the cultures were collected and the anti-Ang2 monoclonal antibody produced in each hybridoma was purified by protein G-affinity chromatography.

First, the hybridoma cells cultured in 50 ml of a culture medium (DMEM) containing 10% (v/v) FBS were centrifuged, and the cell precipitate was washed twice or more with 20 ml PBS to remove FBS. 50 ml of the culture medium (DMEM) medium was resuspended in the cell precipitate and then cultured in a carbon dioxide incubator at 37° C. for 3 days. Thereafter, the antibody-producing cells are removed through centrifugation, and the culture medium secreted with the antibodies is separated and stored at 4° C. or collected directly, and an affinity column (Protein G agarose column; Pharmacia, USA) is prepared from the culture medium of 50 ml to 300 ml. After purely purifying the antibody using the equipped AKTA purification device (GE Healthcare), the supernatant was replaced with PBS using a protein aggregation filter (Amicon) to store the purified antibody, and used for subsequent experiments. One of the antibodies obtained from each of the above hybridomas was designated as 10D6.

The binding affinity of the antibody to human Ang-2 protein was measured by the SPR method using BIAcore T100 (GE Healthcare). The SPR method uses the principle that the refractive index of light passing through the chip changes according to the state of the material coated on the sensor chip.When an antibody or antigen is spilled while the antigen or antibody is coated on the chip, the refractive index changes due to binding between them. Is generated, and the Kd value is calculated from the measured value.

First, an anti-His antibody was immobilized on a CM5 sensor chip (GE Healthcare) to a level of 8,000 RU using a pH 5.0 acetate solution and an amine coupling kit (GE Healthcare). Recombinant hAng-2 (C-His, R&D Systems) protein at a concentration of 6 ug/ml was flowed and captured at a level of 100 to 200 RU. Here, the antibody obtained in Example 2 was sequentially diluted 2 times from a concentration of 100 nM, and then bound (on), separated (off), and dissociated (regeneration, 10 mM) with the antigen captured on the sensor chip by flowing each NaOH solution was used), and the affinity between the antigen-antibody was measured. The experiment was performed in the same manner as above for hAng1, and the results are shown in Table 3 below.

Antibody name hAng2 (Kd) SAIT-ANG2-AB-m10D6 8.0 nM

2.2. term Ang2 Antibody gene Cloning

Total RNA was obtained from the antibody-producing hybridoma (2x10 ⁶ cells) obtained in Example 2.1 using RNeasy mini kit (Qiagen). Then, using this as a template, using OneStep RT-PCR kit (Qiagen), Mouse Ig-Primer Set (Novagen) and a thermocycler (GeneAmp PCR System 9700, Applied Biosystem) under the following conditions. Only variable region gene sequences of heavy and light chains of monoclonal antibodies produced on a cutting board were amplified: 94° C. for 5 minutes; [30 minutes at 50°C, 15 minutes at 95°C], [1 minute at 94°C, 1 minute at 50°C, 2 minutes at 72°C] x 35 cycles; 72° C. for 6 minutes; Cool to 4°C.

The PCR products obtained from each reaction were directly subjected to DNA sequencing to obtain the CDRs, heavy chain variable regions and light chain variable regions of each antibody, and nucleotide sequences encoding them, and the obtained results are shown in Table 4 below. It is summarized in 7:

Antibody name Heavy chain CDR sequences CDRH1-KABAT CDRH2-KABAT CDRH3-KABAT SAIT-ANG2-AB-m10D6 SDYAWN
(SEQ ID NO: 1) YINYSGNTDYNPSLKS
(SEQ ID NO: 2) GNFEGAMDY
(SEQ ID NO:3)

Antibody name Light chain CDR amino acid sequence CDRL1-KABAT CDRL2-KABAT CDRL3-KABAT SAIT-ANG2-AB-m10D6 KASQSVSNDVA
(SEQ ID NO: 4) YASNRYP
(SEQ ID NO: 5) QQDYSSPWT
(SEQ ID NO: 6)

Antibody name Heavy chain variable region sequence SAIT-ANG2-AB-m10D6 VQLQESGPGLVKPSQSLSLTCTVTGYSIT SDYAWN WIRQFPGNKLEWMG YINYSGNTDYNPSLKS RSSITRDTSKNQFFLQLNSVTTGDTATYYCAR GNFEGAMDY WG (SEQ ID NO: 7) GATGTGCAGCTTCAGGAGTCGGGACCTGACCTGGTGAAACCTTCTCAGTCTCTGTCCCTCACCTGCACTGTCACTGGCTACTCAATCACCAGTGATTATGCCTGGAACTGGATCCGGCAGTTTCCAGGAAACAAACTGGAGTGGATGGGCTACATAAACTACAGTGGTAACACTGACTACAACCCATCTCTCAAAAGTCGAAGCTCTATCACTCGAGACACATCCAAGAACCAGTTCTTCCTGCAGTTGAATTCTGTGACTACTGGGGACACAGCCACATATTACTGTGCAAGAGGTAACTTCGAAGGTGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCA (SEQ ID NO: 8)

Antibody name Light chain variable region sequence SAIT-ANG2-AB-m10D6 SIVMTQTPKFLLVSAGDRVTITC KASQSVSNDVA WYQQKPGQSPKLLIY YASNRYP GVPDRFTGSGYGTDFTFTISTVQAEDLAVYFC QQDYSSPWT FGGGTKLEIK (SEQ ID NO: 9) agtattgtgatgacccagactcccaaattcctgcttgtatcagcaggagacagggttaccataacctgcaaggccagtcagagtgtgagtaatgatgtagcttggtaccaacagaagccagggcagtctcctaaactgctgatatactatgcatccaatcgctaccctggagtccctgatcgcttcactggcagtggatatgggacggatttcactttcaccatcagcactgtgcaggctgaagacctggcagtttatttctgtcagcaggattatagctctccgtggacgttcggtggaggcaccaagctggaaatcaaa (SEQ ID NO: 10)

(In Tables 6 and 7 above, the underlined bold letters are CDR1, CDR2, and CDR3 in order)

Example 3. Ang2 - Tie2 About 10 combined D6 Of antibodies competition ELISA assay

Ang2-Tie2 binding competition ELISA was performed using the antibody that binds to Ang-2 prepared in Example 2-1.

More specifically, a 96-well MaxiSorp™ flat-bottom plate (Nunc) was coated with hTie2-Fc (R&D Systems), a protein conjugated with 4 ug (microgram)/ml of human IgG1 Fc. Then, after washing the plate 5 times with PBS (Phosphate Buffer Saline) containing 0.05% (v/v) Tween-20, PBS containing 1% (v/v) BSA (Bovine serum albumin; Sigma) Blocked at room temperature for 2 hours.

For the Ang2-Tie2 competition ELISA, each anti-Ang2 antibody prepared in Example 2 was used at various concentrations of 400 nM to 0.001 nM with 1% (v/v) of BSA and 400 ng/ml of FLAG-Tagged hAng- 2 and 　 the hTie-2/Fc fusion protein was coated in each well, and then the plate was reacted at room temperature for 2 hours, and then the plate was washed 5 times with PBST. HRP-conjugated anti-FLAG antibody (Sigma) was diluted with PBS containing 1% (v/v) of BSA at a ratio of 1:5,000 (v/v) and added to each well in an amount of 100 ul at room temperature. After reacting for 1 hour, it was washed 5 times with PBST. Finally, 100 ul (microliter) of TMB substrate (Cell Signaling) was added to each well of the plate to induce a color reaction for 3 minutes, and then, 100 ul of Stop solution (Cell Signaling) was added to stop the reaction, The OD450 value was measured on a plate reader (Molecular Devices).

For comparison, the same test as described above was performed using 4H10, an anti-Ang2 antibody that inhibits Ang2-Tie2 binding. The 4H10 is an antibody having the following heavy chain variable region and light chain variable region:

Heavy chain variable region (SEQ ID NO: 12):

EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYDMS WVRQAPGKGLEWVS LISPDSSSIYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYC AKDLISFWRGGFDY WGQGTLVTVSS

Light chain variable region (SEQ ID NO: 13)

QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNYVN WYQQLPGTAPKLLIY ADSNRPS GVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDYSLSG YVFGGGTKLTVLG

The degree of inhibition of Ang-Tie2 binding (%) is shown in FIG. 1. As shown in Figure 1, unlike 4H10, an anti-Ang2 antibody that inhibits Ang2-Tie2 binding, it was confirmed that the 10D6 antibody did not inhibit the binding between Ang2-Tie2 receptors.

Example 4. Ang2 Of antibodies Antigen recognition site ( epitope ) Confirm

Recombinant protein that artificially mutated the receptor binding domain (RBD) of the Ang2 protein tagged with a flag to identify the epitope (or specific binding site) of the anti-Ang2 antibody produced in Example 2 ELISA was performed using.

Each well of a 96-well MaxiSorp™ flat-bottom plate (Nunc) was coated with 50 ul (microliter) of an antibody of 1000 nM. Thereafter, the plate was washed 5 times with PBS (PBST) containing 0.05% (v/v) Tween-20, and then blocked with PBS containing 1% (v/v) BSA for 2 hours at room temperature. S417, Q418, P419, N421, I434, D448, A449, P452, Y460, N467, K468, or F469 residues of Ang2 protein tagged to N-terminal with FLAG sequence (DYKDDDDK, Sigma) are replaced with alanine. Each obtained mutant protein (Mutant Ang2) was added to each well of the plate by 250 ng, and then the plate was reacted at room temperature for 2 hours.

After washing 5 times with PBS containing 0.05% (v/v) Tween-20, HRP-conjugated anti-FLAG 　 antibody (SIGMA) was mixed with PBS containing 1% (v/v) BSA 1: After diluting at a rate of 5,000 (v/v) and reacting for 1 hour at room temperature, it was washed 5 times with PBS containing 0.1% (v/v) Tween-20.

Finally, 50 ul of TMB substrate (cell signaling) was added to each well of the plate to induce a color reaction for 3 minutes at room temperature, and then, 50 ul of a Stop solution (Cell signaling) was added to stop the reaction. , OD450 values were measured on a plate reader (Molecular Devices). Each epitope for Ang2 antibodies was confirmed by comparing the binding strength with mutated Ang2 with non-mutated Ang2. The result of measuring the binding force (%) with Mutant Ang2 relative to the obtained binding force with native Ang2 is shown in Table 8 below:

Loop 1 Loop 2 Loop 3 Loop4 417 418 419 421 434 448 449 452 460 467 468 469 10D6 101.17 38.94 41.08 109.09 109.49 104.55 97.86 102.15 103.15 106.84 110.27 108.79

Example 5. 10 D6 Antibody Tie2 Receptor phosphorylation induction test

Ang2 binds to the Tie2 receptor expressed in vascular endothelial cells, induces phosphorylation of the receptor and activates it, thereby inducing changes in vascular endothelial cells, so the effect of anti-Ang2 antibodies on Tie2 phosphorylation was analyzed using a cell-based assay. The following experiment was performed.

To this end, HUVEC (ATCC) cells (1X10 ⁶ cells) in a 100mm culture dish were cultured at 37°C using EGM-2 (Lonza) medium, and if 80-90% confluency was shown, then replaced with serum-free medium (Lonza). Incubated at 37° C. for 6 to 16 hours. After washing with PBS once, it was changed to a serum-free medium (Lonza) mixed with 1 nM sodium orthovanadate (Sigma) and incubated for 10 minutes. After washing once with PBS, Ang2 antibody (10D6) of various concentrations (600 ~ 0.06 nM) was mixed with 40 nM of Ang2 protein (R&D systems) for 20 minutes, and then treated on the cultured cells and incubated for 10 minutes. . After washing the cells with PBS, 400ul of lysis buffer (Roche) was treated, the cells were collected in a tube, lysed at 4°C for 30 minutes, and then centrifuged at 13,000 rpm for 15 minutes to nanodrop the supernatant. It was quantified using.

1 ug of Tie2 antibody (R&D system) was added to 0.8 mg cell lysate and reacted overnight at 4°C, followed by immunoprecipitation by adding Protein A bead (GE Healthcare). The obtained reaction product was centrifuged at 13,000 rpm for 15 minutes to obtain a pellet, washed 2 to 3 times with a lysis buffer (Roche), and a sample buffer (Invitrogen) mixed with a reducing agent was added and boiled at 95° C. for 5 minutes, NuPAGE Novex 4-12% Bis-Tris gel (Invitrogen) was run and transferred to a nitrocellulose membrane (Invitrogen).

To confirm Tie2 phosphorylation, the above membrane was blocked with PBST mixed with 3% (v/v) skim milk (Sigma) for 30 minutes, and then confirmed using HRP-conjugated anti-phospho tyrosine antibody (Millipore). I did. To confirm Tie2, the blot was reacted in a stripping buffer (Thermo) for 15 minutes, then blocked again and confirmed using a Tie2 antibody (Santa Cruz).

Fig. 2 shows the obtained results. As shown in FIG. 2, it was confirmed that phosphorylation of Tie2 was more strongly induced in all tested antibody concentration ranges when 10D6 antibody was put together with Ang2 compared to the Ang2 alone treatment group.

Example 6: 10 D6 Antibody Tie2 signaling Activation induction test

In order to confirm whether the 10D6 antibody induces the activation of downstream signaling of the Tie2 receptor as well as the Tie2 receptor, the degree of phosphorylation of the protein participating in downstream signaling when Ang2 alone or Ang2 and 10D6 antibodies are treated in HUVEC (ATCC) cells is determined by immunoblasting. Tested by Ting. To compare the degree of downstream signaling activation, Ang1 (R&D systems), and Ang2 (R&D systems) and Regeneron's anti-Ang2 antibody (RG antibody; a control antibody with MOA that inhibits Ang2-Tie2 binding) were treated together. The same test was also carried out.

Specifically, HUVEC (ATCC) cells (1×10 ⁵ cells) in a 6 well culture dish were cultured at 37° C. using EGM-2 (Lonza) medium, and if 80 to 90% confluency was shown, use serum-free medium (Lonza). It was incubated at 37° C. for 6 to 16 hours. After washing once with PBS, 60 nM of Ang2 antibody (10D6) was mixed with 40 nM of Ang2 protein (R&D systems) and left for 20 minutes, and then treated on the cultured cells and incubated for 30 minutes. For comparison, groups treated with Ang1 (R&D systems) 4nM, Ang2 (R&D systems) 40nM, and Ang2 (R&D systems) 40nM + anti-Ang2 antibody (Regeneron) 60nM, respectively, were prepared.

After washing the cells with PBS, after treatment with lysis buffer (Roche), the cells were collected in a tube, lysed at 4° C. for 30 minutes, and then centrifuged at 13,000 rpm for 15 minutes to quantify the supernatant. Add sample buffer (Invitrogen) mixed with reducing agent to 25ug of cell lysate, boil for 5 minutes at 95℃, run NuPAGE Novex 4-12% Bis-Tris gel (Invitrogen), and transfer to nitrocellulose membrane (Invitrogen) Made it.

In order to confirm the phosphorylation of Akt, eNOS, 42/44, which are involved in downstream signaling of Tie2 receptor, block the above blot with PBST mixed with 3% (v/v) skim milk (Sigma) for 30 minutes, Anti-pAkt antibody, anti-p-eNOS antibody, and anti-p-42/44 antibody (abnormal cell signaling) were treated. After reacting the blot in a stripping buffer (Thermo) for 15 minutes, blocking again to confirm Akt, eNOS, and 42/44 using anti-Akt antibody, anti-eNOS antibody, and 42/44 antibody (abnormal cell signaling).

Fig. 3 shows the obtained results. As shown in Figure 3, compared to the group treated with Ang2 alone and the group treated with Ang2 and RG antibody together, downstream signaling is strongly induced in the group treated with Ang1 alone and with Ang2 and 10D6 antibodies, and Ang2 and 10D6 antibodies It can be seen that the effect in the group treated with Ang1 was equal to or greater than that of the Ang1 alone treatment group.

Example 7: 10 D6 - Ang2 - Tie2 complex For confirming formation ELISA assay

Since it was confirmed that the 10D6 anti-Ang2 antibody did not inhibit Ang2-Tie2 binding and activated Tie2 signaling, ELISA was performed to confirm whether a complex between the antibody and the Ang2 Tie2 receptor was formed.

A 96-well MaxiSorp™ flat-bottom plate (Nunc) was coated with 4ug/ml Tie2-Fc (R&D systems) or BSA (Sigma). Then, after washing the plate 5 times with PBS (Phosphate Buffer Saline) containing 0.05% (v/v) Tween-20, PBS containing 1% (v/v) BSA (Bovine serum albumin; Sigma) Blocked at room temperature for 2 hours. After adding 0.25 ug/ml of Ang2 and 2 ug/ml 10D6 antibody to each well, 　 the plate was reacted at room temperature for 2 hours, and 　 the plate was washed 5 times with PBST. HRP-conjugated anti-mouse IgG antibody (Sigma) was diluted in 1% (v/v) BSA-containing PBS at a ratio of 1:5,000 (v/v) and added to each well in an amount of 100 ul. After reacting at room temperature for 1 hour, it was washed 5 times with PBST. Finally, 100 ul (microliter) of TMB substrate (Cell Signaling) was added to each well of the plate to induce a color reaction for 3 minutes, and then, 100 ul of Stop solution (Cell Signaling) was added to stop the reaction, The OD450 value was measured on a plate reader (Molecular Devices).

Fig. 4 shows the obtained results. As shown in FIG. 4, it was confirmed that the 10D6 antibody forms a complex by binding to Ang2 bound to Tie2.

Example 8 . 10 D6 Of antibodies dimerization On by Tie2 Receptor clustering Activation through

In order to confirm whether the activation of the Tie2 receptor is due to the dimerization of the 10D6 antibody, the Fab fragment of the 10D6 antibody was purified and used in the experiment. Fab fragment was obtained from 10D6 antibody using Fab Preparation Kit (Pierce). PBS containing 20 mM EDTA and 20 mM L-Cysteine was used as a digestion buffer, and when immobilized papain was treated for 2 hours at room temperature, Fab and Fc were separated. The Fc fragment was removed from this reaction solution using MabSelectSuRe column (GE Healthcare), and only pure Fab fragment was isolated and purified.

HUVEC (ATCC) cells in 100mm culture dish After culturing (1X10 ⁶ pcs.) at 37℃ using EGM-2 (Lonza) medium, if 80~90% confluency is shown, serum-free medium Changed to (Lonza) and incubated at 37° C. for 6 to 16 hours. After washing with PBS once, it was changed to a serum-free medium (Lonza) mixed with 1 nM sodium orthovanadate (Sigma) and incubated for 10 minutes. After washing once with PBS, 60nM of 10D6 Ang2 antibody or 10D6 Fab was mixed with 40nM Ang2 protein (R&D systems) for 20 minutes, and then treated on the cultured cells and incubated for 10 minutes. After washing the cells with PBS, 400ul of lysis buffer (Roche) was treated, the cells were collected in a tube, lysed at 4°C for 30 minutes, and then centrifuged at 13,000 rpm for 15 minutes to nanodrop the supernatant. It was quantified using.

1 ug of Tie2 antibody (R&D system) was added to 0.8 mg cell lysate and reacted overnight at 4°C, followed by immunoprecipitation by adding Protein A bead (GE Healthcare). The obtained reaction product was centrifuged at 13,000 rpm for 15 minutes to obtain a pellet, washed 2 to 3 times with a lysis buffer (Roche), and a sample buffer (Invitrogen) mixed with a reducing agent was added and boiled at 95° C. for 5 minutes, NuPAGE Novex 4-12% Bis-Tris gel (Invitrogen) was run and transferred to a nitrocellulose membrane (Invitrogen).

To confirm Tie2 phosphorylation, the above membrane was blocked with PBST mixed with 3% (v/v) skim milk (Sigma) for 30 minutes, and then confirmed using HRP-conjugated anti-phospho tyrosine antibody (Millipore). I did. To confirm Tie2, the blot was reacted in a stripping buffer (Thermo) for 15 minutes, then blocked again and confirmed using a Tie2 antibody (Santa Cruz).

In order to confirm the phosphorylation of Akt, eNOS, 42/44, which are involved in downstream signaling of Tie2 receptor, block the above blot with PBST mixed with 3% (v/v) skim milk (Sigma) for 30 minutes, Anti-pAkt antibody, anti-p-eNOS antibody, and anti-p-42/44 antibody (abnormal cell signaling) were treated. The blot was reacted in a stripping buffer (Thermo) for 15 minutes, and then blocked again to confirm Akt and 42/44 using anti-Akt antibody and anti-42/44 antibody (abnormal cell signaling).

Fig. 5 shows the obtained results. As shown in FIG. 5, when 10D6 antibody was added together with Ang2, activation of Tie2 and Akt, 42/44 occurred, whereas activation was not observed when 10D6 Fab was treated. As a result, Tie2 by dimerization of 10D6 antibody It was confirmed that phosphorylation occurs strongly due to clustering of the receptors.

Example 9 .10 D6 Antibody Tie2 Receptor internalization Confirm

HUVEC (ATCC) cells (1X10 ⁶ cells) were grown in m-slide 8 wells (#80826, ibidi) for 24 hours and then serum starvated in EBM-2 media (Lonza) without serum for 3 hours. Ang1 (R&D systems) 200 ng/ml or Ang2 (R&D systems) 2 ug/ml and 10D6 antibody 10 ug/ml were each diluted in EBM-2 media without serum, treated with the cells, and incubated for the time indicated in the figure. Cells immobilized with 4% formaldehyde (Sigma) were first stained with anti-Tie2 antibody (R&D systems), and then anti-goat Alexa 555 antibody (red, Life technology) and anti-mouse Alexa 488 antibody (green, Life technology) ) Was stained secondary. The stained cells were treated with Vectashield mounting medium with DAPI (Vector labs) and observed by confocal laser scanning microscopy (Carl Zeiss).

The results are shown in Figs. 6a and 6b. As shown in Fig. 6a, it was found that the internalization of the Tie2 receptor started from 30 minutes when Ang2 and 10D6 antibodies were treated, similar to Tie2 endocytosis during Ang1 treatment (dots in the enlarged picture). And it was confirmed by the anti-EEA1 antibody (Cell Signaling) staining of Fig. 6b that the internalized Tie2 and 10D6 antibodies are located in the early endosome, an organelle in the cell.

Example 10 . 10 D6 Confirmation of the effect of increasing cell growth and mobility by antibody

Blood vessel and lymphatic endothelial cell proliferation was measured using BrdU assay kit (Roche) Cell. Put vascular endothelial cells (HUVEC, ATCC) or lymphatic endothelial cells (Lonza) of P3~P8 in a Collagen coated 96 well plate (BD Bioscience) at 3000~5000 cells/well and then use EGM-2 medium (Lonza) to 16~24 Incubated for hours. After preparing by mixing 2 ug/ml Ang2 (R&D systems) and 10 ug/ml 10D6 antibody in 2% EBM medium, the mixture was added to a 96-well plate washed with PBS and incubated for 3 days.

MedImmune's anti-Ang2 antibody was used for efficacy comparison. For BrdU assay analysis, 10ul of BrdU solution diluted to 1;1,000 was added to each well to label the cells. After incubating for 1 hour, after removing the culture medium, 100ul of Fixation/Denaturation solution (Roche) was added to each well and removed after waiting for 30 minutes. Peroxidase-conjugated Anti-BrdU antibody (Roche) was diluted to 1;100 using a dilution buffer (Roche), added to each well, reacted for 1 hour, and washed 4 times using a washing buffer (Roche). . After 100ul of TMB substrate was added and reacted, the absorbance was measured at 450nm using a Microplate reader (Perkin Elmer).

Fig. 7 shows the obtained results. As shown in FIG. 7, it was confirmed that cell growth was increased in the group where the 10D6 antibody was added to Ang2 in both vascular endothelial cells and lymphatic endothelial cells, and in the case of MEDI antibodies, it was confirmed that the growth of cells by Ang2 was reduced. Confirmed.

In addition, the measurement of the mobility of lymphatic endothelial cells was measured using GE Healthcare's xCelligence RTCA (Realtime cell analyzer). RTCA is a non-invasive cell monitoring system that can check changes in cells by measuring impedance in real time. To perform the cell migration assay, CIM-plate16 (GE Healthcare) consisting of a lower chamber and an upper chamber is used. Microelectrodes to measure impedance are arranged in the upper chamber, so when cells seeded in the chamber move through the micropores, Attached to the electrode, the degree of cell migration can be checked, and this is expressed as a migration index. Lymphatic endothelial cells (P5-7; Lonza) grown in EGM-2 medium (Lonza) were cultured in EBM medium supplemented with 1% FBS for 6 hours. In each well of the lower chamber of CIM-plate16, 2 ug/ml Ang2 and 10D6 antibodies were added to the EBM medium added with 2% FBS, followed by assembly with the upper chamber coated with fibronectin (Sigma). MedImmune's anti-Ang2 antibody was used for efficacy comparison. After 30 ul of serum free EBM medium was added to the upper chamber, it was placed in an incubator for 1 hour for equilibration between the plate and the medium, and the CIM-plate was mounted on the device station in the incubator, and the background value was measured. Lymphatic endothelial cells resuspensioned with serum-free media were seeded at an amount of 60,000 cells/well, left to settle down for 15 minutes, and mounted on a device to measure cell migration in real time. The degree of cell migration was expressed as Slope (1/hr).

Fig. 8 shows the obtained results. As shown in FIG. 8, it was confirmed that the migration of lymphatic endothelial cells into which the 10D6 antibody was put together with Ang2 was increased, but in the case of the MEDI antibody, the migration of cells by Ang2 was inhibited.

Example 11 . 10 D6 Confirmation of cell permeability inhibition effect by antibody

An In vitro vascular permeability assay kit (Millipore) was used to check the cell permeability inhibitory effect of the 10D6 antibody. 5x10 ⁴ HUVEC (ATCC) cells were added to a collagen-coated transwell and cultured for 2 days to create a confluent monolayer. Ang2 200 ng/ml or Ang1 (R&D systems) 200 ng/ml alone, or Ang2 200 ng/ml and 10D6 antibody 1 ug/ml were treated and pre-incubated for 30 minutes, followed by LPS (Lipopolysaccharide) to induce permeability of HUVEC monolayer. ; Sigma) 100 ng/ml or TNF-a (R&D systems) 100 ng/ml was treated. LPS or TNF-a weakens the binding between HUVEC cells to form a gap, thereby increasing the movement of substances between HUVEC monolayers. The LPS-treated group was incubated for 6 hours, and the TNF-a-treated group was incubated for 22 hours, FITC-dextran (Millipore) was treated in the upper chamber, and incubated for 18 minutes. The fluorescence of FITC-Dextran moved to the lower chamber was measured at 485/535 nm (Ex /Em) setting using an Envision 2104 multilabel Reader (Perkinelmer).

Fig. 9 shows the obtained results. 9 is a graph showing the measured fluorescence intensity as a relative fold, indicating vascular permeability induced by LPS or TNF-a. Through the above results, it can be seen that the vascular permeability increased by LPS or TNF-a decreased to contorl level in the Ang1 treatment group and the Ang2 and 10D6 antibody treatment groups.

Example 12 . 10 D6 Confirmation of anti-inflammatory effect by antibody

In order to confirm the anti-inflammatory effect of the 10D6 antibody, HUVEC (ATCC) cells 4X10 ⁵ were treated with Ang2 alone or with Ang2 and 10D6 antibodies, and Ang1 and Ang2 (R&D systems) and Regeneron's antibody (RG antibody) were used as controls. Groups treated together were included. Ang1 0.2ug/ml, Ang2 0.1ug/ml, or Ang2 0.1ug/ml and antibody 0.5ug/ml were respectively treated on HUVEC cells, and after 30 minutes pre-incubation, LPS (Sigma) 100 to induce an inflammatory response ng/ml was treated and incubated for 5 hours.

The degree of inflammatory response was confirmed by measuring the mRNA expression level of inflammatory substances (ICAM-1, E-selectin). After washing the cells with PBS, RNA was extracted using RNeasy Mini kit (Qiagen), of which 2ug RNA was synthesized into cDNA using Transcriptor First Strand cDNA synthesis kit (Roche). The pPCR reaction was performed using RT2 SYBR ^TM Green Mastermix (Qiagen) and LightCycler ^TM 480 Real-Time PCR System (Roche). HPRT1 is used as an internal control to correct the amount of RNA in the sample, and qPCR follows the following procedure for all primers. Step1: 95°C, 10 min; Step2 (45 cycles): Step 2-1: 95℃, 15 sec; Step 2-2: 60° C., 1 min; Step3: 65°C, 15 sec; Step4: 95℃, continuous (every 20℃); Step6: 40℃, 10 sec.

The primer sequence used for qPCR is summarized in Table 9 below:

The measured relative expression levels of ICAM-1 and E-selectin are shown in FIG. 10. As shown in FIG. 10, it can be seen that the expression of ICAM-1 and E-selectin induced by LPS was significantly suppressed in the Ang1 treatment group and the Ang2 and 10D6 antibody treatment groups.

On the other hand, when the expression of inflammatory substances (ICAM-1, E-selectin, etc.) of vascular endothelial cells is increased, the binding between inflammatory cells and vascular endothelial cells is promoted to induce an inflammatory response. To confirm this, an experiment was conducted to measure the binding between HL-60 (ATCC) cells, which are inflammatory cells, and HUVECs.

HUVEC cells (4X10 ⁵ ) were cultured in a 24-multiwell plate and treated with Ang2 0.1 ug/ml alone or Ang2 0.1 ug/ml and 10D6 antibody 0.5 ug/ml, and Ang1 0.2 ug/ml, and Ang2 0.1 ug as controls. A group treated with /ml and 0.5 ug/ml of Regeneron's antibody (RG antibody) was included. As described above, angiopoietin and antibody were treated on HUVEC cells, and after 30 minutes pre-incubation, TNF-a (eBioscience) 1 ng/ml was treated and incubated for 2 hours and 30 minutes to induce an inflammatory response.

After washing the HUVEC cells with complete media (Lonza), HL-60 cells stained with Calcein-AM (BD bioscience) solution were added to each well by 2.5×10 ⁵ cells and incubated for 1 hour. To remove HL-60 cells that did not bind to HUVEC cells, they were washed three times with PBS and then treated with lysis buffer (0.1% SDS, 50mM Tris.HCl, pH8.0). The obtained lysate was transferred to a 96 well plate and the intensity of fluorescence derived from HL-60 cells was measured at 485/535 nm (Ex / Em) setting using an Envision 2104 multilabel Reader (Perkin Elmer).

Fig. 11 shows the obtained results. The graph of FIG. 11 shows the measured fluorescence intensity as a relative fold, which is proportional to the number of HL-60 cells attached to HUVEC cells. From the above results, it can be confirmed that the binding of HUVEC cells induced by TNF-a and HL-60 cells was significantly inhibited in the Ang1 treatment group and the Ang2 and 10D6 antibody treatment groups.

Example 13. Clause Ang -2 of antibodies Colo205 Tumor growth inhibitory effect

In order to confirm the tumor growth inhibitory effect of the Ang-2 antibody, a colon cancer Xenograft model using the human colon cancer cell line Colo205 (ATCC) was used.

Colo205 cell line was cultured using RPMI-1640 (Gibco) medium to which 10% FBS (Gibco) was added. After resuspension of 5X10 ⁵ Colo205 cell lines in 100 ul of serum-free medium, 4-5 weeks old BALB/c nude mice (Shanghai SLAC Laboratory Animal Co. Ltd.) anesthetized with 1-2% isoflurane subcutaneously were placed subcutaneously in 100 ul of serum-free medium. Was injected. When the tumor size reached 100 to 200 mm ³ , anti-Ang-2 antibody (10D6) was injected intraperitoneally at a concentration of 10 mg/kg twice a week, and then the size of the tumor was measured.

Tumor size (V) was calculated using the following equation:

V=(length x width ² )/2

Fig. 12 shows the obtained results. The x-axis of FIG. 12 indicates the day when antibody treatment is performed in Days after grouping. As shown in Figure 12, it was confirmed that the 10D6 antibody inhibited the growth of colon cancer.

Korea Cell Line Research Foundation KCLRFBP00295 20130513

<110> SAMSUNG ELECTRONICS CO., LTD. <120> Anti-Ang2 antibody <130> DPP20132768KR <160> 13 <170> KopatentIn 1.71 <210> 1 <211> 6 <212> PRT <213> Artificial Sequence <220> <223> CDR-H1 of anti-Ang2 antibody <400> 1 Ser Asp Tyr Ala Trp Asn 1 5 <210> 2 <211> 16 <212> PRT <213> Artificial Sequence <220> <223> CDR-H2 of anti-Ang2 antibody <400> 2 Tyr Ile Asn Tyr Ser Gly Asn Thr Asp Tyr Asn Pro Ser Leu Lys Ser 1 5 10 15 <210> 3 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-H3 of anti-Ang2 antibody <400> 3 Gly Asn Phe Glu Gly Ala Met Asp Tyr 1 5 <210> 4 <211> 11 <212> PRT <213> Artificial Sequence <220> <223> CDR-L1 of anti-Ang2 antibody <400> 4 Lys Ala Ser Gln Ser Val Ser Asn Asp Val Ala 1 5 10 <210> 5 <211> 7 <212> PRT <213> Artificial Sequence <220> <223> CDR-L2 of anti-Ang2 antibody <400> 5 Tyr Ala Ser Asn Arg Tyr Pro 1 5 <210> 6 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> CDR-L3 of anti-Ang2 antibody <400> 6 Gln Gln Asp Tyr Ser Ser Pro Trp Thr 1 5 <210> 7 <211> 118 <212> PRT <213> Artificial Sequence <220> <223> Heavy chain variable region of an anti-Ang2 antibody <400> 7 Asp Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Gln 1 5 10 15 Ser Leu Ser Leu Thr Cys Thr Val Thr Gly Tyr Ser Ile Thr Ser Asp 20 25 30 Tyr Ala Trp Asn Trp Ile Arg Gln Phe Pro Gly Asn Lys Leu Glu Trp 35 40 45 Met Gly Tyr Ile Asn Tyr Ser Gly Asn Thr Asp Tyr Asn Pro Ser Leu 50 55 60 Lys Ser Arg Ser Ser Ile Thr Arg Asp Thr Ser Lys Asn Gln Phe Phe 65 70 75 80 Leu Gln Leu Asn Ser Val Thr Thr Gly Asp Thr Ala Thr Tyr Tyr Cys 85 90 95 Ala Arg Gly Asn Phe Glu Gly Ala Met Asp Tyr Trp Gly Gln Gly Thr 100 105 110 Ser Val Thr Val Ser Ser 115 <210> 8 <211> 354 <212> DNA <213> Artificial Sequence <220> <223> Coding DNA of heavy chain variable region of anti-Ang2 antibody <400> 8 gatgtgcagc ttcaggagtc gggacctgac ctggtgaaac cttctcagtc tctgtccctc 60 acctgcactg tcactggcta ctcaatcacc agtgattatg cctggaactg gatccggcag 120 tttccaggaa acaaactgga gtggatgggc tacataaact acagtggtaa cactgactac 180 aacccatctc tcaaaagtcg aagctctatc actcgagaca catccaagaa ccagttcttc 240 ctgcagttga attctgtgac tactggggac acagccacat attactgtgc aagaggtaac 300 ttcgaaggtg ctatggacta ctggggtcaa ggaacctcag tcaccgtctc ctca 354 <210> 9 <211> 107 <212> PRT <213> Artificial Sequence <220> <223> Light chain variable region of anti-Ang2 antibody <400> 9 Ser Ile Val Met Thr Gln Thr Pro Lys Phe Leu Leu Val Ser Ala Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Ser Val Ser Asn Asp 20 25 30 Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile 35 40 45 Tyr Tyr Ala Ser Asn Arg Tyr Pro Gly Val Pro Asp Arg Phe Thr Gly 50 55 60 Ser Gly Tyr Gly Thr Asp Phe Thr Phe Thr Ile Ser Thr Val Gln Ala 65 70 75 80 Glu Asp Leu Ala Val Tyr Phe Cys Gln Gln Asp Tyr Ser Ser Pro Trp 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 <210> 10 <211> 321 <212> DNA <213> Artificial Sequence <220> <223> Coding DNA of light chain variable region of anti-Ang2 antibody <400> 10 agtattgtga tgacccagac tcccaaattc ctgcttgtat cagcaggaga cagggttacc 60 ataacctgca aggccagtca gagtgtgagt aatgatgtag cttggtacca acagaagcca 120 gggcagtctc ctaaactgct gatatactat gcatccaatc gctaccctgg agtccctgat 180 cgcttcactg gcagtggata tgggacggat ttcactttca ccatcagcac tgtgcaggct 240 gaagacctgg cagtttattt ctgtcagcag gattatagct ctccgtggac gttcggtgga 300 ggcaccaagc tggaaatcaa a 321 <210> 11 <211> 496 <212> PRT <213> Artificial Sequence <220> <223> amino acid sequence of Ang2 <400> 11 Met Trp Gln Ile Val Phe Phe Thr Leu Ser Cys Asp Leu Val Leu Ala 1 5 10 15 Ala Ala Tyr Asn Asn Phe Arg Lys Ser Met Asp Ser Ile Gly Lys Lys 20 25 30 Gln Tyr Gln Val Gln His Gly Ser Cys Ser Tyr Thr Phe Leu Leu Pro 35 40 45 Glu Met Asp Asn Cys Arg Ser Ser Ser Ser Pro Tyr Val Ser Asn Ala 50 55 60 Val Gln Arg Asp Ala Pro Leu Glu Tyr Asp Asp Ser Val Gln Arg Leu 65 70 75 80 Gln Val Leu Glu Asn Ile Met Glu Asn Asn Thr Gln Trp Leu Met Lys 85 90 95 Leu Glu Asn Tyr Ile Gln Asp Asn Met Lys Lys Glu Met Val Glu Ile 100 105 110 Gln Gln Asn Ala Val Gln Asn Gln Thr Ala Val Met Ile Glu Ile Gly 115 120 125 Thr Asn Leu Leu Asn Gln Thr Ala Glu Gln Thr Arg Lys Leu Thr Asp 130 135 140 Val Glu Ala Gln Val Leu Asn Gln Thr Thr Arg Leu Glu Leu Gln Leu 145 150 155 160 Leu Glu His Ser Leu Ser Thr Asn Lys Leu Glu Lys Gln Ile Leu Asp 165 170 175 Gln Thr Ser Glu Ile Asn Lys Leu Gln Asp Lys Asn Ser Phe Leu Glu 180 185 190 Lys Lys Val Leu Ala Met Glu Asp Lys His Ile Ile Gln Leu Gln Ser 195 200 205 Ile Lys Glu Glu Lys Asp Gln Leu Gln Val Leu Val Ser Lys Gln Asn 210 215 220 Ser Ile Ile Glu Glu Leu Glu Lys Lys Ile Val Thr Ala Thr Val Asn 225 230 235 240 Asn Ser Val Leu Gln Lys Gln Gln His Asp Leu Met Glu Thr Val Asn 245 250 255 Asn Leu Leu Thr Met Met Ser Thr Ser Asn Ser Ala Lys Asp Pro Thr 260 265 270 Val Ala Lys Glu Glu Gln Ile Ser Phe Arg Asp Cys Ala Glu Val Phe 275 280 285 Lys Ser Gly His Thr Thr Asn Gly Ile Tyr Thr Leu Thr Phe Pro Asn 290 295 300 Ser Thr Glu Glu Ile Lys Ala Tyr Cys Asp Met Glu Ala Gly Gly Gly 305 310 315 320 Gly Trp Thr Ile Ile Gln Arg Arg Glu Asp Gly Ser Val Asp Phe Gln 325 330 335 Arg Thr Trp Lys Glu Tyr Lys Val Gly Phe Gly Asn Pro Ser Gly Glu 340 345 350 Tyr Trp Leu Gly Asn Glu Phe Val Ser Gln Leu Thr Asn Gln Gln Arg 355 360 365 Tyr Val Leu Lys Ile His Leu Lys Asp Trp Glu Gly Asn Glu Ala Tyr 370 375 380 Ser Leu Tyr Glu His Phe Tyr Leu Ser Ser Glu Glu Leu Asn Tyr Arg 385 390 395 400 Ile His Leu Lys Gly Leu Thr Gly Thr Ala Gly Lys Ile Ser Ser Ile 405 410 415 Ser Gln Pro Gly Asn Asp Phe Ser Thr Lys Asp Gly Asp Asn Asp Lys 420 425 430 Cys Ile Cys Lys Cys Ser Gln Met Leu Thr Gly Gly Trp Trp Phe Asp 435 440 445 Ala Cys Gly Pro Ser Asn Leu Asn Gly Met Tyr Tyr Pro Gln Arg Gln 450 455 460 Asn Thr Asn Lys Phe Asn Gly Ile Lys Trp Tyr Tyr Trp Lys Gly Ser 465 470 475 480 Gly Tyr Ser Leu Lys Ala Thr Thr Met Met Ile Arg Pro Ala Asp Phe 485 490 495 <210> 12 <211> 121 <212> PRT <213> Artificial Sequence <220> <223> heavy chain variable region of 4H10 <400> 12 Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Leu Ile Ser Pro Asp Ser Ser Ser Ile Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Lys Asp Leu Ile Ser Phe Trp Arg Gly Gly Phe Asp Tyr Trp Gly 100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 <210> 13 <211> 111 <212> PRT <213> Artificial Sequence <220> <223> light chain variable region of 4H10 <400> 13 Gln Ser Val Leu Thr Gln Pro Pro Ser Ala Ser Gly Thr Pro Gly Gln 1 5 10 15 Arg Val Thr Ile Ser Cys Ser Gly Ser Ser Ser Asn Ile Gly Ser Asn 20 25 30 Tyr Val Asn Trp Tyr Gln Gln Leu Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45 Ile Tyr Ala Asp Ser Asn Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60 Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg 65 70 75 80 Ser Glu Asp Glu Ala Asp Tyr Tyr Cys Gly Ser Trp Asp Tyr Ser Leu 85 90 95 Ser Gly Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu Gly 100 105 110

Claims (6)

(1) contacting a candidate compound with a sample containing Ang2 and Tie2 receptors; And
(2) i) confirming the formation of a complex in which the candidate compound, Ang2, and Tie2 receptors are bound, ii) confirming the inhibition of Ang2 and activation of the Tie2 receptor, or both of the steps i) and ii)
Containing,
A method of screening for candidate substances for the prevention or treatment of diseases associated with Ang2 overexpression, neovascularization, vascular permeability enhancement, or reduction in normal angiogenesis. The method of claim 1, wherein the step of confirming the formation of a complex in which i) a candidate compound, Ang2, and Tie2 receptors are bound,
(a) confirmation of the presence or absence of a complex to which the candidate compound, Ang2, and Tie2 receptors are bound, or
(b) Confirmation of binding between the candidate compound and Ang2 and binding between Ang2 and Tie2
Which is carried out by the method. The method of claim 1, wherein the activation of the Tie2 receptor in step ii),
(a) increased phosphorylation of the Tie2 receptor,
(b) increased phosphorylation of proteins involved in downstream signaling of the Tie2 receptor,
(c) increased intracellular migration of the Tie2 receptor, or
(d) combinations thereof
As confirmed by the method. The method of claim 3, wherein the protein involved in the downstream signal of the Tie2 receptor is at least one selected from the group consisting of Akt, eNOS, and 42/44 (NM_002745). According to any one of claims 1 to 4, wherein the Ang2 overexpression, neovascularization, vascular permeability enhancement, or normal angiogenesis reduction-related diseases are cancer, cancer metastasis, inflammatory disease, infection, cardiovascular disease, kidney disease. , Hereditary hemorrhagic telangiectasia, asthma, edema, myocardial infarction, angina, cerebral infarction, stroke, Berger's disease, avascular necrosis, foot ulcer, or erectile dysfunction, method. Contacting the candidate compound with the epitope of Ang2 having the amino acid sequence of SEQ ID NO: 11; And
Measuring the binding force between the epitope and the candidate compound; And
Steps to confirm the binding of Ang2 and Tie2 receptors
Including,
The epitope of Ang2 is Q418, P419 of Ang2 of SEQ ID NO: 11, or a combination of Q418 and P419,
A method for screening candidates for anti-Ang2 antibodies.

Images