KR102145793B1 - Pharmaceutical compositions for the prevention or treatment of influenza virus infection - Google Patents

Pharmaceutical compositions for the prevention or treatment of influenza virus infection Download PDF

Info

Publication number
KR102145793B1
KR102145793B1 KR1020190037637A KR20190037637A KR102145793B1 KR 102145793 B1 KR102145793 B1 KR 102145793B1 KR 1020190037637 A KR1020190037637 A KR 1020190037637A KR 20190037637 A KR20190037637 A KR 20190037637A KR 102145793 B1 KR102145793 B1 KR 102145793B1
Authority
KR
South Korea
Prior art keywords
leu
glu
lys
ile
protein
Prior art date
Application number
KR1020190037637A
Other languages
Korean (ko)
Inventor
이흥규
정희은
Original Assignee
한국과학기술원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국과학기술원 filed Critical 한국과학기술원
Priority to KR1020190037637A priority Critical patent/KR102145793B1/en
Application granted granted Critical
Publication of KR102145793B1 publication Critical patent/KR102145793B1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y306/00—Hydrolases acting on acid anhydrides (3.6)
    • C12Y306/05—Hydrolases acting on acid anhydrides (3.6) acting on GTP; involved in cellular and subcellular movement (3.6.5)
    • C12Y306/05005—Dynamin GTPase (3.6.5.5)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biomedical Technology (AREA)
  • Communicable Diseases (AREA)
  • Pulmonology (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention relates to a pharmaceutical composition for preventing or treating influenza virus infection. Influenza is an infectious disease caused by the influenza virus of Orthomyxovirus family, and is also called flu. In the 20th century, there were three global pandemics of the new influenza outbreak, and tens of millions of people died. It is known that myxovirus-resistant proteins, one type of GTPases, have antiviral effects against infection with various RNA viruses, but do not move smoothly between cells due to their self-aggregating properties, and thus are not commercialized as an antiviral agent. Therefore, the present invention is conceived to solve the problems of the related art as described above, and the denatured MxA protein of the present invention has higher solubility than the native MxA protein, and thus moves efficiently between cells, and has an excellent antiviral activity. Therefore, this protein is expected to be widely used in the medical field as a preventive or therapeutic agent for influenza virus infection.

Description

인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물{Pharmaceutical compositions for the prevention or treatment of influenza virus infection}Pharmaceutical compositions for the prevention or treatment of influenza virus infection

본 발명은 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물에 관한 것이다.The present invention relates to a pharmaceutical composition for preventing or treating influenza virus infection.

인플루엔자(Influenza)란 오소믹소바이러스과의 인플루엔자 바이러스가 유발하는 감염성 질환으로, 독감(flu)이라고도 명명된다. 일반적인 증상은 오한, 발열, 인후염, 근육통, 두통, 기침, 무력감과 불쾌감으로, 독감은 이런 비특이적 증상의 정도가 몸살감기보다 심하고, 전격성 폐렴이나 라이증후군 같은 치명적일 수 있는 합병증을 종종 야기하기도 한다. 보통 감염자의 기침이나 재채기를 통해 공기 중으로 나오는, 바이러스가 함유된 연무질을 흡입함으로써 인플루엔자에 감염되고, 조류의 배설물, 침, 콧물, 대변과 혈액으로도 전염될 수 있다. 때때로 변이된 인플루엔자 바이러스는 수 천에서 수 만명이 사망하는 유행성 독감을 전 세계에 걸쳐 일으키는데, 여러 해에 걸쳐 일어난 전 세계적 유행때에는 보통 약 백만명이 사망하였다. 20세기에는 새로운 인플루엔자로 발생된 독감의 세계적 유행이 세 번 있었으며, 수 천 만명에 이르는 사람들이 사망하였다. 이런 변종은 다른 동물에게서 인간으로 감염이 일어날 때, 또는 인간을 숙주로 삼는 종이 다른 동물을 숙주로 삼는 종에게서 유전자를 받았을 때 자주 발생한다. 따라서 인플루엔자 유행을 예방하고자 독감 예방주사가 개발되었으나, 인플루엔자 바이러스가 계속 변이하고 있어 완벽하게 예방되지 못하고 있는 실정이다.Influenza (Influenza) is an infectious disease caused by influenza virus of the family Orsomyxovirus, and is also called flu. Common symptoms are chills, fever, sore throat, muscle pain, headache, cough, weakness and discomfort.The flu is more severe than cold, and often causes potentially fatal complications such as fulminant pneumonia or Reye's syndrome. Influenza is infected by inhaling the virus-containing aerosol, which usually comes into the air through coughing or sneezing of an infected person, and can also be transmitted through bird droppings, saliva, runny nose, feces and blood. Sometimes mutated influenza viruses cause pandemic flu, which kills thousands to tens of thousands of people around the world, and during a multi-year global pandemic, it usually kills about a million. In the twentieth century, there were three global pandemics of the new influenza outbreak, killing tens of thousands of people. These strains often occur when human infections occur from other animals, or when human-hosted species receive genes from other animal-hosted species. Therefore, influenza vaccines were developed to prevent influenza outbreaks, but the influenza virus continues to mutate, so it is not completely prevented.

한편, 1962년, 린데만(Lindenmann)에 의해 A2G 계통의 마우스가 인플루엔자 바이러스(Influenza virus) 감염에 저항성을 갖고 있다는 것이 밝혀진 이후, 저항성의 원인을 밝히기 위하여 다양한 후속 연구들이 이루어졌고 이를 통하여, 타입 I 인터페론에 의해 생성이 유도되는 GTPases(Dynamin-like large guanosine triphosphatases)의 한 종류인 Mx(믹소바이러스 저항성, Myxovirus(influenza virus) resistance) 단백질들이 다양한 RNA 바이러스의 감염에 대한 항바이러스 기작을 촉진시키는데 중요한 역할을 하는 것이 밝혀졌다(Genome Res 12, 2002, 527-530). Mx GTPase의 종류는 종에 따라 다양한데, 그 중 MxA 단백질은 광범위한 바이러스에 대한 인터페론 유발 항바이러스 반응의 핵심 매개체이다. MxA 발현은 타입 제 1 형, 및 제 3 형 인터페론에 의해 엄격히 조절되고, 바이러스 또는 다른 자극에 의해서는 직접 유도되지 않는다. MxA는 큰 GTPase의 다이나민 수퍼 패밀리와 많은 특성을 공유하며, 다이나민과 마찬가지로 고순도의 올리고머로 자가 응집(self-assembly)되고, 고리와 같은 구조를 형성하여 바이러스의 vRNP 주위를 둘러싸서 그 기능을 방해한다(J Interferon Cytokine Res. 2011, Jan;31(1):79-87). 이러한 MxA 단백질은 다양한 바이러스의 감염에 대한 선천성 면역 반응에 관여하여 바이러스의 활성화를 저해하고 바이러스의 증식을 억제하여 항바이러스 제제로 사용될 수 있을 것이 기대되었으나, MxA 단백질의 자가 응집되는 특성 때문에 세포 간에 원활히 이동하지 못하고 자가 응집한 상태로 존재한다. 따라서 항바이러스 제제로 상용화되지 못하고 있는 실정이다.Meanwhile, in 1962, after it was discovered by Lindenmann that A2G-type mice were resistant to influenza virus infection, various follow-up studies were conducted to determine the cause of resistance, and through this, type I Mx (myxovirus (influenza virus) resistance) proteins, a type of GTPases (Dynamin-like large guanosine triphosphatases) induced by interferon production, play an important role in promoting antiviral mechanisms against infection of various RNA viruses. (Genome Res 12, 2002, 527-530). The types of Mx GTPase vary from species to species, of which MxA protein is a key mediator of interferon-induced antiviral response to a wide range of viruses. MxA expression is tightly regulated by type 1 and type 3 interferons and not directly induced by viruses or other stimuli. MxA shares many properties with the Dynamin superfamily of large GTPases. Like Dynamin, it self-assemblies as a high-purity oligomer, forms a ring-like structure, and surrounds the viral vRNP to perform its functions. It interferes (J Interferon Cytokine Res. 2011, Jan;31(1):79-87). These MxA proteins are expected to be used as antiviral agents by inhibiting viral activation and inhibiting viral proliferation by participating in the innate immune response against infection of various viruses. However, due to the self-aggregating properties of MxA proteins, smoothly between cells. It cannot move and exists in a self-aggregated state. Therefore, it has not been commercialized as an antiviral agent.

따라서 본 발명은 새로운 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물에 관한 것으로, 보다 구체적으로 세포간 이동이 촉진되도록 용해성을 증가시킨 변성 MxA 단백질을 유효성분으로 포함하는 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물에 관한 것이다. 본 발명의 변성 MxA 단백질은 자연형 MxA 단백질보다 용해도가 높아 세포 간에 효율적으로 이동되고, 우수한 항바이러스 활성을 나타내므로, 의학 분야에서 크게 이용될 것으로 기대된다.Therefore, the present invention relates to a pharmaceutical composition for the prevention or treatment of new influenza virus infection, and more specifically, a pharmaceutical composition for preventing or treating influenza virus infection, comprising as an active ingredient a denatured MxA protein having increased solubility so as to promote intercellular migration It relates to the composition. The denatured MxA protein of the present invention has higher solubility than the native MxA protein, so it moves efficiently between cells and exhibits excellent antiviral activity, and is expected to be widely used in the medical field.

본 발명은 상기와 같은 종래의 기술 상의 문제점을 해결하기 위해 안출된 것으로, 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물을 제공하는 것을 그 목적으로 한다.The present invention was conceived to solve the problems of the prior art as described above, and an object thereof is to provide a pharmaceutical composition for preventing or treating influenza virus infection.

그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당업계에서 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다.However, the technical problem to be achieved by the present invention is not limited to the problems mentioned above, and other problems that are not mentioned will be clearly understood by those of ordinary skill in the art from the following description.

이하, 본원에 기재된 다양한 구체예가 도면을 참조로 기재된다. 하기 설명에서, 본 발명의 완전한 이해를 위해서, 다양한 특이적 상세사항, 예컨대, 특이적 형태, 조성물, 및 공정 등이 기재되어 있다. 그러나, 특정의 구체예는 이들 특이적 상세사항 중 하나 이상 없이, 또는 다른 공지된 방법 및 형태와 함께 실행될 수 있다. 다른 예에서, 공지된 공정 및 제조 기술은 본 발명을 불필요하게 모호하게 하지 않게 하기 위해서, 특정의 상세사항으로 기재되지 않는다. "한 가지 구체예" 또는 "구체예"에 대한 본 명세서 전체를 통한 참조는 구체예와 결부되어 기재된 특별한 특징, 형태, 조성 또는 특성이 본 발명의 하나 이상의 구체예에 포함됨을 의미한다. 따라서, 본 명세서 전체에 걸친 다양한 위치에서 표현된 "한 가지 구체예에서" 또는 "구체예"의 상황은 반드시 본 발명의 동일한 구체예를 나타내지는 않는다. 추가로, 특별한 특징, 형태, 조성, 또는 특성은 하나 이상의 구체예에 서 어떠한 적합한 방법으로 조합될 수 있다.Hereinafter, various embodiments described herein are described with reference to the drawings. In the following description, for a thorough understanding of the present invention, various specific details, such as specific forms, compositions, and processes, are set forth. However, certain embodiments may be practiced without one or more of these specific details, or with other known methods and forms. In other instances, well-known processes and manufacturing techniques have not been described in specific details in order not to unnecessarily obscure the present invention. Reference throughout this specification to “one embodiment” or “an embodiment” means that a particular feature, form, composition, or characteristic described in connection with the embodiment is included in one or more embodiments of the invention. Thus, the context of “in one embodiment” or “an embodiment” expressed in various places throughout this specification does not necessarily represent the same embodiment of the invention. Additionally, particular features, shapes, compositions, or properties may be combined in any suitable manner in one or more embodiments.

명세서에서 특별한 정의가 없으면 본 명세서에 사용된 모든 과학적 및 기술적인 용어는 본 발명이 속하는 기술분야에서 당업자에 의하여 통상적으로 이해되는 것과 동일한 의미를 가진다.Unless otherwise defined in the specification, all scientific and technical terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the present invention belongs.

본 명세서에 있어서, 믹소바이러스 저항성 A(Myxovirus resistance A, MxA) 단백질이란 커다란 GTPase의 다이나민 수퍼 패밀리(dynamin superfamily)에 속하는 항바이러스성 단백질로 오르토믹소바이러스(orthomyxovirus)와 버냐바이러스(bunyaviruses)를 포함한 많은 다른 바이러스에 대해 내재적 항바이러스 활성을 나타내며, 그 발현은 I 형(α/β)이나 III 형(λ) 인터페론에 의해 엄격히 제어된다. 믹소바이러스 저항성 A 단백질은 662개의 아미노산으로 구성되고(서열번호 1), 전체 75.520 Da 크기이며, 고도로 정돈된 올리고머를 자체 조립하여 링과 같은 구조를 형성할 수 있다.In the present specification, the myxovirus resistance A (MxA) protein is an antiviral protein belonging to the dynamin superfamily of large GTPases, including orthomyxovirus and bunyaviruses. It exhibits intrinsic antiviral activity against many other viruses, and its expression is tightly controlled by type I (α/β) or type III (λ) interferons. The myxovirus resistance A protein is composed of 662 amino acids (SEQ ID NO: 1), has a total size of 75.520 Da, and can form a ring-like structure by self-assembling a highly ordered oligomer.

믹소바이러스 저항성 A 단백질은 N 말단으로부터 G도메인(G domain, 또는 GTPase binding domain), 미들도메인(Middle domain), 및 GED(GTPase effect domain)으로 구분되고, 미들도메인과 GED는 α1N, α1C, α2, α3, α4, α6, 및 α1N과 α1C 사이의 L1, α1C와 α2 사이의 L2, α3와 α4 사이의 L3, α3와 α4 사이의 L4 영역으로 구분된다. 특히 GED에 해당하는 L4 및 α4 영역은 믹소바이러스 저항성 A 단백질의 항바이러스 활성 효과를 조절하는 부분으로, 항바이러스 활성에 매우 중요하다(Corinna Patzina 등, THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 289, NO. 9, pp. 6020-6027). 그러나 추가 연구를 통해 상기 MxA 단백질은 300mM 이상의 NaCl 이 포함된 고농도의 salt 조건에서는 수용액 속에 용해되어 존재하나 생리학적 수준(150mM 가량)으로 salt 농도를 낮추면 자가응집되어 3MDa 이상의 거대한 올리고머를 형성하며 불용성의 침전을 이루는 것이 확인되었다(Georg Kochs등, THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 277, NO. 16, pp. 14172-14176, 2002). 이렇듯 MxA 단백질은 자가 응집되는 특성 때문에 세포 내에서 자가 응집한 올리고머 상태로 존재하므로, GED 영역의 활성조절, 및 세포간 이동에 제한을 받는다는 것이 알려졌다. 따라서 항바이러스 제제로 상용화되지 못하고 있는 실정이다.Myxovirus-resistant A protein is divided into a G domain (G domain, or GTPase binding domain), a middle domain, and a GED (GTPase effect domain) from the N-terminus, and the middle domain and GED are α1N, α1C, α2, It is divided into regions of α3, α4, α6, and L1 between α1N and α1C, L2 between α1C and α2, L3 between α3 and α4, and L4 between α3 and α4. In particular, the L4 and α4 regions corresponding to GED are parts that regulate the antiviral activity effect of the myxovirus resistance A protein, and are very important for antiviral activity (Corinna Patzina et al., THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 289, NO. 9 , pp. 6020-6027). However, through further research, the MxA protein is dissolved and present in an aqueous solution under high salt conditions containing 300 mM NaCl, but when the salt concentration is lowered to a physiological level (about 150 mM), it self-aggregates to form a huge oligomer of 3 MDa or more. It was confirmed that precipitation was formed (Georg Kochs et al., THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 277, NO. 16, pp. 14172-14176, 2002). As such, it is known that the MxA protein exists in a self-aggregated oligomer state in the cell due to its self-aggregating property, and therefore is limited in the regulation of the activity of the GED region and the movement between cells. Therefore, it has not been commercialized as an antiviral agent.

본 명세서에 있어서, 단백질 전달 도메인(Protein transduction domain, PTD)이란 3 내지 30개의 아미노산으로 구성된 펩타이드로 단백질, 펩타이드, DNA 등 다양한 물질과 결합하여 특별한 수용체 없이도 물질들을 세포 내부로 이동시킬 수 있는 펩타이드를 말한다. 바람직하게는 하기 표 1에 기재한 서열, 즉, 아르기닌(Arginine)이 5 내지 10개가 결합된 서열, 전사 트랜스 활성자(Trans-activator of transcription, TAT), ANTP, Vp22, MTS, Pep-1, Pep-2 등일 수 있으나, MxA 단백질과 결합하여 세포막을 통과하여 세포간 이동을 촉진할 수 있는 도메인이라면 제한이 없다.In the present specification, the protein transduction domain (PTD) is a peptide composed of 3 to 30 amino acids, and is a peptide that can move substances into cells without a special receptor by binding with various substances such as proteins, peptides, and DNA. Say. Preferably, the sequence shown in Table 1 below, that is, a sequence in which 5 to 10 arginine is bound, a trans-activator of transcription (TAT), ANTP, Vp22, MTS, Pep-1, Pep-2 or the like may be used, but there is no limitation as long as it is a domain capable of promoting intercellular migration by binding to the MxA protein and passing through the cell membrane.

정의Justice 서열order 아르기닌(Arginine)이 5 내지 10개가 결합Arginine (Arginine) is 5 to 10 bound RRRRR 내지 RRRRRRRRRRRRRRR to RRRRRRRRRR 전사 트랜스 활성자(TAT)Transcriptional trans activator (TAT) YGRKKRRORRRYGRKKRRORRR ANTPANTP RQIKIWFQNRRMKWKKRQIKIWFQNRRMKWKK Vp22Vp22 DAATATRGRSAASRPTERPRAPARSASRPRRPVEDAATATRGRSAASRPTERPRAPARSASRPRRPVE MTSMTS AAVALLPAVLLALLAPAAADQNQLMPAAVALLPAVLLALLAPAAADQNQLMP Pep-1Pep-1 KETWWETWWTEWSQPKKKRKVKETWWETWWTEWSQPKKKRKV Pep-2Pep-2 KETWFETWFTEWSQPKKKRKVKETWFETWFTEWSQPKKKRKV

본 명세서에 있어서, 항바이러스란 동물, 식물, 세균, 방사균 등 살아있는 세포에 기생하며 세포 내에서만 증식할 수 있는 바이러스 감염에 대한 예방 또는 치료 작용을 의미하며, 상기 바이러스는 본 발명의 변성 MxA 단백질에 의하여 증식이 억제되는 바이러스라면 제한이 없으나, 바람직하게는 오르토믹소바이러스(orthomyxoviridae)과 인플루엔자 바이러스(influenza virus)를 의미한다.In the present specification, anti-virus refers to a prophylactic or therapeutic action against viral infection that is parasitic in living cells such as animals, plants, bacteria, and radioactive bacteria and can only proliferate within cells, and the virus is the denatured MxA protein of the present invention. There is no limitation if it is a virus whose proliferation is inhibited by, but preferably, it means an orthomyxoviridae and an influenza virus.

본 명세서에 있어서, 약학조성물이란 특정한 목적을 위해 투여되는 조성물을 의미한다. 본 발명의 목적상, 본 발명의 약학조성물은 인플루엔자 바이러스 감염을 예방 또는 치료하기 위한 것이며, 이에 관여하는 화합물 및 약학적으로 허용 가능한 담체, 부형제 또는 희석제를 포함할 수 있다. 또한 본 발명에 따른 약학 조성물은 조성물 총 중량에 대하여 본 발명의 유효성분을 0.1 내지 50 중량%로 포함한다. 본 발명의 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있으나, 이에 제한되는 것은 아니다.In the present specification, the pharmaceutical composition refers to a composition administered for a specific purpose. For the purposes of the present invention, the pharmaceutical composition of the present invention is for preventing or treating an influenza virus infection, and may include a compound involved therein and a pharmaceutically acceptable carrier, excipient, or diluent. In addition, the pharmaceutical composition according to the present invention contains 0.1 to 50% by weight of the active ingredient of the present invention based on the total weight of the composition. Carriers, excipients and diluents that may be included in the composition of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil may be mentioned, but are not limited thereto.

본 명세서에 있어서, 투여란 어떠한 적절한 방법으로 환자에게 본 발명의 조성물을 도입하는 것을 의미하며, 본 발명의 조성물의 투여경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 경구 투여, 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 투여, 피내 투여, 비내 투여, 폐내 투여, 직장내 투여, 강내 투여, 복강 내 투여, 경막 내 투여가 이루어질 수 있으나, 이에 제한되지는 않는다. 본 발명에서 유효량은 질환의 종류, 질환의 중증도, 조성물에 함유된 유효 성분 및 다른 성분의 종류 및 함량, 제형의 종류 및 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료 기간, 동시 사용되는 약물을 비롯한 다양한 인자에 따라 조절될 수 있다. 성인의 경우, 상기 치료용 약학조성물을 1회 50ml~500ml의 양으로 체내에 투여 가능하며, 화합물일 경우 0.1ng/kg-10㎎/kg, 모노클로날 항체일 경우 0.1ng/kg-10㎎/kg의 용량으로 투여될 수 있다. 투여간격은 1일 1회 내지 12회일 수 있으며, 1일 12회 투여할 경우에는 2시간마다 1회씩 투여할 수 있다. 또한 본 발명의 약학조성물은 목적하고자 하는 암 줄기세포의 치료를 위해 단독 또는 당업계에 공지된 다른 치료법, 예를 들어 화학요법제, 방사선 및 수술과 같이 투여될 수 있다. 또한 본 발명의 약학조성물은 면역 반응을 증진하기 위하여 고안된 다른 치료, 예를 들어 당업계에 주지된 것과 같은 어쥬번트 또는 사이토카인(또는 사이토카인을 코딩하는 핵산)과 혼합하여 투여될 수 있다. 바이오리스틱(biolistic) 전달 또는 생체 외(ex vivo) 처리와 같은 다른 표준 전달 방법들이 사용될 수도 있다. 생체 외 처리에서 예를 들어 항원제시 세포들(APCs), 수지상세포들, 말초혈액 단핵구 세포들, 또는 골수세포들을 환자 또는 적당한 공여자로부터 얻어서 본 약학조성물로 생체 외에서 활성화된 후 그 환자에게 투여될 수 있다.In the present specification, administration means introducing the composition of the present invention to a patient by any suitable method, and the administration route of the composition of the present invention may be administered through any general route as long as it can reach the target tissue. Oral administration, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, intranasal administration, intrapulmonary administration, rectal administration, intranasal administration, intraperitoneal administration, intrathecal administration, but not limited thereto. Does not. In the present invention, the effective amount is the type of disease, the severity of the disease, the type and content of the active ingredient and other ingredients contained in the composition, the type of formulation and the age, weight, general health condition, sex and diet, administration time, route of administration And the secretion rate of the composition, duration of treatment, and drugs used simultaneously. In the case of adults, the therapeutic pharmaceutical composition can be administered in the body in an amount of 50ml~500ml once, 0.1ng/kg-10mg/kg in the case of a compound, 0.1ng/kg-10mg in the case of a monoclonal antibody It can be administered at a dose of /kg. The administration interval may be 1 to 12 times a day, and in the case of administration 12 times a day, it may be administered once every 2 hours. In addition, the pharmaceutical composition of the present invention may be administered alone or with other treatments known in the art, such as chemotherapeutic agents, radiation, and surgery, for the treatment of desired cancer stem cells. In addition, the pharmaceutical composition of the present invention may be administered in combination with other treatments designed to enhance the immune response, for example, adjuvants or cytokines (or nucleic acids encoding cytokines) as well known in the art. Other standard delivery methods may be used such as biolistic delivery or ex vivo treatment. In ex vivo treatment, for example, antigen presenting cells (APCs), dendritic cells, peripheral blood mononuclear cells, or bone marrow cells can be obtained from a patient or a suitable donor, activated in vitro with this pharmaceutical composition, and then administered to the patient. have.

본 발명의 일 구체예에서, 서열번호 1로 표시되는 단백질에서 1개 이상의 류신이 아스파르트산으로 치환된 변성 단백질을 제공하고, 상기 변성 단백질은 서열번호 1의 단백질보다 용해성이 증가한 것인 변성 단백질을 제공하며, 상기 변성 단백질은 서열번호 2로 표시되는 것인 변성 단백질을 제공하며, 상기 변성 단백질은 N 말단에 단백질 전달 도메인(Protein transduction domain, PTD)이 추가로 결합된 것인 변성 단백질을 제공하며, 상기 단백질 전달 도메인은 5개 내지 10개의 아르기닌(Arginine)이 결합된 것, 전사 트랜스 활성자(Trans-activator of transcription, TAT), ANTP, Vp22, MTS, Pep-1, 및 Pep-2로 구성되는 그룹으로부터 선택되는 어느 하나인 변성 단백질을 제공하며, 상기 단백질 전달 도메인은 전사 트랜스 활성자(Trans-activator of transcription, TAT)인 변성 단백질을 제공한다. In one embodiment of the present invention, a denatured protein in which at least one leucine is substituted with aspartic acid in the protein represented by SEQ ID NO: 1 is provided, and the denatured protein has increased solubility than the protein of SEQ ID NO: 1. Provided, wherein the denatured protein provides a denatured protein represented by SEQ ID NO: 2, wherein the denatured protein provides a denatured protein in which a protein transduction domain (PTD) is additionally bound to the N-terminus, and , The protein transduction domain is composed of 5 to 10 arginine (Arginine) bound, transcriptional trans activator (Trans-activator of transcription, TAT), ANTP, Vp22, MTS, Pep-1, and Pep-2 A denatured protein selected from the group is provided, and the protein transduction domain provides a denatured protein which is a trans-activator of transcription (TAT).

본 발명의 다른 구체예에서, 상기 중 어느 하나 이상의 변성 단백질을 코딩하는 재조합 유전자를 제공한다.In another embodiment of the present invention, a recombinant gene encoding any one or more of the above denatured proteins is provided.

본 발명의 또 다른 구체예에서, 상기의 재조합 유전자를 포함하는 재조합 벡터를 제공하고, 상기 벡터는 대장균 과발현 벡터인 재조합 벡터를 제공하며, 상기 벡터는 pET28a 벡터인 재조합 벡터를 제공하며, 상기 벡터는 히스티딘-표지(Histidine-tag) 유전자를 포함하는 것인 재조합 벡터를 제공한다.In another embodiment of the present invention, a recombinant vector containing the recombinant gene is provided, wherein the vector provides a recombinant vector that is an E. coli overexpression vector, and the vector provides a recombinant vector that is a pET28a vector, the vector It provides a recombinant vector containing a histidine-labeled (Histidine-tag) gene.

본 발명의 또 다른 구체예에서, 상기 중 어느 하나 이상의 재조합 벡터로 형질전환된 인간을 제외한 형질전환체를 제공하고, 상기 형질전환체는 미생물인 형질전환체를 제공한다.In another embodiment of the present invention, a transformant other than humans transformed with any one or more of the above recombinant vectors is provided, and the transformant is a microorganism.

본 발명의 또 다른 구체예에서, 상기 중 어느 하나 이상의 변성 단백질을 유효성분으로 포함하는 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물을 제공하고, 상기 인플루엔자 바이러스는 인플루엔자 A 바이러스인 것인 약학조성물을 제공한다.In another embodiment of the present invention, there is provided a pharmaceutical composition for preventing or treating influenza virus infection comprising any one or more of the above denatured proteins as an active ingredient, and the influenza virus is an influenza A virus. do.

이하 상기 본 발명을 단계별로 상세히 설명한다.Hereinafter, the present invention will be described in detail step by step.

본 발명은 새로운 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물에 관한 것으로, 보다 구체적으로 세포간 이동이 촉진되도록 용해성을 증가시킨 변성 MxA 단백질을 유효성분으로 포함하는 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물에 관한 것이다. 본 발명의 변성 MxA 단백질은 자연형 MxA 단백질보다 용해도가 높아 세포 간에 효율적으로 이동되고, 우수한 항바이러스 활성을 나타내므로, 의학 분야에서 크게 이용될 것으로 기대된다.The present invention relates to a pharmaceutical composition for preventing or treating a new influenza virus infection, and more specifically, a pharmaceutical composition for preventing or treating influenza virus infection, comprising as an active ingredient a denatured MxA protein having increased solubility to promote intercellular migration It is about. The denatured MxA protein of the present invention has higher solubility than the native MxA protein, so it moves efficiently between cells and exhibits excellent antiviral activity, and is expected to be widely used in the medical field.

도 1은 본 발명의 일 실시예에 따른, PTD TAT(YGRKKRRQRRR) 결합된 WT, 또는 Mut 단백질의 모식도를 나타낸 것이다.
도 2는 본 발명의 일 실시예에 따른, PTD-WT, 및 PTD-Mut 단백질의 용해도를 확인한 결과를 나타낸 것이다.
도 3은 본 발명의 일 실시예에 따른, 세포 내 PTD-WT, 또는 PTD-Mut 단백질의 크기와 위치를 공초점 현미경으로 관찰한 결과를 나타낸 것이다.
도 4는 본 발명의 일 실시예에 따른, PTD-WT, 및 PTD-Mut 단백질의 항-바이러스 효과를 비교한 결과를 나타낸 것이다.
도 5는 본 발명의 일 실시예에 따른, 인플루엔자에 감염된 세포에서 사후 PTD-Mut 단백질 투여의 바이러스 부하 조절능을 다양한 바이러스로 확인한 결과를 나타낸 것이다.1 is a schematic diagram of a PTD TAT (YGRKKRRQRRR) bound WT or Mut protein according to an embodiment of the present invention.
Figure 2 shows the results of confirming the solubility of PTD-WT and PTD-Mut proteins according to an embodiment of the present invention.
3 shows the results of observing the size and location of PTD-WT or PTD-Mut proteins in cells according to an embodiment of the present invention with a confocal microscope.
Figure 4 shows the results of comparing the anti-viral effect of PTD-WT and PTD-Mut proteins according to an embodiment of the present invention.
5 is a post-mortem PTD-Mut protein in influenza-infected cells according to an embodiment of the present invention It shows the results of confirming the viral load control ability of administration with various viruses.

이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로서, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.Hereinafter, the present invention will be described in more detail through examples. These examples are only for describing the present invention in more detail, and it will be apparent to those of ordinary skill in the art that the scope of the present invention is not limited by these examples according to the gist of the present invention. .

실시예 1: pET28a-PTD-WT, 및 pET28a-PTD-Mut 벡터 제작Example 1: pET28a-PTD-WT, and pET28a-PTD-Mut vector construction

본 발명자들은 서열번호 1로 표시되는 자연형 단백질에서 아미노산 류신(Leucine, L) 하나가 아스파르트산(Aspartic acid, D)으로 치환되어 자연형 단백질보다 용해성이 증가한 변성 단백질(서열번호 2)을 제조하였다(표 2). 상기 자연형 단백질(WT), 및 변성 단백질(Mut)의 일측에는 단백질 전달 도메인(Protein transduction domain) 서열을 결합하였다.The present inventors prepared a denatured protein (SEQ ID NO: 2) with increased solubility than the native protein by replacing one amino acid leucine (L) with aspartic acid (D) in the native protein represented by SEQ ID NO: 1. (Table 2). A protein transduction domain sequence was coupled to one side of the natural protein (WT) and the denatured protein (Mut).

서열번호Sequence number 염기 정보Base information 서열번호 1SEQ ID NO: 1 MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPGMVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG 서열번호 2SEQ ID NO: 2 MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMDQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPGMVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKYGVDIPEDENEKMFFLIDKINAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIENNFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMDQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG

보다 구체적으로, 서열번호 1을 코딩하는 전장 cDNA를 OriGene(Clone SC118603)으로부터 수득한 후, QuikChange Lightning Site-Directed Mutagenesis Kit(Agilent, Santa Clara, CA)를 사용하여 점 돌연변이를 제조하였다. 이 때 사용한 프라이머 정보를 하기 표 3에 기재하였다.More specifically, after obtaining the full-length cDNA encoding SEQ ID NO: 1 from OriGene (Clone SC118603), point mutations were prepared using QuikChange Lightning Site-Directed Mutagenesis Kit (Agilent, Santa Clara, CA). The primer information used at this time is shown in Table 3 below.

Primer Description Primer Description Primer sequence (5`-3`) Primer sequence (5`-3`) Mut - Primer 1 Mut-Primer 1 TGTCCTGCAGGAGCTGGTCCATGGCCTTCTGAAGC TGTCCTGCAGGAGCTGGTCCATGGCCTTCTGAAGC Mut - Primer 2 Mut-Primer 2 GCTTCAGAAGGCCATGGACCAGCTCCTGCAGGACA GCTTCAGAAGGCCATGGACCAGCTCCTGCAGGACA

His-tag 융합 단백질을 발현시키기 위해 대장균 발현 벡터 pET28a(HM Kim, KAIST, Korea, Korea)를 사용하였고, PTD TAT(YGRKKRRQRRR) 결합된 WT, 또는 Mut 단백질을 함유하는 삽입 DNA를 제조하기 위해, 하기 표 4의 프라이머를 사용하였다. 상기 PTD TAT(YGRKKRRQRRR) 결합된 WT, 또는 Mut 단백질의 모식도를 도 1에 나타내었다.To express the His-tag fusion protein, an E. coli expression vector pET28a (HM Kim, KAIST, Korea, Korea) was used, and to prepare an insert DNA containing PTD TAT (YGRKKRRQRRR) bound WT, or Mut protein, the following The primers in Table 4 were used. A schematic diagram of the PTD TAT (YGRKKRRQRRR) bound WT or Mut protein is shown in FIG. 1.

Primer Description Primer Description Primer sequence (5`-3`) Primer sequence (5`-3`) Forward PrimerForward Primer CTAGCTAGCTATGGCAGGAAGAAGCGGAGACAGAGGAGAAGAGTTGTTTCCGAAGTGGA CATCCTAGCTAGCTATGGCAGGAAGAAGCGGAGACAGAGGAGAAGAGTTGTTTCCGAAGTGGA CATC Reverse PrimerReverse Primer ATAAGAATGCGGCCGCTTAACCGGGGAACTGGGCATAAGAATGCGGCCGCTTAACCGGGGAACTGGGC

삽입된 DNA를 증폭하기 위해 PrimeSTAR HS DNA Polymerase(TAKARA, Shiga, Japan)를 사용하였고, 증폭된 PCR 산물은 Gel Extraction Kit(TAKARA)로 정제하였다. 목적하는 단백질 단편을 Nhe I 및 Not I 제한 효소(NEB, Ipswich, MA)로 분해하고, T4 리가아제(NEB)를 사용하여 pET28a 벡터에 삽입하였다. 재조합된 pET28a-PTD-WT, 또는 pET28a-PTD-Mut 벡터를 DH5α-chemically competent E. coli(Enzynomics, Daejeon, Korea)에서 제조자의 가이드에 따라 증폭시켰다. 이후, 이어서, BL21(DE3) E.coli(Enzynomics) 세포를 pET28a-PTD-WT, 또는 pET28a-PTD-Mut 융합 DNA 서열을 포함하는 pET28a 벡터로 형질 전환시켰다.PrimeSTAR HS DNA Polymerase (TAKARA, Shiga, Japan) was used to amplify the inserted DNA, and the amplified PCR product was purified by Gel Extraction Kit (TAKARA). The desired protein fragment was digested with Nhe I and Not I restriction enzymes (NEB, Ipswich, MA), and inserted into the pET28a vector using T4 ligase (NEB). The recombinant pET28a-PTD-WT, or pET28a-PTD-Mut vector was amplified in DH5α-chemically competent E. coli (Enzynomics, Daejeon, Korea) according to the manufacturer's guide. Thereafter, BL21 (DE3) E. coli (Enzynomics) cells were transformed with pET28a-PTD-WT or pET28a vector containing the pET28a-PTD-Mut fusion DNA sequence.

실시예 2: PTD-WT, 및 PTD-Mut 단백질의 발현 및 정제Example 2: Expression and purification of PTD-WT and PTD-Mut proteins

형질 전환된 BL21 세포를 37 ℃에서 3시간 동안 30 ㎍/㎖의 카나마이신(LPS Solution, Daejeon, Korea)을 함유하는 Circlegrow® Bacterial Growth Medium(MP Biomedicals, Santa Ana, CA)에서 배양한 후, 0.125 mM 이소프로필-티오갈락토시드(isopropyl-thiogalactoside; IPTG)를 첨가하여 18 ℃에서 72시간 동안 추가 배양하였다. 이후, 세포를 원심 분리하고 50 mM HEPES(pH 7.5), 400 mM NaCl, 30mM 이미다졸, 6 mM MgCl2, 1 mM DNAse, 2.5 mM β-머켑토에탄올(β-ME), 및 1 mM 페닐메틸설포닐 플루오라이드(phenylmethylsufonyl fluoride; PMSF)를 함유하는 완충액에 재현탁시켰다. 상기 세포 현탁액을 얼음 위에서 20초 간격으로 90 x 10 초간 초음파 처리하여 용해시키고, 용해물을 4 ℃에서 8000 RPM으로 30 분간 원심 분리하고, His-tagged PTD-WT, 또는 His-tagged PTD-Mut 단백질을 Ni-NTA 수지(Incospharm, 대전, 한국)로 정제하였다. 칼럼은 20 mM HEPES(pH 7.5), 800 mM NaCl, 30 mM 이미다졸, 5 mM MgCl2, 2.5 mM β-ME, 1 mM ATP, 및 10 mM KCl을 포함하는 용액으로 2회 세척하였고, 20 mM HEPES(pH 7.5), 400 mM NaCl, 80 mM 이미다졸, 5 mM MgCl2, 및 2.5 mM β-ME을 포함하는 용액으로 단시간 추가 세척하였다. 이어서, 결합된 단백질을 20 mM HEPES(pH 7.5), 400 mM NaCl, 300 mM 이미다졸, 5 mM MgCl2, 및 2.5 mM β-ME을 포함하는 용액으로 용출하였고, 정제된 PTD-WT, 또는 PTD-Mut 융합 단백질을 내 독소를 제거하기 위해 Pierce High Capacity Endotoxin Removal Resin (Thermo, Waltham, MA)으로 처리하였으며, 20 mM HEPES(pH 7.5), 100 mM NaCl, 1.5 mM MgCl2, 및 2.5 mM β-ME을 포함하는 용액으로 4 ℃에서 하룻밤 투석하였다. 마지막으로, 시료를 4-20% Mini-PROTEAN® TGX Stain-Free ™ Protein Gels(Bio-rad, Hercules, CA)을 사용하여 SDS-PAGE로 분리하고, 단백질 밴드는 ChemiDoc ™ 겔 이미징 시스템(Bio-rad)을 사용하여 검출하였다.Transformed BL21 cells were cultured in Circlegrow® Bacterial Growth Medium (MP Biomedicals, Santa Ana, CA) containing 30 μg/ml kanamycin (LPS Solution, Daejeon, Korea) at 37° C. for 3 hours, and then 0.125 mM Isopropyl-thiogalactoside (IPTG) was added and incubated for 72 hours at 18°C. Thereafter, the cells were centrifuged and 50 mM HEPES (pH 7.5), 400 mM NaCl, 30 mM imidazole, 6 mM MgCl 2 , 1 mM DNAse, 2.5 mM β-mercaptoethanol (β-ME), and 1 mM phenylmethyl It was resuspended in a buffer containing sulfonyl fluoride (phenylmethylsufonyl fluoride; PMSF). The cell suspension was sonicated on ice at 20 second intervals for 90 x 10 seconds to lyse, and the lysate was centrifuged at 8000 RPM at 4° C. for 30 minutes, and His-tagged PTD-WT or His-tagged PTD-Mut protein Was purified with Ni-NTA resin (Incospharm, Daejeon, Korea). The column was washed twice with a solution containing 20 mM HEPES (pH 7.5), 800 mM NaCl, 30 mM imidazole, 5 mM MgCl 2 , 2.5 mM β-ME, 1 mM ATP, and 10 mM KCl, and 20 mM It was further washed for a short time with a solution containing HEPES (pH 7.5), 400 mM NaCl, 80 mM imidazole, 5 mM MgCl 2 , and 2.5 mM β-ME. Subsequently, the bound protein was eluted with a solution containing 20 mM HEPES (pH 7.5), 400 mM NaCl, 300 mM imidazole, 5 mM MgCl 2 , and 2.5 mM β-ME, and purified PTD-WT, or PTD -Mut fusion protein was treated with Pierce High Capacity Endotoxin Removal Resin (Thermo, Waltham, MA) to remove endotoxin, and 20 mM HEPES (pH 7.5), 100 mM NaCl, 1.5 mM MgCl 2, and 2.5 mM β- The solution containing ME was dialyzed overnight at 4°C. Finally, samples were separated by SDS-PAGE using 4-20% Mini-PROTEAN® TGX Stain-Free ™ Protein Gels (Bio-rad, Hercules, CA), and the protein bands were separated by ChemiDoc™ gel imaging system (Bio- rad).

실시예 3: PTD-WT, 및 PTD-Mut 단백질의 용해도 확인Example 3: Confirmation of solubility of PTD-WT and PTD-Mut proteins

PTD-WT 및 PTD-Mut 단백질의 용해도를 비교하기 위해 투석한 시료를 1.5 ml 마이크로 튜브에 옮긴 후 4 ℃에서 30 분 간 기다려 불용해성 단백질의 침전 정도를 확인하였다. 대조군으로서 PTD가 결합되지 않은 WT 단백질을 이용하였다. 실험 결과, WT 및 PTD-WT의 경우 단백질이 고차원 올리고머를 이루어 불용성 응집체 상태로 마이크로 튜브 바닥으로 가라앉는 것이 확인되었으나 PTD-Mut 단백질은 동일한 시간 동안 수용성 상태를 유지하고 불용성 응집체를 이루지 않았다. 상기 결과를 도 2에 나타내었다.In order to compare the solubility of PTD-WT and PTD-Mut proteins, the dialyzed sample was transferred to a 1.5 ml microtube and waited at 4° C. for 30 minutes to determine the degree of precipitation of the insoluble protein. As a control, WT protein to which PTD was not bound was used. As a result of the experiment, in the case of WT and PTD-WT, it was confirmed that the proteins form high-dimensional oligomers and sink to the bottom of the microtube in the state of insoluble aggregates, but the PTD-Mut protein remained in the water-soluble state for the same time and did not form insoluble aggregates. The results are shown in FIG. 2.

실시예 4: PTD-WT, 및 PTD-Mut 단백질의 세포간 이동성 확인Example 4: Confirmation of intercellular mobility of PTD-WT and PTD-Mut proteins

PTD-WT, 및 PTD-Mut 단백질의 세포간, 또는 세포내 이동성을 확인하기 위해 4 x 104 MDCK 세포를 25 ㎍/㎖ PTD-WT, 또는 PTD-Mut 단백질과 함께 배양하였다. 3시간 후, MDCK 세포 내의 PTD-WT, 또는 PTD-Mut 단백질을 공초점 현미경으로 관찰하였다. 간단하게, 세포를 원형질막 염색하기 위해 5 ㎍/㎖의 Alexa Fluor ™ 633이 결합된 Wheat Germ Agglutinin(WGA, Thermo Fisher, Waltham, MA)과 함께 37 ℃에서 10분간 배양하고, 예열된 HBSS로 3회 세척한 후에 Dulbecco's phosphate-buffered saline(DPBS)으로 희석한 4% 파라포름알데히드 용액으로 고정시켰다. 이후, 세포를 DPBS에 희석된 0.2% Triton-X100 용액으로 투과시키고, 1% 소 혈청 알부민(BSA) 및 3% 염소 혈청을 사용하여 블록하였다. 항-MxA 항체(Santa Cruz, Dallas, TX)로 상온에서 2시간 반응시키고, 이어서 Cy3-결합된 염소 항-마우스 IgG(Jackson Immunoresearch, West Grove, PA)로 반응시켰다. DPBS로 3회 세척한 후, DAPI(Abcam, Cambridge, UK)를 포함하는 Fluoroshield 봉입제로 커버 슬립을 정착하였다. 마지막으로, 세포 내 PTD-WT, 또는 PTD-Mut 단백질의 크기와 위치를 LSM800(Carl Zeiss, Oberkochen, Germany) 현미경으로 관찰하였다. In order to confirm the intercellular or intracellular mobility of PTD-WT and PTD-Mut protein, 4 x 10 4 MDCK cells were cultured with 25 μg/ml PTD-WT or PTD-Mut protein. After 3 hours, PTD-WT or PTD-Mut protein in MDCK cells was observed with a confocal microscope. Briefly, in order to stain the plasma membrane of cells, 5 ㎍ / ㎖ Alexa Fluor ™ 633 conjugated Wheat Germ Agglutinin (WGA, Thermo Fisher, Waltham, MA) and incubated for 10 minutes at 37 ℃ for 10 minutes, 3 times with preheated HBSS After washing, it was fixed with a 4% paraformaldehyde solution diluted with Dulbecco's phosphate-buffered saline (DPBS). Thereafter, the cells were permeated with a 0.2% Triton-X100 solution diluted in DPBS, and blocked using 1% bovine serum albumin (BSA) and 3% goat serum. It was reacted with anti-MxA antibody (Santa Cruz, Dallas, TX) for 2 hours at room temperature, followed by reaction with Cy3-linked goat anti-mouse IgG (Jackson Immunoresearch, West Grove, PA). After washing three times with DPBS, a cover slip was fixed with a Fluoroshield encapsulant containing DAPI (Abcam, Cambridge, UK). Finally, the size and location of PTD-WT or PTD-Mut proteins in the cells were observed with a microscope LSM800 (Carl Zeiss, Oberkochen, Germany).

실험 결과, PTD-WT의 경우 단백질이 고차원 올리고머를 형성하여 크게 응집된 채로 세포막 부근에 존재하였으나, PTD-Mut의 경우에는 PTD-WT와 비교하여 응집된 크기가 현저하게 작고 세포질 내에 고르게 분산되어 있는 것을 확인하였다. 상기 결과를 도 3에 나타내었다.As a result of the experiment, in the case of PTD-WT, the protein formed a high-dimensional oligomer and existed in the vicinity of the cell membrane with a large aggregation, but in the case of PTD-Mut, the aggregated size was significantly smaller than that of PTD-WT, which was evenly dispersed in the cytoplasm. Confirmed. The results are shown in FIG. 3.

실시예 5: PTD-WT, 및 PTD-Mut 단백질의 항-바이러스 효과 확인Example 5: Confirmation of anti-viral effects of PTD-WT and PTD-Mut proteins

PTD-WT, 및 PTD-Mut 단백질의 항-인플루엔자 활성을 시험하기 위해서 3 x 105 MDCK 세포를 감염 3시간 전부터 50 ㎍/㎖ PTD-WT, 또는 PTD-Mut 단백질과 함께 배양하였다. 이후, 세포를 IAV PR8(H1N1)의 0.01 감염다중도(multiplicity of infection; MOI) 바이러스(gifted from Akiko Iwasaki, Yale University, New Haven, CT)와 함께 24시간 배양하였다. 감염된 세포의 바이러스 증식은 vRNA 발현을 RT-qPCR로 평가하였다. 그 결과 PTD-WT 또는 PTD-Mut 단백질을 감염 전에 처리하면 유의적으로 세포 내 vRNA의 발현이 감소하는 것이 관찰되었으며, PTD-WT과 PTD-Mut간의 항-바이러스 효과에는 큰 차이가 없는 것이 확인되었다. 이로서 용해성을 증진시킨 PTD-Mut가 PTD-WT 수준의 항-바이러스 효과를 유지하는 것을 확인할 수 있었으며, 상기 결과를 도 4에 나타내었다. In order to test the anti-influenza activity of PTD-WT and PTD-Mut protein, 3 x 10 5 MDCK cells were cultured with 50 μg/ml PTD-WT or PTD-Mut protein 3 hours before infection. Thereafter, the cells were cultured with IAV PR8 (H1N1) 0.01 multiplicity of infection (MOI) virus (gifted from Akiko Iwasaki, Yale University, New Haven, CT) for 24 hours. Virus proliferation of infected cells was evaluated by RT-qPCR for vRNA expression. As a result, it was observed that treatment of PTD-WT or PTD-Mut protein before infection significantly decreased the expression of vRNA in cells, and there was no significant difference in anti-viral effect between PTD-WT and PTD-Mut. . As a result, it was confirmed that PTD-Mut, which has improved solubility, maintains the anti-viral effect of PTD-WT level, and the results are shown in FIG. 4.

또한 인플루엔자에 감염된 세포에서 사후 PTD-Mut 단백질 투여가 바이러스 부하를 조절할 수 있는지 알아보기 위해서 3 x 105 MDCK 세포를 PR8, 또는 X-31(H3N2) (Charles River Laboratories, Wilmington, MA)의 0.01 MOI로 4시간 동안 감염시킨 후, 80 ㎍/㎖의 PTD-Mut 단백질을 첨가하고 24시간 추가 배양하였다. 배양액 상층 내의 바이러스 역가는 플라크 분석법으로 측정하였고, vRNA 발현은 RT-qPCR로 평가하였다.In addition, PTD-Mut protein after death in influenza-infected cells To see if the administration can regulate the viral load, 3 x 10 5 MDCK cells were infected with PR8, or 0.01 MOI of X-31(H3N2) (Charles River Laboratories, Wilmington, MA) for 4 hours, followed by 80 μg/ After adding ㎖ of PTD-Mut protein, it was further cultured for 24 hours. Virus titer in the culture medium was measured by plaque assay, and vRNA expression was evaluated by RT-qPCR.

추가로 PTD-Mut 단백질이 RSV 또는 HSV-2 바이러스의 전파를 억제할 수 있는지 확인하기 위해서 3 x 105 Hep G2 세포, 또는 vero 세포를 RSV(provided by Dr. Jun Chang, Ewha Womans University, Seoul, Korea), 또는 HSV-2 (gifted from Akiko Iwasaki, Yale University)의 1 MOI로 감염시킨 후, 4시간 동안 80 ㎍/㎖의 PTD-Mut 단백질로 치료하였다. vRNA 활성은 감염 24시간 후에 RT-qPCR로 평가하였다.In addition, in order to confirm whether PTD-Mut protein can inhibit the transmission of RSV or HSV-2 virus, 3 x 10 5 Hep G2 cells or vero cells were prepared by Dr. Jun Chang, Ewha Womans University, Seoul, Korea), or HSV-2 (gifted from Akiko Iwasaki, Yale University) after infection with 1 MOI, followed by treatment with 80 μg/ml of PTD-Mut protein for 4 hours. vRNA activity was evaluated by RT-qPCR 24 hours after infection.

그 결과 PTD-Mut 단백질은 바이러스에 이미 감염되어있는 세포에도 효과적으로 작용하여 바이러스 vRNA의 발현을 억제하는 것이 확인되었으며, 이러한 바이러스 증식 억제 효과는 H1N1 아형의 PR8 및 H3N2 아형의 X-31 모두에서 효과적이었다. 그러나 MxA가 항-바이러스 효과를 보이지 않는 것으로 알려진 RSV 혹은 HSV-2 감염에 대해서는 PTD-Mut 단백질이 항-바이러스 효과를 보이지 않는 것이 관찰되었다. 상기 결과를 도 5에 나타내었다.As a result, it was confirmed that the PTD-Mut protein effectively acts on cells already infected with the virus and inhibits the expression of viral vRNA, and this viral proliferation inhibitory effect was effective in both PR8 of the H1N1 subtype and X-31 of the H3N2 subtype. . However, it was observed that the PTD-Mut protein did not show an anti-viral effect against RSV or HSV-2 infection, which is known to have no anti-viral effect of MxA. The results are shown in FIG. 5.

상기 실시예 1 내지 5의 결과로부터, 서열번호 1로 표시되는 자연형 단백질(WT)에서 아미노산 류신(Leucine, L) 하나를 아스파르트산(Aspartic acid, D)으로 치환한 변성 단백질(Mut, 서열번호 2)이 자연형 단백질(WT)에 비하여 용해도가 현저하게 증가하였으며, 이 변성단백질의 항바이러스 효과는 자연형 단백질 수준으로 유지되는 것이 확인되었다. 이는 본 발명에서 제조한 서열번호 2의 단백질이 효과적인 항바이러스 제제로서 유용하게 사용될 수 있음을 의미한다.From the results of Examples 1 to 5, a denatured protein (Mut, SEQ ID NO: 1) in which one amino acid leucine (L) was substituted with aspartic acid (D) in the natural protein (WT) represented by SEQ ID NO: 1 2) It was confirmed that the solubility was remarkably increased compared to the natural protein (WT), and the antiviral effect of this denatured protein was maintained at the level of the natural protein. This means that the protein of SEQ ID NO: 2 prepared in the present invention can be effectively used as an effective antiviral agent.

<110> Korea Advanced Institute of Science and Technology <120> Pharmaceutical compositions for the prevention or treatment of influenza virus infection <130> PDPB187387 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 662 <212> PRT <213> Homo sapiens <400> 1 Met Val Val Ser Glu Val Asp Ile Ala Lys Ala Asp Pro Ala Ala Ala 1 5 10 15 Ser His Pro Leu Leu Leu Asn Gly Asp Ala Thr Val Ala Gln Lys Asn 20 25 30 Pro Gly Ser Val Ala Glu Asn Asn Leu Cys Ser Gln Tyr Glu Glu Lys 35 40 45 Val Arg Pro Cys Ile Asp Leu Ile Asp Ser Leu Arg Ala Leu Gly Val 50 55 60 Glu Gln Asp Leu Ala Leu Pro Ala Ile Ala Val Ile Gly Asp Gln Ser 65 70 75 80 Ser Gly Lys Ser Ser Val Leu Glu Ala Leu Ser Gly Val Ala Leu Pro 85 90 95 Arg Gly Ser Gly Ile Val Thr Arg Cys Pro Leu Val Leu Lys Leu Lys 100 105 110 Lys Leu Val Asn Glu Asp Lys Trp Arg Gly Lys Val Ser Tyr Gln Asp 115 120 125 Tyr Glu Ile Glu Ile Ser Asp Ala Ser Glu Val Glu Lys Glu Ile Asn 130 135 140 Lys Ala Gln Asn Ala Ile Ala Gly Glu Gly Met Gly Ile Ser His Glu 145 150 155 160 Leu Ile Thr Leu Glu Ile Ser Ser Arg Asp Val Pro Asp Leu Thr Leu 165 170 175 Ile Asp Leu Pro Gly Ile Thr Arg Val Ala Val Gly Asn Gln Pro Ala 180 185 190 Asp Ile Gly Tyr Lys Ile Lys Thr Leu Ile Lys Lys Tyr Ile Gln Arg 195 200 205 Gln Glu Thr Ile Ser Leu Val Val Val Pro Ser Asn Val Asp Ile Ala 210 215 220 Thr Thr Glu Ala Leu Ser Met Ala Gln Glu Val Asp Pro Glu Gly Asp 225 230 235 240 Arg Thr Ile Gly Ile Leu Thr Lys Pro Asp Leu Val Asp Lys Gly Thr 245 250 255 Glu Asp Lys Val Val Asp Val Val Arg Asn Leu Val Phe His Leu Lys 260 265 270 Lys Gly Tyr Met Ile Val Lys Cys Arg Gly Gln Gln Glu Ile Gln Asp 275 280 285 Gln Leu Ser Leu Ser Glu Ala Leu Gln Arg Glu Lys Ile Phe Phe Glu 290 295 300 Asn His Pro Tyr Phe Arg Asp Leu Leu Glu Glu Gly Lys Ala Thr Val 305 310 315 320 Pro Cys Leu Ala Glu Lys Leu Thr Ser Glu Leu Ile Thr His Ile Cys 325 330 335 Lys Ser Leu Pro Leu Leu Glu Asn Gln Ile Lys Glu Thr His Gln Arg 340 345 350 Ile Thr Glu Glu Leu Gln Lys Tyr Gly Val Asp Ile Pro Glu Asp Glu 355 360 365 Asn Glu Lys Met Phe Phe Leu Ile Asp Lys Ile Asn Ala Phe Asn Gln 370 375 380 Asp Ile Thr Ala Leu Met Gln Gly Glu Glu Thr Val Gly Glu Glu Asp 385 390 395 400 Ile Arg Leu Phe Thr Arg Leu Arg His Glu Phe His Lys Trp Ser Thr 405 410 415 Ile Ile Glu Asn Asn Phe Gln Glu Gly His Lys Ile Leu Ser Arg Lys 420 425 430 Ile Gln Lys Phe Glu Asn Gln Tyr Arg Gly Arg Glu Leu Pro Gly Phe 435 440 445 Val Asn Tyr Arg Thr Phe Glu Thr Ile Val Lys Gln Gln Ile Lys Ala 450 455 460 Leu Glu Glu Pro Ala Val Asp Met Leu His Thr Val Thr Asp Met Val 465 470 475 480 Arg Leu Ala Phe Thr Asp Val Ser Ile Lys Asn Phe Glu Glu Phe Phe 485 490 495 Asn Leu His Arg Thr Ala Lys Ser Lys Ile Glu Asp Ile Arg Ala Glu 500 505 510 Gln Glu Arg Glu Gly Glu Lys Leu Ile Arg Leu His Phe Gln Met Glu 515 520 525 Gln Ile Val Tyr Cys Gln Asp Gln Val Tyr Arg Gly Ala Leu Gln Lys 530 535 540 Val Arg Glu Lys Glu Leu Glu Glu Glu Lys Lys Lys Lys Ser Trp Asp 545 550 555 560 Phe Gly Ala Phe Gln Ser Ser Ser Ala Thr Asp Ser Ser Met Glu Glu 565 570 575 Ile Phe Gln His Leu Met Ala Tyr His Gln Glu Ala Ser Lys Arg Ile 580 585 590 Ser Ser His Ile Pro Leu Ile Ile Gln Phe Phe Met Leu Gln Thr Tyr 595 600 605 Gly Gln Gln Leu Gln Lys Ala Met Leu Gln Leu Leu Gln Asp Lys Asp 610 615 620 Thr Tyr Ser Trp Leu Leu Lys Glu Arg Ser Asp Thr Ser Asp Lys Arg 625 630 635 640 Lys Phe Leu Lys Glu Arg Leu Ala Arg Leu Thr Gln Ala Arg Arg Arg 645 650 655 Leu Ala Gln Phe Pro Gly 660 <210> 2 <211> 662 <212> PRT <213> Artificial Sequence <220> <223> Mutent MxA protein <400> 2 Met Val Val Ser Glu Val Asp Ile Ala Lys Ala Asp Pro Ala Ala Ala 1 5 10 15 Ser His Pro Leu Leu Leu Asn Gly Asp Ala Thr Val Ala Gln Lys Asn 20 25 30 Pro Gly Ser Val Ala Glu Asn Asn Leu Cys Ser Gln Tyr Glu Glu Lys 35 40 45 Val Arg Pro Cys Ile Asp Leu Ile Asp Ser Leu Arg Ala Leu Gly Val 50 55 60 Glu Gln Asp Leu Ala Leu Pro Ala Ile Ala Val Ile Gly Asp Gln Ser 65 70 75 80 Ser Gly Lys Ser Ser Val Leu Glu Ala Leu Ser Gly Val Ala Leu Pro 85 90 95 Arg Gly Ser Gly Ile Val Thr Arg Cys Pro Leu Val Leu Lys Leu Lys 100 105 110 Lys Leu Val Asn Glu Asp Lys Trp Arg Gly Lys Val Ser Tyr Gln Asp 115 120 125 Tyr Glu Ile Glu Ile Ser Asp Ala Ser Glu Val Glu Lys Glu Ile Asn 130 135 140 Lys Ala Gln Asn Ala Ile Ala Gly Glu Gly Met Gly Ile Ser His Glu 145 150 155 160 Leu Ile Thr Leu Glu Ile Ser Ser Arg Asp Val Pro Asp Leu Thr Leu 165 170 175 Ile Asp Leu Pro Gly Ile Thr Arg Val Ala Val Gly Asn Gln Pro Ala 180 185 190 Asp Ile Gly Tyr Lys Ile Lys Thr Leu Ile Lys Lys Tyr Ile Gln Arg 195 200 205 Gln Glu Thr Ile Ser Leu Val Val Val Pro Ser Asn Val Asp Ile Ala 210 215 220 Thr Thr Glu Ala Leu Ser Met Ala Gln Glu Val Asp Pro Glu Gly Asp 225 230 235 240 Arg Thr Ile Gly Ile Leu Thr Lys Pro Asp Leu Val Asp Lys Gly Thr 245 250 255 Glu Asp Lys Val Val Asp Val Val Arg Asn Leu Val Phe His Leu Lys 260 265 270 Lys Gly Tyr Met Ile Val Lys Cys Arg Gly Gln Gln Glu Ile Gln Asp 275 280 285 Gln Leu Ser Leu Ser Glu Ala Leu Gln Arg Glu Lys Ile Phe Phe Glu 290 295 300 Asn His Pro Tyr Phe Arg Asp Leu Leu Glu Glu Gly Lys Ala Thr Val 305 310 315 320 Pro Cys Leu Ala Glu Lys Leu Thr Ser Glu Leu Ile Thr His Ile Cys 325 330 335 Lys Ser Leu Pro Leu Leu Glu Asn Gln Ile Lys Glu Thr His Gln Arg 340 345 350 Ile Thr Glu Glu Leu Gln Lys Tyr Gly Val Asp Ile Pro Glu Asp Glu 355 360 365 Asn Glu Lys Met Phe Phe Leu Ile Asp Lys Ile Asn Ala Phe Asn Gln 370 375 380 Asp Ile Thr Ala Leu Met Gln Gly Glu Glu Thr Val Gly Glu Glu Asp 385 390 395 400 Ile Arg Leu Phe Thr Arg Leu Arg His Glu Phe His Lys Trp Ser Thr 405 410 415 Ile Ile Glu Asn Asn Phe Gln Glu Gly His Lys Ile Leu Ser Arg Lys 420 425 430 Ile Gln Lys Phe Glu Asn Gln Tyr Arg Gly Arg Glu Leu Pro Gly Phe 435 440 445 Val Asn Tyr Arg Thr Phe Glu Thr Ile Val Lys Gln Gln Ile Lys Ala 450 455 460 Leu Glu Glu Pro Ala Val Asp Met Leu His Thr Val Thr Asp Met Val 465 470 475 480 Arg Leu Ala Phe Thr Asp Val Ser Ile Lys Asn Phe Glu Glu Phe Phe 485 490 495 Asn Leu His Arg Thr Ala Lys Ser Lys Ile Glu Asp Ile Arg Ala Glu 500 505 510 Gln Glu Arg Glu Gly Glu Lys Leu Ile Arg Leu His Phe Gln Met Glu 515 520 525 Gln Ile Val Tyr Cys Gln Asp Gln Val Tyr Arg Gly Ala Leu Gln Lys 530 535 540 Val Arg Glu Lys Glu Leu Glu Glu Glu Lys Lys Lys Lys Ser Trp Asp 545 550 555 560 Phe Gly Ala Phe Gln Ser Ser Ser Ala Thr Asp Ser Ser Met Glu Glu 565 570 575 Ile Phe Gln His Leu Met Ala Tyr His Gln Glu Ala Ser Lys Arg Ile 580 585 590 Ser Ser His Ile Pro Leu Ile Ile Gln Phe Phe Met Leu Gln Thr Tyr 595 600 605 Gly Gln Gln Leu Gln Lys Ala Met Asp Gln Leu Leu Gln Asp Lys Asp 610 615 620 Thr Tyr Ser Trp Leu Leu Lys Glu Arg Ser Asp Thr Ser Asp Lys Arg 625 630 635 640 Lys Phe Leu Lys Glu Arg Leu Ala Arg Leu Thr Gln Ala Arg Arg Arg 645 650 655 Leu Ala Gln Phe Pro Gly 660 <110> Korea Advanced Institute of Science and Technology <120> Pharmaceutical compositions for the prevention or treatment of influenza virus infection <130> PDPB187387 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 662 <212> PRT <213> Homo sapiens <400> 1 Met Val Val Ser Glu Val Asp Ile Ala Lys Ala Asp Pro Ala Ala Ala 1 5 10 15 Ser His Pro Leu Leu Leu Asn Gly Asp Ala Thr Val Ala Gln Lys Asn 20 25 30 Pro Gly Ser Val Ala Glu Asn Asn Leu Cys Ser Gln Tyr Glu Glu Lys 35 40 45 Val Arg Pro Cys Ile Asp Leu Ile Asp Ser Leu Arg Ala Leu Gly Val 50 55 60 Glu Gln Asp Leu Ala Leu Pro Ala Ile Ala Val Ile Gly Asp Gln Ser 65 70 75 80 Ser Gly Lys Ser Ser Val Leu Glu Ala Leu Ser Gly Val Ala Leu Pro 85 90 95 Arg Gly Ser Gly Ile Val Thr Arg Cys Pro Leu Val Leu Lys Leu Lys 100 105 110 Lys Leu Val Asn Glu Asp Lys Trp Arg Gly Lys Val Ser Tyr Gln Asp 115 120 125 Tyr Glu Ile Glu Ile Ser Asp Ala Ser Glu Val Glu Lys Glu Ile Asn 130 135 140 Lys Ala Gln Asn Ala Ile Ala Gly Glu Gly Met Gly Ile Ser His Glu 145 150 155 160 Leu Ile Thr Leu Glu Ile Ser Ser Arg Asp Val Pro Asp Leu Thr Leu 165 170 175 Ile Asp Leu Pro Gly Ile Thr Arg Val Ala Val Gly Asn Gln Pro Ala 180 185 190 Asp Ile Gly Tyr Lys Ile Lys Thr Leu Ile Lys Lys Tyr Ile Gln Arg 195 200 205 Gln Glu Thr Ile Ser Leu Val Val Val Pro Ser Asn Val Asp Ile Ala 210 215 220 Thr Thr Glu Ala Leu Ser Met Ala Gln Glu Val Asp Pro Glu Gly Asp 225 230 235 240 Arg Thr Ile Gly Ile Leu Thr Lys Pro Asp Leu Val Asp Lys Gly Thr 245 250 255 Glu Asp Lys Val Val Asp Val Val Arg Asn Leu Val Phe His Leu Lys 260 265 270 Lys Gly Tyr Met Ile Val Lys Cys Arg Gly Gln Gln Glu Ile Gln Asp 275 280 285 Gln Leu Ser Leu Ser Glu Ala Leu Gln Arg Glu Lys Ile Phe Phe Glu 290 295 300 Asn His Pro Tyr Phe Arg Asp Leu Leu Glu Glu Gly Lys Ala Thr Val 305 310 315 320 Pro Cys Leu Ala Glu Lys Leu Thr Ser Glu Leu Ile Thr His Ile Cys 325 330 335 Lys Ser Leu Pro Leu Leu Glu Asn Gln Ile Lys Glu Thr His Gln Arg 340 345 350 Ile Thr Glu Glu Leu Gln Lys Tyr Gly Val Asp Ile Pro Glu Asp Glu 355 360 365 Asn Glu Lys Met Phe Phe Leu Ile Asp Lys Ile Asn Ala Phe Asn Gln 370 375 380 Asp Ile Thr Ala Leu Met Gln Gly Glu Glu Thr Val Gly Glu Glu Asp 385 390 395 400 Ile Arg Leu Phe Thr Arg Leu Arg His Glu Phe His Lys Trp Ser Thr 405 410 415 Ile Ile Glu Asn Asn Phe Gln Glu Gly His Lys Ile Leu Ser Arg Lys 420 425 430 Ile Gln Lys Phe Glu Asn Gln Tyr Arg Gly Arg Glu Leu Pro Gly Phe 435 440 445 Val Asn Tyr Arg Thr Phe Glu Thr Ile Val Lys Gln Gln Ile Lys Ala 450 455 460 Leu Glu Glu Pro Ala Val Asp Met Leu His Thr Val Thr Asp Met Val 465 470 475 480 Arg Leu Ala Phe Thr Asp Val Ser Ile Lys Asn Phe Glu Glu Phe Phe 485 490 495 Asn Leu His Arg Thr Ala Lys Ser Lys Ile Glu Asp Ile Arg Ala Glu 500 505 510 Gln Glu Arg Glu Gly Glu Lys Leu Ile Arg Leu His Phe Gln Met Glu 515 520 525 Gln Ile Val Tyr Cys Gln Asp Gln Val Tyr Arg Gly Ala Leu Gln Lys 530 535 540 Val Arg Glu Lys Glu Leu Glu Glu Glu Lys Lys Lys Lys Ser Trp Asp 545 550 555 560 Phe Gly Ala Phe Gln Ser Ser Ser Ala Thr Asp Ser Ser Met Glu Glu 565 570 575 Ile Phe Gln His Leu Met Ala Tyr His Gln Glu Ala Ser Lys Arg Ile 580 585 590 Ser Ser His Ile Pro Leu Ile Ile Gln Phe Phe Met Leu Gln Thr Tyr 595 600 605 Gly Gln Gln Leu Gln Lys Ala Met Leu Gln Leu Leu Gln Asp Lys Asp 610 615 620 Thr Tyr Ser Trp Leu Leu Lys Glu Arg Ser Asp Thr Ser Asp Lys Arg 625 630 635 640 Lys Phe Leu Lys Glu Arg Leu Ala Arg Leu Thr Gln Ala Arg Arg Arg 645 650 655 Leu Ala Gln Phe Pro Gly 660 <210> 2 <211> 662 <212> PRT <213> Artificial Sequence <220> <223> Mutent MxA protein <400> 2 Met Val Val Ser Glu Val Asp Ile Ala Lys Ala Asp Pro Ala Ala Ala 1 5 10 15 Ser His Pro Leu Leu Leu Asn Gly Asp Ala Thr Val Ala Gln Lys Asn 20 25 30 Pro Gly Ser Val Ala Glu Asn Asn Leu Cys Ser Gln Tyr Glu Glu Lys 35 40 45 Val Arg Pro Cys Ile Asp Leu Ile Asp Ser Leu Arg Ala Leu Gly Val 50 55 60 Glu Gln Asp Leu Ala Leu Pro Ala Ile Ala Val Ile Gly Asp Gln Ser 65 70 75 80 Ser Gly Lys Ser Ser Val Leu Glu Ala Leu Ser Gly Val Ala Leu Pro 85 90 95 Arg Gly Ser Gly Ile Val Thr Arg Cys Pro Leu Val Leu Lys Leu Lys 100 105 110 Lys Leu Val Asn Glu Asp Lys Trp Arg Gly Lys Val Ser Tyr Gln Asp 115 120 125 Tyr Glu Ile Glu Ile Ser Asp Ala Ser Glu Val Glu Lys Glu Ile Asn 130 135 140 Lys Ala Gln Asn Ala Ile Ala Gly Glu Gly Met Gly Ile Ser His Glu 145 150 155 160 Leu Ile Thr Leu Glu Ile Ser Ser Arg Asp Val Pro Asp Leu Thr Leu 165 170 175 Ile Asp Leu Pro Gly Ile Thr Arg Val Ala Val Gly Asn Gln Pro Ala 180 185 190 Asp Ile Gly Tyr Lys Ile Lys Thr Leu Ile Lys Lys Tyr Ile Gln Arg 195 200 205 Gln Glu Thr Ile Ser Leu Val Val Val Pro Ser Asn Val Asp Ile Ala 210 215 220 Thr Thr Glu Ala Leu Ser Met Ala Gln Glu Val Asp Pro Glu Gly Asp 225 230 235 240 Arg Thr Ile Gly Ile Leu Thr Lys Pro Asp Leu Val Asp Lys Gly Thr 245 250 255 Glu Asp Lys Val Val Asp Val Val Arg Asn Leu Val Phe His Leu Lys 260 265 270 Lys Gly Tyr Met Ile Val Lys Cys Arg Gly Gln Gln Glu Ile Gln Asp 275 280 285 Gln Leu Ser Leu Ser Glu Ala Leu Gln Arg Glu Lys Ile Phe Phe Glu 290 295 300 Asn His Pro Tyr Phe Arg Asp Leu Leu Glu Glu Gly Lys Ala Thr Val 305 310 315 320 Pro Cys Leu Ala Glu Lys Leu Thr Ser Glu Leu Ile Thr His Ile Cys 325 330 335 Lys Ser Leu Pro Leu Leu Glu Asn Gln Ile Lys Glu Thr His Gln Arg 340 345 350 Ile Thr Glu Glu Leu Gln Lys Tyr Gly Val Asp Ile Pro Glu Asp Glu 355 360 365 Asn Glu Lys Met Phe Phe Leu Ile Asp Lys Ile Asn Ala Phe Asn Gln 370 375 380 Asp Ile Thr Ala Leu Met Gln Gly Glu Glu Thr Val Gly Glu Glu Asp 385 390 395 400 Ile Arg Leu Phe Thr Arg Leu Arg His Glu Phe His Lys Trp Ser Thr 405 410 415 Ile Ile Glu Asn Asn Phe Gln Glu Gly His Lys Ile Leu Ser Arg Lys 420 425 430 Ile Gln Lys Phe Glu Asn Gln Tyr Arg Gly Arg Glu Leu Pro Gly Phe 435 440 445 Val Asn Tyr Arg Thr Phe Glu Thr Ile Val Lys Gln Gln Ile Lys Ala 450 455 460 Leu Glu Glu Pro Ala Val Asp Met Leu His Thr Val Thr Asp Met Val 465 470 475 480 Arg Leu Ala Phe Thr Asp Val Ser Ile Lys Asn Phe Glu Glu Phe Phe 485 490 495 Asn Leu His Arg Thr Ala Lys Ser Lys Ile Glu Asp Ile Arg Ala Glu 500 505 510 Gln Glu Arg Glu Gly Glu Lys Leu Ile Arg Leu His Phe Gln Met Glu 515 520 525 Gln Ile Val Tyr Cys Gln Asp Gln Val Tyr Arg Gly Ala Leu Gln Lys 530 535 540 Val Arg Glu Lys Glu Leu Glu Glu Glu Lys Lys Lys Lys Ser Trp Asp 545 550 555 560 Phe Gly Ala Phe Gln Ser Ser Ser Ala Thr Asp Ser Ser Met Glu Glu 565 570 575 Ile Phe Gln His Leu Met Ala Tyr His Gln Glu Ala Ser Lys Arg Ile 580 585 590 Ser Ser His Ile Pro Leu Ile Ile Gln Phe Phe Met Leu Gln Thr Tyr 595 600 605 Gly Gln Gln Leu Gln Lys Ala Met Asp Gln Leu Leu Gln Asp Lys Asp 610 615 620 Thr Tyr Ser Trp Leu Leu Lys Glu Arg Ser Asp Thr Ser Asp Lys Arg 625 630 635 640 Lys Phe Leu Lys Glu Arg Leu Ala Arg Leu Thr Gln Ala Arg Arg Arg 645 650 655 Leu Ala Gln Phe Pro Gly 660

Claims (15)

서열번호 2로 표시되는 변성 단백질을 유효성분으로 포함하는 인플루엔자 바이러스 감염의 예방 또는 치료용 약학조성물로서,
상기 인플루엔자 바이러스는 X-31 아형인 것인, 약학조성물.
As a pharmaceutical composition for preventing or treating influenza virus infection comprising a denatured protein represented by SEQ ID NO: 2 as an active ingredient,
The influenza virus is of the X-31 subtype, a pharmaceutical composition.
제 1항에 있어서,
상기 변성 단백질은 서열번호 1의 단백질보다 용해성이 증가한 것인, 약학조성물.
The method of claim 1,
The denatured protein will have increased solubility than the protein of SEQ ID NO: 1, a pharmaceutical composition.
삭제delete 제 1항에 있어서,
상기 변성 단백질은 N 말단에 단백질 전달 도메인(Protein transduction domain, PTD)이 추가로 결합된 것인, 약학조성물.
The method of claim 1,
The modified protein is a protein transduction domain (PTD) is further bound to the N-terminus, pharmaceutical composition.
제 4 항에 있어서,
상기 단백질 전달 도메인은 5개 내지 10개의 아르기닌(Arginine)이 결합된 것, 전사 트랜스 활성자(Trans-activator of transcription, TAT), ANTP, Vp22, MTS, Pep-1, 및 Pep-2로 구성되는 그룹으로부터 선택되는 어느 하나인, 약학조성물.
The method of claim 4,
The protein transduction domain is composed of 5 to 10 arginine bound, trans-activator of transcription (TAT), ANTP, Vp22, MTS, Pep-1, and Pep-2. Any one selected from the group, a pharmaceutical composition.
제 5 항에 있어서,
상기 단백질 전달 도메인은 전사 트랜스 활성자(Trans-activator of transcription, TAT)인, 약학조성물.
The method of claim 5,
The protein transduction domain is a transcriptional trans activator (Trans-activator of transcription, TAT), a pharmaceutical composition.
삭제delete 삭제delete 삭제delete 삭제delete 삭제delete 삭제delete 삭제delete 삭제delete 삭제delete
KR1020190037637A 2019-04-01 2019-04-01 Pharmaceutical compositions for the prevention or treatment of influenza virus infection KR102145793B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020190037637A KR102145793B1 (en) 2019-04-01 2019-04-01 Pharmaceutical compositions for the prevention or treatment of influenza virus infection

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020190037637A KR102145793B1 (en) 2019-04-01 2019-04-01 Pharmaceutical compositions for the prevention or treatment of influenza virus infection

Publications (1)

Publication Number Publication Date
KR102145793B1 true KR102145793B1 (en) 2020-08-19

Family

ID=72291707

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020190037637A KR102145793B1 (en) 2019-04-01 2019-04-01 Pharmaceutical compositions for the prevention or treatment of influenza virus infection

Country Status (1)

Country Link
KR (1) KR102145793B1 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150122088A (en) * 2014-04-22 2015-10-30 한국과학기술원 Cell permeable mx1 recombinant protein

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150122088A (en) * 2014-04-22 2015-10-30 한국과학기술원 Cell permeable mx1 recombinant protein

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
GenBank Accession No. AAA36458 (1993.04.27.) 1부.* *
THE JOURNAL OF BIOLOGICAL CHEMISTRY, 2015, Vol.290, No.50, pp.29893-29906 1부.* *

Similar Documents

Publication Publication Date Title
JP6142077B2 (en) Peptide having inhibitory activity on respiratory virus infection, use thereof, and production method thereof
JP5709800B2 (en) Interferon with altered spatial structure and its application
TW201406959A (en) Anti-inflammatory peptides and composition comprising the same (3)
JP2022530439A (en) Recombinant influenza antigen
US11426459B2 (en) Mutant of hemagglutinin protein of H3N2 subtype influenza virus and use thereof
KR20180037185A (en) A broad spectrum of anti-infective peptides
KR102145793B1 (en) Pharmaceutical compositions for the prevention or treatment of influenza virus infection
KR101650100B1 (en) Cell permeable mx1 recombinant protein
KR20210023737A (en) Novel Interferon Lambda Variants and Preparation Method Thereof
KR102494231B1 (en) Pharmaceutical compositions for the prevention or treatment of influenza virus infection
US8440788B2 (en) N-terminal VDAC variants and uses thereof
EP4289949A1 (en) Bacteriophage lysine, chimera thereof and application thereof
KR101783030B1 (en) Pharmaceurical composition for preventing or treating hepatitis C virus infection or disease due to HCV infection
KR20210147362A (en) A novel anti-inflammatory peptides derived nlrx1 and use thereof
KR102061324B1 (en) Cell permeable mx-a recombinant protein
KR102259320B1 (en) Pharmaceutical Composition for Preventing or Treating Influenza Virus Infection Disease
US9499595B2 (en) Development of influenza A antivirals
NL2025294B1 (en) Antimicrobial peptide for treatment and controlling virus infections
JP2023527416A (en) Novel anti-inflammatory peptide and use thereof
KR20240137479A (en) Bacillus subtilis flagellin mutants and fusion protein comprising influenza antigen
US20170298100A1 (en) Anti-viral peptides
WO2022066798A1 (en) Interferon tau fc-fusion proteins and methods for treating coronavirus infections
WO2008091241A1 (en) Development of influenza a antivirals

Legal Events

Date Code Title Description
E701 Decision to grant or registration of patent right
GRNT Written decision to grant