KR101995774B1 - A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus - Google Patents
A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus Download PDFInfo
- Publication number
- KR101995774B1 KR101995774B1 KR1020180052483A KR20180052483A KR101995774B1 KR 101995774 B1 KR101995774 B1 KR 101995774B1 KR 1020180052483 A KR1020180052483 A KR 1020180052483A KR 20180052483 A KR20180052483 A KR 20180052483A KR 101995774 B1 KR101995774 B1 KR 101995774B1
- Authority
- KR
- South Korea
- Prior art keywords
- dengue virus
- residue
- protein scaffold
- thr
- val
- Prior art date
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/18—Togaviridae; Flaviviridae
- G01N2333/183—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus) or border disease virus
- G01N2333/185—Flaviviruses or Group B arboviruses, e.g. yellow fever virus, japanese encephalitis, tick-borne encephalitis, dengue
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Abstract
Description
본 발명은 뎅기열 바이러스에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드에 관한 것으로, 더욱 구체적으로 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드를 코팅하기 위한 핵산 분자, 상기 핵산 분자를 포함하는 재조합 백터, 상기 재조합 백터로부터 발현되는 피브로넥틴 EDB 단백질 스캐폴드 및 이를 포함하는 뎅기열 바이러스 진단용 조성물에 관한 것이다.The present invention relates to a fibronectin EDB protein scaffold specifically binding to a dengue fever virus, and more particularly to a nucleic acid molecule for coating a fibronectin EDB protein scaffold specifically binding to a dengue virus NS1 domain, A fibronectin EDB protein scaffold expressed from the recombinant vector, and a composition for diagnosing dengue virus comprising the recombinant vector.
뎅기열은 뎅기열 바이러스에 의한 급성 열병으로 모기에 의해 매개되는 질환이다. 뎅기열 바이러스는 분류학상 플라비바이러스과 (Flaviviridae)의 플라비바이러스속(Flavivirus)에 속하는 양성 단일가닥(positive, single strand)의 RNA를 유전물질로 갖는 구형의 바이러스로, 웨스트나일 바이러스 (West Nile virus), 일본뇌염 바이러스(Japanese encephalitis virus), 진드기 매개뇌염 바이러스 (Tickborne encephalitis virus) 및 황열 바이러스 (Yellow fever virus )등도 같은 종들이다. 대부분은 절지 동물 (모기 또는 진드기)에 의해 전염되기 때문에 아르보 바이러스 (arthropod-borne virus)라고도 불리기도 한다. Dengue fever is an acute fever caused by dengue virus and is a disease mediated by mosquitoes. Dengue virus is a spherical virus with a genetic material of positive single strand RNA belonging to Flaviviridae of the taxonomic Flaviviridae, West Nile virus, , Japanese encephalitis virus, tickborne encephalitis virus and yellow fever virus are the same species. Most are also known as arthropod-borne viruses because they are transmitted by arthropods (mosquitoes or ticks).
뎅기열 바이러스는 4개 (DENV1, DENV2, DENV3, DENV4)의 혈청형을 갖고 있으며, 이 4개의 혈청형들은 약 60~90%의 서열 상동성을 갖고 있는 것으로 알려져 있다. 하나의 혈청형에 의해 1 차 감염되면 그 혈청형에 대한 면역성을 갖지만, 이후 나머지 3 개중 하나의 혈청형에 의해 2차 감염이 발생할 수 있는데, 2차 감염이 되면 뎅기 바이러스 특성에 따른 항원-항체 복합체에 의한 보체 활성화에 기인하여 뎅기 출혈열(dengue hemorrhagic fever) 또는 뎅기열 쇼크 증후군(dengue shock syndrome)과 같은 중증 뎅기열이 발병하여 1차 질병에 비해 더 심각한 징후를 초래하기도 한다. Dengue viruses have four serotypes (DENV1, DENV2, DENV3, DENV4), and these four serotypes are known to have about 60-90% sequence homology. The first infection by one serotype has immunity to the serotype, but thereafter the second infection can occur by one serotype of the remaining three. When the second infection occurs, the antigen-antibody Complement activation by conjugates can lead to severe dengue fever, such as dengue hemorrhagic fever or dengue shock syndrome, leading to more severe signs than primary disease.
뎅기열 바이러스는 약 10.6 Kbp 크기의 작고 외피가 있는 구조로, 약 11000 염기쌍으로 이루어져 있는 한 가닥의 양성 센스 RNA 게놈을 가지고 있고, 이 RNA 게놈은 3 개의 구조 단백질 (캡시드 단백질, 막 단백질, 엔벨로프 단백질) 및 7 개의 비구조 단백질 (NS1, NS2a, NS2b, NS3, NS4a, NS4b, NS5)을 만들어 낸다.Dengue virus is a small, cortical structure of about 10.6 Kbp. It has a strand of positive-sense RNA genome consisting of about 11,000 base pairs. This RNA genome contains three structural proteins (capsid protein, membrane protein, envelope protein) And seven nonstructural proteins (NS1, NS2a, NS2b, NS3, NS4a, NS4b, and NS5).
이들 비구조 단백질들의 역할은 바이러스 생존에 필수적인 수용체 결합, 적혈구 응집 및 중화 항체(Ab)의 유도 및 방어 면역 반응과 같은 생물학적 특성과 바이러스 복제 및 조립 과정 등에 영향을 주는 등의 중요한 기능을 수행하는 것으로 알려져 있다.The role of these nonstructural proteins is to perform important functions, such as influencing the biological properties such as receptor binding, induction of red blood cell aggregation and neutralizing antibody (Ab) and defense immunity, viral replication and assembly processes essential for virus survival It is known.
특히, 뎅기열 바이러스의 비구조 당 단백질인 NS1은 ~40KDa의 기본 폴리 펩타이드에서 352 아미노산 잔기를 함유하고 12개의 불변 시스테인 잔기 및 2개의 N-글리코실화 부위를 갖고 있는 구조이다. 일부 연구에 의하면, 세포 내 NS1 당단백질은 바이러스 복제에 직-간접적으로 관여를 하며, 면역원성 복합체 형성에 영향을 주어 보체-매개성(complement-mediated) 경로 및 항체-의존성 세포독성(antibody-dependent cell cytotoxicity)의 원인이 되어 더 심한 형태의 합병증을 유발하는 것으로도 알려져 있다.In particular, NS1, an unstructured glycoprotein of dengue virus, is a structure containing 352 amino acid residues in the basic polypeptide of ~ 40 KDa and having 12 invariant cysteine residues and 2 N-glycosylation sites. In some studies, intracellular NS1 glycoproteins have been directly or indirectly involved in viral replication, affecting the formation of immunogenic complexes, leading to complement-mediated pathways and antibody-dependent pathways cell cytotoxicity) and is known to cause more severe complications.
발병 후, 적어도 3~5일 이후에 검출되는 IgM 및 IgG 항체들과는 다르게 NS1 단백질은 바이러스 복제 과정에서 세포 표면과 결합하여 조기 증상의 발병 1일 후에 순환계로 방출되어, 임상 증상이 나타나기 직전의 감염된 사람의 혈청에서 급속히 농도가 증가하며 약 9일 정도까지 혈액에서 높은 농도로 검출이 된다. 따라서, 뎅기열 감염에 있어서 조기 진단이 중요하다. Unlike the IgM and IgG antibodies detected after at least 3 to 5 days after onset, NS1 protein binds to the cell surface during viral replication and is released into the
현재까지 알려진 뎅기열에 대한 진단 방법은 환자의 혈청이나 조직에서 바이러스를 직접 검출하거나, 바이러스핵산 검사를 위한 중합 효소 연쇄 반응 방법 (polymerase chain reaction), 또는 숙주 반응 테스트를 위한 숙주 항체(IgM, IgG)에 대한 혈청검사이다. 그 외에도 바이러스 배양, 면역 분석, 형광 분석, 또는 질량분석법 등에 의한 항원 검출법이 사용되고 있다.To date, known methods for diagnosing dengue fever include direct detection of viruses in the serum or tissue of a patient, polymerase chain reaction (PCR) for viral nucleic acid detection, or host antibody (IgM, IgG) . In addition, antigen detection methods such as virus culture, immunoassay, fluorescence assay, or mass spectrometry have been used.
그러나, 사용되고 있는 방법들의 경우, 진단을 위한 대부분의 장비가 고가이고 숙련된 인력이 필요하기 때문에, 발병이 되고 있는 지역 특성상 사용에 제한적인 점이 있다. 그리고 일부 혈청검사의 경우 교차반응으로 인해 각각의 혈청형을 구분하기 어렵고, 유사 바이러스의 존재 시에는 중복 검출로 인해 진단 결과에 대한 신뢰도가 낮다는 단점이 있다. 또한, 대부분의 진단 방법이 1차 감염과 비교하여 2차 감염 진단시에 감수성이 떨어진다고 알려져 있으며, 특히 혈청학적 방법으로는 질병의 초기 단계에서 뎅기 바이러스의 감염 진단이 불가능할 수 있다. However, the methods used are limited in their use due to the nature of the area in which they are developed, as most equipment for diagnosis is expensive and requires skilled personnel. In some sera test, it is difficult to distinguish each serotype due to cross reaction. In case of similar virus, there is a disadvantage that reliability of diagnosis result is low due to duplication detection. In addition, it is known that most of the diagnostic methods are less susceptible to the diagnosis of the second infection than the first infection. In particular, serologic methods may not be able to diagnose dengue virus infection at an early stage of the disease.
따라서, 뎅기열 바이러스 감염의 진단 및 치료를 위해 효율적으로 뎅기열 바이러스를 효율적으로 검출할 수 있는 진단 검사 방법의 개발이 필요하다.Therefore, there is a need to develop a diagnostic test method that can efficiently detect dengue viruses for the diagnosis and treatment of dengue fever virus infection.
항체(antibody)는 인체 내에서 외부로부터 들어온 항원(antibody)과 결합하여 항원의 작용을 방해하거나, 항원을 제거하기 위하여 만들어진 면역단백질로 타겟 물질에 고친화도 및 선택성으로 결합할 수 있어 다양한 질병에 대한 획기적인 치료제로서 각광을 받고 있다. 항체는 중쇄(Heavy chain)와 경쇄(Light chain)의 두 가지 면역글로불린으로 이루어지며, 이들은 다시 불변영역(Constant region)과 가변영역(Variable region)으로 이루어진다. 몇 개의 항체 대체 단백질은 항체와 같이 불변영역과 가변영역을 가질 수 있도록 만든 재조합 단백질로 크기가 작고 안정한 단백질의 일정부분을 무작위 서열의 아미노산으로 바꾸어 라이브러리를 만들고 이를 표적물질에 대해 스크리닝을 하여 높은 친화력과 좋은 특이성을 가진 물질을 찾을 수 있다. An antibody is an immune protein that binds to an antibody from the outside to interfere with the action of an antigen or to remove an antigen. The antibody can bind to a target substance with high affinity and selectivity, And has been widely recognized as a breakthrough therapeutic agent. Antibodies are composed of two immunoglobulins, heavy chain and light chain, which consist of a constant region and a variable region. Several antibody substitution proteins are recombinant proteins, such as antibodies, that can be made to have constant regions and variable regions. A small portion of a small, stable protein is replaced with a random sequence of amino acids to create a library, which is then screened for target substances, And a material with good specificity.
피브로넥틴(Fibronectin; FN)은 세포외 기질(Extracellular Matrix; ECM)의 주요성분인 당단백(glycoprotein)의 하나로 세포의 분화, 접착, 이동, 영역 및 세포자연사(apoptosis)등에 관여하는 중요한 매개물질로 알려져 있다. 그 중 인간 피브로넥틴3(Human Fibronectin Type III; FN3)는 면역 글로불린(Immunoglobulin)과 유사한 β-샌드위치 구조를 가지고 있어, 항체 대체 단백질의 제조에 적용되기도한다. 피브로넥틴의 EDB(Extra Domain B)는 FN3와 유사한 구조를 갖고 있으며, 특히 암과 관련된 혈관 및 세포외 기질에서 발현되는 것이 보고되어 있어 암 특이적 검출 및 치료에 있어 표적으로 주목 받고 있다.Fibronectin (FN) is a glycoprotein, a major component of the extracellular matrix (ECM), and is known to be an important mediator involved in cell differentiation, adhesion, migration, domain and apoptosis . Among them, Human Fibronectin Type III (FN3) has a β-sandwich structure similar to that of immunoglobulin, and is also applied to the production of antibody replacement proteins. Fibronectin EDB (Extra Domain B) has a structure similar to that of FN3, and has been reported to be expressed in blood vessels and extracellular matrix particularly in cancer, and thus has attracted attention as a target in cancer-specific detection and treatment.
스캐폴드(scaffold)는 단백질의 구조적인 특징 중 하나로서 서로 다른 기능을 가지고 있는 여러 단백질들과 결합할 수 있는 특징으로 가지고 있다. A scaffold is one of the structural features of a protein that has the property of being able to bind to several proteins with different functions.
이에, 본 발명자들은 상기 종래기술들의 문제점들을 극복하기 위하여 예의 연구노력한 결과, 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드의 경우, 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하기 때문에 뎅기열 바이러스 감염을 효과적으로 진단을 할 수 있음을 확인하고, 본 발명을 완성하게 되었다.Accordingly, the present inventors have made intensive efforts to overcome the problems of the prior art. As a result, the inventors of the present invention found that the fibronectin EDB protein scaffold specifically binding to the dengue virus NS1 domain specifically binds to the dengue virus NS1 domain, It was confirmed that the infection can be effectively diagnosed, and the present invention was completed.
따라서, 본 발명은 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하여 뎅기열 바이러스 감염을 진단할 수 있는 피브로넥틴 EDB 단백질 스캐폴드를 제공하는 것을 목적으로 한다.Accordingly, it is an object of the present invention to provide a fibronectin EDB protein scaffold capable of specifically diagnosing dengue virus infection by binding specifically to the dengue virus NS1 domain.
본 발명은 또한, 상기 피브로넥틴 EDB 단백질 스캐폴드를 코팅하는 핵산 분자를 제공하는 것을 목적으로 한다.The present invention also aims to provide nucleic acid molecules that coat the fibronectin EDB protein scaffold.
본 발명은 또한, 상기 피브로넥틴 EDB 단백질 스캐폴드를 발현하기 위한 핵산 분자를 포함하는 백터를 제공하는 것을 목적으로 한다.The present invention also aims to provide a vector comprising nucleic acid molecules for expressing the fibronectin EDB protein scaffold.
본 발명은 또한, 상기 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드를 포함하는 뎅기열 바이러스 진단용 조성물을 제공하는 것을 목적으로 한다.It is another object of the present invention to provide a composition for diagnosing dengue virus comprising a fibronectin EDB protein scaffold specifically binding to the dengue virus NS1 domain.
본 발명의 한 양태에 따르면, 본 발명은 하기의 일반식 1 내지 3으로 표시되는 아미노산 서열로 구성된 그룹에서 선택되는 하나 이상의 아미노산 서열을 포함하는 According to one aspect of the present invention, the present invention provides a method for producing a polypeptide comprising at least one amino acid sequence selected from the group consisting of amino acid sequences represented by the following
뎅기열 바이러스에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드를 제 공한다.Provides a fibronectin EDB protein scaffold that specifically binds dengue virus.
[일반식 1] X1X2X3X4X5X6X7 [Formula 1] X 1 X 2 X 3 X 4 X 5 X 6 X 7
X1은 발린(Val) 또는 아르기닌(Arg) 잔기이고, X 1 is a valine (Val) or arginine (Arg) residue,
X2는 글루타민(Gln) 또는 메티오닌(Met) 잔기이고, X 2 is a glutamine (Gln) or methionine (Met) residue,
X3는 시스테인(Cys), 발린(Val) 또는 트레오닌(Thr) 잔기이고,X 3 is a cysteine (Cys), valine (Val) or threonine (Thr) residue,
X4는 글루타민(Gln), 메티오닌(Met) 또는 시스테인(Cys) 잔기이고,X 4 is glutamine (Gln), methionine (Met) or cysteine (Cys) residue,
X5는 시스테인(Cys), 아르기닌(Arg) 또는 류신(Leu) 잔기이고,X 5 is a cysteine (Cys), arginine (Arg) or leucine (Leu) residue,
X6는 알라닌(Ala), 메티오닌(Met) 또는 류신(Leu) 잔기이고,X 6 is an alanine (Ala), methionine (Met) or leucine (Leu) residue,
X7은 글라이신(Gly) 또는 류신(Leu) 잔기다.X 7 stands for glycine (Gly) or leucine (Leu).
[일반식 2] X8X9X10X11 [Formula 2] X 8 X 9 X 10 X 11
X8은 프롤린(Pro), 히스티딘(His) 또는 아스파르트산(Asp) 잔기이고,X 8 is proline (Pro), histidine (His) or aspartic acid (Asp) residue,
X9은 알라닌(Ala) 또는 프롤린(Pro) 잔기이고,X 9 is an alanine (Ala) or proline (Pro) residue,
X10은 시스테인(Cys), 이소류신(Ile) 또는 트립토판(Trp) 잔기이고,X 10 is a cysteine (Cys), isoleucine (Ile) or tryptophan (Trp) residue,
X11은 발린(Val), 아르기닌(Arg) 또는 트레오닌(Thr) 잔기이다.X 11 is valine (Val), arginine (Arg) or threonine (Thr) residue.
[일반식 3] X12X13X14X15X16X17 [Formula 3] X 12 X 13 X 14 X 15 X 16 X 17
X12는 히스티딘(His), 프롤린(Pro) 또는 트레오닌(Thr) 잔기이고,X 12 is a histidine (His), proline (Pro) or threonine (Thr) residue,
X13은 아르기닌(Arg), 트립토판(Trp) 또는 글루타민(Gln) 잔기이고,X 13 is an arginine (Arg), tryptophan (Trp) or glutamine (Gln) residue,
X14는 이소류신(Ile), 글루타민(Gln) 또는 라이신(Lys) 잔기이고,X 14 is isoleucine (Ile), glutamine (Gln) or lysine (Lys) residue,
X15는 히스티딘(His) 또는 아르기닌(Arg) 잔기이고, X 15 is a histidine (His) or arginine (Arg) residue,
X16는 프롤린(Pro), 히스티딘(His) 또는 발린(Val) 잔기이고,X 16 is proline (Pro), histidine (His) or valine (Val) residue,
X17은 아스파라긴(Asn), 아르기닌(Arg) 또는 라이신(Lys) 잔기이다. X 17 is an asparagine (Asn), arginine (Arg) or lysine (Lys) residue.
본 발명의 피브로넥틴 EDB 단백질 스캐폴드에 있어서, 상기 피브로넥틴 EDB 단백질 스캐폴드는 하기의 [일반식 4]로 표시되는 것을 특징으로 한다.In the fibronectin EDB protein scaffold of the present invention, the fibronectin EDB protein scaffold is characterized by being represented by the following general formula (4).
[일반식 4][Formula 4]
EVPQLTDLSFVDITDSSIGLRWX1X2X3X4X5X6X7IIGYRITVVAAGEGIPIFEDFVDX8X9X10X11YYTVTGLEPGIDYDISVITLIX12X13X14X15X16X17PTTLTQQTEVPQLTDLSFVDITDSSIGLRWX 1 X 2 X 3 X 4 X 5 X 6 X 7 IIGYRITVVAAGEGIPIFEDFVDX 8 X 9 X 10 X 11 YYTVTGLEPGIDYDISVITLIX 12 X 13 X 14 X 15 X 16 X 17 PTTLTQQT
X1은 발린(Val) 또는 아르기닌(Arg) 잔기이고, X 1 is a valine (Val) or arginine (Arg) residue,
X2는 글루타민(Gln) 또는 메티오닌(Met) 잔기이고, X 2 is a glutamine (Gln) or methionine (Met) residue,
X3는 시스테인(Cys), 발린(Val) 또는 트레오닌(Thr) 잔기이고,X 3 is a cysteine (Cys), valine (Val) or threonine (Thr) residue,
X4는 글루타민(Gln), 메티오닌(Met) 또는 시스테인(Cys) 잔기이고,X 4 is glutamine (Gln), methionine (Met) or cysteine (Cys) residue,
X5는 시스테인(Cys), 아르기닌(Arg) 또는 류신(Leu) 잔기이고,X 5 is a cysteine (Cys), arginine (Arg) or leucine (Leu) residue,
X6는 알라닌(Ala), 메티오닌(Met) 또는 류신(Leu) 잔기이고,X 6 is an alanine (Ala), methionine (Met) or leucine (Leu) residue,
X7은 글라이신(Gly) 또는 류신(Leu) 잔기이고,X 7 is a glycine (GIy) or leucine (Leu) residue,
X8은 프롤린(Pro), 히스티딘(His) 또는 아스파르트산(Asp) 잔기이고,X 8 is proline (Pro), histidine (His) or aspartic acid (Asp) residue,
X9은 알라닌(Ala) 또는 프롤린(Pro) 잔기이고,X 9 is an alanine (Ala) or proline (Pro) residue,
X10은 시스테인(Cys), 이소류신(Ile) 또는 트립토판(Trp) 잔기이고,X 10 is a cysteine (Cys), isoleucine (Ile) or tryptophan (Trp) residue,
X11은 발린(Val), 아르기닌(Arg) 또는 트레오닌(Thr) 잔기이고, X 11 is a valine (Val), arginine (Arg) or threonine (Thr) residue,
X12는 히스티딘(His), 프롤린(Pro) 또는 트레오닌(Thr) 잔기이고,X 12 is a histidine (His), proline (Pro) or threonine (Thr) residue,
X13은 아르기닌(Arg), 트립토판(Trp) 또는 글루타민(Gln) 잔기이고,X 13 is an arginine (Arg), tryptophan (Trp) or glutamine (Gln) residue,
X14는 이소류신(Ile), 글루타민(Gln) 또는 라이신(Lys) 잔기이고,X 14 is isoleucine (Ile), glutamine (Gln) or lysine (Lys) residue,
X15는 히스티딘(His) 또는 아르기닌(Arg) 잔기이고, X 15 is a histidine (His) or arginine (Arg) residue,
X16는 프롤린(Pro), 히스티딘(His) 또는 발린(Val) 잔기이고,X 16 is proline (Pro), histidine (His) or valine (Val) residue,
X17은 아스파라긴(Asn), 아르기닌(Arg) 또는 라이신(Lys) 잔기이고, X 17 is asparagine (Asn), arginine (Arg) or lysine (Lys) residue,
이외의 문자는 아미노산의 단문자 표기이다.The other characters are single-character notation of amino acids.
본 발명의 피브로넥틴 EDB 단백질 스캐폴드에 있어서, 상기 [일반식 4]로 표시되는 피브로넥틴 EDB 단백질 스캐폴드는 하기 서열번호 1 내지 3의 아미노산 서열로 구성된 그룹에서 선택되는 하나 이상의 아미노산 서열을 포함하는 것을 특징으로 한다.In the fibronectin EDB protein scaffold of the present invention, the fibronectin EDB protein scaffold represented by [Formula 4] includes at least one amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS: .
[서열번호 1][SEQ ID NO: 1]
EVPQLTDLSFVDITDSSIGLRWVQCQCAGIIGYRITVVAAGEGIPIFEDFVDPACVYYTVTGLEPGIDYDISVITLIHRIHPNPTTLTQQTEVPQLTDLSFVDITDSSIGLRWVQCQCAGIIGYRITVVAAGEGIPIFEDFVDPACVYYTVTGLEPGIDYDISVITLIHRIHPNPTTLTQQT
[서열번호 2][SEQ ID NO: 2]
EVPQLTDLSFVDITDSSIGLRWVQVMRMGIIGYRITVVAAGEGIPIFEDFVDHPIRYYTVTGLEPGIDYDISVITLIPWQRHRPTTLTQQT≪
[서열번호 3][SEQ ID NO: 3]
EVPQLTDLSFVDITDSSIGLRWRMTCLCLIIGYRITVVAAGEGIPIFEDFVDDPWTYYTVTGLEPGIDYDISVITLITQKHVKPTTLTQQTEVPQLTDLSFVDITDSSIGLRWRMTCLCLIIGYRITVVAAGEGIPIFEDFVDDPWTYYTVTGLEPGIDYDISVITLITQKHVKPTTLTQQT
본 발명의 피브로넥틴 EDB 단백질 스캐폴드에 있어서, 피브로넥틴 EDB 단백질 스캐폴드는 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 것을 특징으로 한다.In the fibronectin EDB protein scaffold of the present invention, the fibronectin EDB protein scaffold is characterized by specific binding to the dengue virus NS1 domain.
본 발명의 상기 용어 "도메인"은 종종 단백질의 나머지 영역과 무관하게 안정한 3차원적 구조로 폴딩될 수 있고 특정 기능을 부여 받을 수 있는 단백질의 영역을 지칭한다.The term "domain" of the present invention refers to a region of a protein that can be folded into a stable three-dimensional structure, often irrelevant to the rest of the protein, and can be given specific functions.
뎅기열 바이러스 복제에 직-간접적으로 관여한다고 알려져 있는 NS1 단백질은 감염된 사람의 혈액에서 높은 농도로 검출된다. 이러한 뎅기열을 진단하기 위한 다양한 방법들(혈청검사, 바이러스 배양 등)이 알려져 있으나, 종래의 진단 방법들은 뎅기열 바이러스를 진단하는데 용이하지 못하고 신뢰도가 낮다는 문제점이 있다. NS1 protein, known to be directly or indirectly involved in dengue virus replication, is detected in high concentrations in the blood of infected persons. Various methods for diagnosing dengue fever (serum test, virus culture, etc.) are known, but conventional diagnostic methods are not easy to diagnose dengue fever virus and have low reliability.
이에, 본 발명자들은 용이하고 신뢰도가 높은 뎅기열 바이러스 진단을 위하여 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드를 발명하게 되었다.Accordingly, the present inventors have invented a fibronectin EDB protein scaffold specifically binding to the dengue virus NS1 domain for easy and reliable diagnosis of dengue virus.
본 발명의 일 실시예에 따르면, EDB 라이브러리를 디스플레이하고 있는 파지와 NS1 항원을 바이오패닝을 진행하였으며, 총 4차의 바이오패닝 동안 세척 회수를 다르게 하여 진행하였다. 이 때 각 바이오패닝 초기에 사용한 파지의 수를 input으로, 세척 과정을 마친 이후 글라이신 용액에 의하여 분리된 후 대장균을 통해 만들어진 콜로니의 수를 output 파아지의 수로 계산하여, 항원결합능이 있는 항체의 지표 정도로 삼았다. According to an embodiment of the present invention, the phage displaying the EDB library and the NS1 antigen were subjected to bio-panning, and the number of washing was varied during the fourth bio-panning. In this case, the number of phage used at the beginning of each bio-panning is input, and after the washing process, the number of colonies produced by Escherichia coli after being separated by glycine solution is calculated as the number of output phages, I made it.
상기와 같이 바이오패닝을 진행한 결과, 세척 과정에 따라 output 파아지 / input 파아지의 비율이 증가하는 것을 확인하였다(표 1 및 도 1 참조). 이러한 결과를 통해 NS1 항원과 결합할 수 있는 항체를 선별하여 염기서열을 분석하였다.As a result of the bio-panning as described above, it was confirmed that the ratio of the output phage / input phage increased according to the washing procedure (see Table 1 and FIG. 1). These results indicate that the antibodies capable of binding to the NS1 antigen were selected and sequenced.
본 발명의 실시예에 따르면, NS1 도메인과 결합능이 있는 클론들의 플라스미드 DNA를 분리한 후 염기서열을 분석한 결과, 최종적으로 선택된 뎅기 바이러스 NS1 진단용 EDB 아미노산 서열은 하기 서열번호 1 내지 3으로 확인되었다.According to an embodiment of the present invention, the plasmid DNA of the clones capable of binding to the NS1 domain was isolated and analyzed for the base sequence. As a result, the finally selected EDB amino acid sequence for Dengue virus NS1 diagnosis was identified as SEQ ID NOS: 1 to 3.
[서열번호 1][SEQ ID NO: 1]
EVPQLTDLSFVDITDSSIGLRWVQCQCAGIIGYRITVVAAGEGIPIFEDFVDPACVYYTVTGLEPGIDYDISVITLIHRIHPNPTTLTQQTEVPQLTDLSFVDITDSSIGLRWVQCQCAGIIGYRITVVAAGEGIPIFEDFVDPACVYYTVTGLEPGIDYDISVITLIHRIHPNPTTLTQQT
[서열번호 2][SEQ ID NO: 2]
EVPQLTDLSFVDITDSSIGLRWVQVMRMGIIGYRITVVAAGEGIPIFEDFVDHPIRYYTVTGLEPGIDYDISVITLIPWQRHRPTTLTQQT≪
[서열번호 3][SEQ ID NO: 3]
EVPQLTDLSFVDITDSSIGLRWRMTCLCLIIGYRITVVAAGEGIPIFEDFVDDPWTYYTVTGLEPGIDYDISVITLITQKHVKPTTLTQQT EVPQLTDLSFVDITDSSIGLRWRMTCLCLIIGYRITVVAAGEGIPIFEDFVDDPWTYYTVTGLEPGIDYDISVITLITQKHVKPTTLTQQT
본 발명의 다른 양태에 따르면, 본 발명은 하기 [일반식 4]로 표시되는 아미노산 서열을 포함하는 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드를 코팅하는 핵산 분자를 제공한다.According to another aspect of the present invention, there is provided a nucleic acid molecule for coating a fibronectin EDB protein scaffold that specifically binds to a dengue virus NS1 domain comprising an amino acid sequence represented by the following formula [4].
[일반식 4][Formula 4]
EVPQLTDLSFVDITDSSIGLRWX1X2X3X4X5X6X7IIGYRITVVAAGEGIPIFEDFVDX8X9X10X11YYTVTGLEPGIDYDISVITLIX12X13X14X15X16X17PTTLTQQTEVPQLTDLSFVDITDSSIGLRWX 1 X 2 X 3 X 4 X 5 X 6 X 7 IIGYRITVVAAGEGIPIFEDFVDX 8 X 9 X 10 X 11 YYTVTGLEPGIDYDISVITLIX 12 X 13 X 14 X 15 X 16 X 17 PTTLTQQT
X1은 발린(Val) 또는 아르기닌(Arg) 잔기이고, X 1 is a valine (Val) or arginine (Arg) residue,
X2는 글루타민(Gln) 또는 메티오닌(Met) 잔기이고, X 2 is a glutamine (Gln) or methionine (Met) residue,
X3는 시스테인(Cys), 발린(Val) 또는 트레오닌(Thr) 잔기이고,X 3 is a cysteine (Cys), valine (Val) or threonine (Thr) residue,
X4는 글루타민(Gln), 메티오닌(Met) 또는 시스테인(Cys) 잔기이고,X 4 is glutamine (Gln), methionine (Met) or cysteine (Cys) residue,
X5는 시스테인(Cys), 아르기닌(Arg) 또는 류신(Leu) 잔기이고,X 5 is a cysteine (Cys), arginine (Arg) or leucine (Leu) residue,
X6는 알라닌(Ala), 메티오닌(Met) 또는 류신(Leu) 잔기이고,X 6 is an alanine (Ala), methionine (Met) or leucine (Leu) residue,
X7은 글라이신(Gly) 또는 류신(Leu) 잔기이고,X 7 is a glycine (GIy) or leucine (Leu) residue,
X8은 프롤린(Pro), 히스티딘(His) 또는 아스파르트산(Asp) 잔기이고,X 8 is proline (Pro), histidine (His) or aspartic acid (Asp) residue,
X9은 알라닌(Ala) 또는 프롤린(Pro) 잔기이고,X 9 is an alanine (Ala) or proline (Pro) residue,
X10은 시스테인(Cys), 이소류신(Ile) 또는 트립토판(Trp) 잔기이고,X 10 is a cysteine (Cys), isoleucine (Ile) or tryptophan (Trp) residue,
X11은 발린(Val), 아르기닌(Arg) 또는 트레오닌(Thr) 잔기이고, X 11 is a valine (Val), arginine (Arg) or threonine (Thr) residue,
X12는 히스티딘(His), 프롤린(Pro) 또는 트레오닌(Thr) 잔기이고,X 12 is a histidine (His), proline (Pro) or threonine (Thr) residue,
X13은 아르기닌(Arg), 트립토판(Trp) 또는 글루타민(Gln) 잔기이고,X 13 is an arginine (Arg), tryptophan (Trp) or glutamine (Gln) residue,
X14는 이소류신(Ile), 글루타민(Gln) 또는 라이신(Lys) 잔기이고,X 14 is isoleucine (Ile), glutamine (Gln) or lysine (Lys) residue,
X15는 히스티딘(His) 또는 아르기닌(Arg) 잔기이고, X 15 is a histidine (His) or arginine (Arg) residue,
X16는 프롤린(Pro), 히스티딘(His) 또는 발린(Val) 잔기이고,X 16 is proline (Pro), histidine (His) or valine (Val) residue,
X17은 아스파라긴(Asn), 아르기닌(Arg) 또는 라이신(Lys) 잔기이고, X 17 is asparagine (Asn), arginine (Arg) or lysine (Lys) residue,
이외의 문자는 아미노산의 단문자 표기이다.The other characters are single-character notation of amino acids.
본 발명의 상기 용어 "핵산"은 임의의 2개 이상의 공유결합된 뉴클레오티드, 또는 뉴클레오티드 유사체 또는 유도체를 지칭한다.The term "nucleic acid" of the present invention refers to any two or more covalently bonded nucleotides, or nucleotide analogs or derivatives.
본 발명의 다른 양태에 따르면, 본 발명은 상기 핵산 분자를 포함하는 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드 발현용 벡터를 제공한다.According to another aspect of the present invention, there is provided a vector for expressing a fibronectin EDB protein scaffold that specifically binds to a dengue virus NS1 domain comprising the nucleic acid molecule.
본 발명의 상기 용어 "벡터" 숙주 세포 내로 도입되어 원하는 발현 생성물을 발현하는 비히클을 지칭한다. 당업자에게 공지되어 있는 바와 같이, 이러한 벡터는 플라스미드, 파지, 바이러스 및 레트로바이러스로 구성된 군으로부터 용이하게 선택될 수 있다. 일반적으로, 본 발명과 상용가능한 벡터는 선택 마커, 원하는 핵산의 클로닝을 촉진하기 위한 적절한 제한 부위, 및 진핵세포 또는 원핵세포 내로 들어가고/가거나 진핵세포 또는 원핵세포에서 복제하는 능력을 포함할 것이다.The term "vector" of the present invention refers to a vehicle that is introduced into a host cell to express the desired expression product. As is known to those skilled in the art, such vectors may be readily selected from the group consisting of plasmids, phage, viruses and retroviruses. Generally, vectors compatible with the present invention will include selectable markers, appropriate restriction sites for promoting cloning of the desired nucleic acid, and the ability to enter and / or replicate in eukaryotic or prokaryotic cells.
본 발명의 또 다른 양태에 따르면, 본 발명은 하기 [일반식 4]로 표시되는 아미노산 서열을 포함하는 피브로넥틴 EDB 단백질 스캐폴드는 질환과 관련된 특정 표적에 결합하여 질환의 진단을 위해 이용될 수 있으며, 바람직하게는 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하여 뎅기열 바이러스를 진단할 수 있는 조성물을 제공한다.According to another aspect of the present invention, the present invention provides a fibronectin EDB protein scaffold comprising an amino acid sequence represented by the following
[일반식 4][Formula 4]
EVPQLTDLSFVDITDSSIGLRWX1X2X3X4X5X6X7IIGYRITVVAAGEGIPIFEDFVDX8X9X10X11YYTVTGLEPGIDYDISVITLIX12X13X14X15X16X17PTTLTQQTEVPQLTDLSFVDITDSSIGLRWX 1 X 2 X 3 X 4 X 5 X 6 X 7 IIGYRITVVAAGEGIPIFEDFVDX 8 X 9 X 10 X 11 YYTVTGLEPGIDYDISVITLIX 12 X 13 X 14 X 15 X 16 X 17 PTTLTQQT
X1은 발린(Val) 또는 아르기닌(Arg) 잔기이고, X 1 is a valine (Val) or arginine (Arg) residue,
X2는 글루타민(Gln) 또는 메티오닌(Met) 잔기이고, X 2 is a glutamine (Gln) or methionine (Met) residue,
X3는 시스테인(Cys), 발린(Val) 또는 트레오닌(Thr) 잔기이고,X 3 is a cysteine (Cys), valine (Val) or threonine (Thr) residue,
X4는 글루타민(Gln), 메티오닌(Met) 또는 시스테인(Cys) 잔기이고,X 4 is glutamine (Gln), methionine (Met) or cysteine (Cys) residue,
X5는 시스테인(Cys), 아르기닌(Arg) 또는 류신(Leu) 잔기이고,X 5 is a cysteine (Cys), arginine (Arg) or leucine (Leu) residue,
X6는 알라닌(Ala), 메티오닌(Met) 또는 류신(Leu) 잔기이고,X 6 is an alanine (Ala), methionine (Met) or leucine (Leu) residue,
X7은 글라이신(Gly) 또는 류신(Leu) 잔기이고,X 7 is a glycine (GIy) or leucine (Leu) residue,
X8은 프롤린(Pro), 히스티딘(His) 또는 아스파르트산(Asp) 잔기이고,X 8 is proline (Pro), histidine (His) or aspartic acid (Asp) residue,
X9은 알라닌(Ala) 또는 프롤린(Pro) 잔기이고,X 9 is an alanine (Ala) or proline (Pro) residue,
X10은 시스테인(Cys), 이소류신(Ile) 또는 트립토판(Trp) 잔기이고,X 10 is a cysteine (Cys), isoleucine (Ile) or tryptophan (Trp) residue,
X11은 발린(Val), 아르기닌(Arg) 또는 트레오닌(Thr) 잔기이고, X 11 is a valine (Val), arginine (Arg) or threonine (Thr) residue,
X12는 히스티딘(His), 프롤린(Pro) 또는 트레오닌(Thr) 잔기이고,X 12 is a histidine (His), proline (Pro) or threonine (Thr) residue,
X13은 아르기닌(Arg), 트립토판(Trp) 또는 글루타민(Gln) 잔기이고,X 13 is an arginine (Arg), tryptophan (Trp) or glutamine (Gln) residue,
X14는 이소류신(Ile), 글루타민(Gln) 또는 라이신(Lys) 잔기이고,X 14 is isoleucine (Ile), glutamine (Gln) or lysine (Lys) residue,
X15는 히스티딘(His) 또는 아르기닌(Arg) 잔기이고, X 15 is a histidine (His) or arginine (Arg) residue,
X16는 프롤린(Pro), 히스티딘(His) 또는 발린(Val) 잔기이고,X 16 is proline (Pro), histidine (His) or valine (Val) residue,
X17은 아스파라긴(Asn), 아르기닌(Arg) 또는 라이신(Lys) 잔기이고, X 17 is asparagine (Asn), arginine (Arg) or lysine (Lys) residue,
이외의 문자는 아미노산의 단문자 표기이다.The other characters are single-character notation of amino acids.
본 발명의 피브로넥틴 EDB 단백질 스캐폴드는, 대상체로부터 샘플을 수득하는 단계; 항원-스캐폴드의 상호작용이 형성될 수 있는 조건 하에서 표적을 피브로넥틴 EDB 단백질 스캐폴드를 포함하는 조성물의 스캐폴드에 접촉시키는 단계; 및 표적-스캐폴드 복합체를 확인하여 조성물 중의 항원을 검출하는 단계; 를 통해 대상체에서 질환, 즉 뎅기열 질환을 진단할 수 있다.The fibronectin EDB protein scaffold of the present invention comprises the steps of: obtaining a sample from a subject; Contacting the target with a scaffold of a composition comprising a fibronectin EDB protein scaffold under conditions where an interaction of the antigen-scaffold can be formed; And detecting the target-scaffold complex to detect an antigen in the composition; Can diagnose a disease, i.e., dengue disease, in a subject.
전술한 바와 같이, 피브로넥틴 EDB 단백질 스캐폴드는 뎅기열 바이러스의 비구조 당 단백질인 NS1 도메인에 특이적으로 결합하므로, 뎅기열 바이러스를 진단하는데 용이하다.As described above, the fibronectin EDB protein scaffold specifically binds to the NS1 domain, an unstructured glycoprotein of dengue virus, so that it is easy to diagnose dengue virus.
도 1은 각 패닝 단계에서 회수한 output 파아지/input 파아지 비율을 나타낸다.
도 2는 피브로넥틴 EDB 단백질 스캐폴드 라이브러리를 이용한 NS1 바이오패닝 과정 중 3차 단계에서 회수한 60개 재조합 파아지의 NS1 및 Streptavidin에 대한 ELISA 결과를 나타낸다.
도 3은 EDB 아미노산들의 NS1 결합 특이성을 확인한 결과를 나타낸다.Figure 1 shows the output phage / input phage ratio recovered at each panning step.
Figure 2 shows the ELISA results for NS1 and Streptavidin of 60 recombinant phage recovered in the third step in the NS1 bio-panning process using the fibronectin EDB protein scaffold library.
Figure 3 shows the results of confirming the NS1 binding specificity of EDB amino acids.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하기로 한다. 이들 실시예는 단지 본 발명을 예시하기 위한 것이므로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지는 않는다.Hereinafter, the present invention will be described in more detail with reference to Examples. These embodiments are only for illustrating the present invention, and thus the scope of the present invention is not construed as being limited by these embodiments.
실시예 1: EDB 재조합 파아지 라이브러리 제작 Example 1: Preparation of EDB recombinant phage library
-80℃에 저장된 EDB 라이브러리에서 재조합 파아지를 생산하였다. 30㎖ SB 액체배지에 -80℃에 보관된 라이브러리 1㎖을 추가하여 20분 동안 37℃에서 200rpm의 속도로 혼합하여 배양하였다. 여기에 Helper phage(1010pfu)과 암피실린(최종 농도 50μg/㎖)을 넣고 다시 한 시간 동안 같은 조건으로 배양하였다. 그 다음, 암피실린(50μg/㎖) 및 카나마이신(10μg/㎖)이 포함된 SB 액체배지 30㎖에 옮겨 같은 조건으로 16시간 이상 배양하여 재조합 파아지를 생산하였다. The recombinant phage was produced from the EDB library stored at -80 ° C. 1 ml of the library stored at -80 占 폚 was added to 30 ml SB liquid medium, and the mixture was cultured at a speed of 200 rpm at 37 占 폚 for 20 minutes. Helper phage (1010 pfu) and ampicillin (final concentration 50 μg / ㎖) were added and cultured for the same time for the same time. Then, the cells were transferred to 30 ml of SB liquid medium containing ampicillin (50 μg / ml) and kanamycin (10 μg / ml) and cultured for 16 hours or more under the same conditions to produce recombinant phages.
배양액을 4℃에서 5,000rpm의 속도로 10분 동안 원심 분리하여 얻은 상층액에 PEG/NaCl을 5:1 비율로 혼합하여 얼음에 1시간 동안 방치시킨 후, 4℃에서 20분 동안 13,000rpm의 속도로 원심 분리하여 상층액은 조심스럽게 제거하고 1㎖의 PBS로 펠렛을 재현탁시켰다.The culture was centrifuged at a rate of 5,000 rpm for 10 minutes at 4 ° C. The supernatant was mixed with PEG / NaCl at a ratio of 5: 1 and left on ice for 1 hour. The mixture was then centrifuged at 4 ° C for 20 minutes at a rate of 13,000 rpm , The supernatant was carefully removed, and the pellet was resuspended in 1 ml of PBS.
실시예 2: EDB-NS1의 바이오패닝Example 2: Biopanning of EDB-NS1
NS1(10㎍/㎖)을 96 well high binding plate의 8개의 well에 50㎕씩 넣은 후, 4℃에서 하룻밤 동안 방치하였고, 다음날 PBS 200㎕로 1회 세척한 후, 2% BSA 200㎕를 넣고 상온에서 2시간 동안 블록킹한 후, 용액을 모두 버리고 PBS 200㎕로 3회 세척하였다. 50 μl of NS1 (10 μg / ml) was added to 8 wells of a 96 well high binding plate, and the plate was allowed to stand at 4 ° C. overnight. The plate was washed once with 200 μl of PBS and then 200 μl of 2% BSA After blocking for 2 hours at room temperature, the solution was discarded and washed three times with 200 μl of PBS.
여기에 상기 실시예 1에서 제조된 EDB 재조합 파아지 포함용액 400㎕ 및 2% BSA 400㎕을 혼합하여 웰당 100㎕씩 넣고 30℃에서 1시간 동안 방치하였다. 400 쨉 l of the EDB recombinant phage containing solution prepared in Example 1 and 400 쨉 l of 2% BSA were mixed and added at a rate of 100 쨉 l per well and left at 30 째 C for 1 hour.
8개 웰의 용액을 모두 제거하고 0.05% PBST(tween-20)로 3회 세척한 뒤 0.2M 글리신(pH 2.2)을 웰당 100㎕씩 넣어 10분간 파아지를 용리시키고 800㎕ 에펜도르프 튜브에 모아 여기에 1M Tris(pH 9.0) 200㎕를 넣어 중화시켰다. After removing all of the 8 wells, the cells were washed three times with 0.05% PBST (tween-20), and then 100 μl of 0.2 M glycine (pH 2.2) was added to each well to elute the phage for 10 minutes. Then, 800 μl of the solution was collected in an Eppendorf tube Was neutralized by adding 200 [mu] l of 1M Tris (pH 9.0).
각 바이오패닝마다 input 파아지 및 output 파아지의 수를 측정하기 위해 OD=0.7인 E. coli 세포에 섞어 주어 암피실린이 포함된 아가 배지에 도말하였다. 패닝을 반복하기 위해 NS1 output 파아지 500㎕를 5㎖의 E. coli 세포와 섞어 37℃에서 200rpm의 속도로 30분 동안 혼합하며 배양한 후, 암피실린(50μg/㎖) 및 헬퍼 파아지(5 x 109 pfu) 첨가하여 같은 방법으로 30분 동안 배양하였다. 그 다음 암피실린(50μg/㎖)과 카나마이신(10μg/㎖)이 포함된 50㎖ SB 배지에 옮겨 같은 방법으로 하루 동안 배양하였다. To measure the number of input phage and output phage for each bio-panning, E. coli cells at OD = 0.7 were mixed and plated on agar medium containing ampicillin. To repeat the panning, 500 μl of the NS1 output phage was mixed with 5 ml of E. coli cells and cultured at 37 ° C. for 30 minutes at a speed of 200 rpm. Then, the cells were cultured in the presence of ampicillin (50 μg / ml) and helper phage ) And incubated for 30 min in the same manner. Then, the cells were transferred to 50 ml SB medium containing ampicillin (50 μg / ml) and kanamycin (10 μg / ml) and cultured in the same manner for one day.
배양액을 4℃에서 5,000rpm의 속도로 10분동안 원심 분리하여 상층액에 PEG/NaCl [20% PEG(w/v) 및 15% NaCl(w/v)]을 5:1 비율로 첨가한 후 얼음에 1시간 동안 정치시켰다. 4℃에서 13,000rpm의 속도로 20분 동안 원심분리 후 상층액을 완전히 제거하고 1㎖의 PBS 용액으로 파아지 펠렛을 현탁한 다음 2차 바이오패닝에 사용하였다. The culture was centrifuged at 5,000 rpm at 4 ° C for 10 minutes, and PEG / NaCl [20% PEG (w / v) and 15% NaCl (w / v)] was added to the supernatant at a ratio of 5: 1 And allowed to stand in ice for 1 hour. After centrifugation at 13,000 rpm at 4 ° C for 20 minutes, the supernatant was completely removed and the phage pellet was suspended in 1 ml of PBS solution and used for secondary bio-panning.
각 패닝 단계마다 상기와 동일한 방법을 사용했으며, 아래 표 1에서 보는 바와 같이 세척 과정만 단계별로 각각 3회, 5회 (0.05% PBST) 증가시켰다. 아래 표 1 및 도 1 에서 세척 과정에 따라 output 파아지 / input 파아지 의 비율이 증가함을 볼 수 있다. The same method as described above was used for each panning step. As shown in Table 1 below, the washing process was increased 3 times and 5 times (0.05% PBST), respectively, at each step. In Table 1 and FIG. 1 below, the ratio of output phage / input phage increases according to the washing procedure.
Washing 3회
(0.05% PBST)Binding 30 °
(0.05% PBST)
3.28 x 1011
3.28 x 10 11
2.6 x 107
2.6 x 10 7
7.92 x 10-5
7.92 x 10 -5
(0.05% PBST)Binding 30
(0.05% PBST)
2.0 x 1011
2.0 x 10 11
2.1 x 106
2.1 x 10 6
1.05 x 10-5
1.05 x 10 -5
(0.05% PBST)Binding 30
(0.05% PBST)
7.2 x 1011
7.2 x 10 11
2.2 x 107
2.2 x 10 7
3.05 x 10-5
3.05 x 10 -5
(0.05% PBST)Binding 30
(0.05% PBST)
4.1 x 1011
4.1 x 10 11
8.39 x 107
8.39 x 10 7
20.46 x 10-5
20.46 x 10 -5
실시예 3: NS1에 특이적인 파아지 검색(colony ELISA)Example 3: NS1-specific phage search (colony ELISA)
상기 표 1에서 output/input 파아지 비율이 가장 높은 바이오패닝 단계에서 회수한 조건 4의 파아지를 E. coli 세포에 감염시킨 후 플라크가 플레이트당 100-200개 정도가 되도록 도말하였다. The E. coli cells were infected with the phage of
멸균된 팁을 이용하여 플라크 60개를 1㎖의 SB-암피실린(50 μμg/㎖) 배양액에 접종한 후 37℃에서 5시간 동안 진탕 배양하여 헬퍼 파아지를 30㎕씩 첨가하여 37℃에서 200rpm의 속도로 하루 동안 배양하였다. 배양액을 12,000rpm의 속도로 2분 동안 원심 분리하여 상층액을 회수한 후 2% BSA를 넣고 이를 파아지 검색에 사용하였다. 96웰 ELISA 플레이트에 5μμg/㎖의 NS1, Streptavidin을 각 웰당 50㎕씩 50개의 웰에 넣고 4℃에서 하루 동안 방치하였다. 다음날 모든 웰의 단백질을 제거하고 2% BSA를 사용하여 상온에서 2시간 동안 블록킹한 뒤, 용액을 모두 버리고 0.1% PBST로 3회 세척하였다. 각 클론별로 증폭된 파아지 용액 100㎕씩을 모든 웰에 분주하고 30℃에서 1시간 동안 정치하였다. 60 plaques were inoculated into 1 ml of SB-Ampicillin (50 μg / ml) culture medium using a sterilized tip, and incubated at 37 ° C for 5 hours with shaking. Then, 30 μl of helper phage was added thereto, For one day. The culture was centrifuged at a speed of 12,000 rpm for 2 minutes, and the supernatant was recovered. Then, 2% BSA was added thereto and used for the phage search. 5 μg / ml of NS1 and Streptavidin were added to 50 wells per well of a 96-well ELISA plate and left at 4 ° C for one day. On the next day, the proteins of all wells were removed and blocked with 2% BSA at room temperature for 2 hours. The solution was discarded and washed three times with 0.1% PBST. 100 쨉 l of phage solution amplified for each clone was dispensed into all wells and allowed to stand at 30 캜 for 1 hour.
0.1% PBST 용액으로 3회 세척한 다음 HRP-컨쥬게이트 항-M13항체(GE Healthcare)를 1:2,000으로 희석하여 100㎕씩 분주하고 30℃에서 1시간 동안 반응시켰다. 0.1% PBST로 3회 세척한 후 TMB용액 100㎕를 분주하여 발색반응을 유도한 다음 100㎕의 1M HSO를 첨가하여 반응을 중지시켰다. 450nm에서 흡광도를 측정한 결과를 도 2에 나타내었다. After washing three times with 0.1% PBST solution, HRP-conjugated anti-M13 antibody (GE Healthcare) was diluted 1: 2,000, and 100 ㎕ of each was diluted and reacted at 30 캜 for 1 hour. After washing three times with 0.1% PBST, 100 μl of TMB solution was dispensed to induce a color reaction, and 100 μl of 1 M HSO was added to stop the reaction. The results of absorbance measurements at 450 nm are shown in FIG.
도 2의 결과에서 Streptavidin에 비해 3배 이상 흡광도가 높은 클론들을 선별하여 시퀀싱을 의뢰하였다 (Bioneer, Daejeon, Korea). 시퀀싱 프라이머는 GATTACGCCAAGCTTTGGAGC를 사용하였다. 선택된 뎅기 바이러스 NS1 진단용 EDB 아미노산 서열은 다음 표 2와 같다.In the result of FIG. 2, clones having a higher absorbance than 3 times higher than that of Streptavidin were selected for sequencing (Bioneer, Daejeon, Korea). Sequencing primer was GATTACGCCAAGCTTTGGAGC. The EDB amino acid sequences for the selected dengue virus NS1 diagnostic are shown in Table 2 below.
실시예 4: NS1에 대한 특이성 시험Example 4: Specificity test for NS1
상기 서열번호 1 내지 3의 NS1@EDB14, NS1@EDB21, NS1@EDB26을 이용하여 NS1을 검출할 수 있는지 ELISA로 확인해 보았다. NS1 @ EDB14, NS1 @ EDB21 and NS1 @ EDB26 of SEQ ID NOS: 1 to 3 were used to confirm whether NS1 could be detected by ELISA.
구체적으로, 5ug/ml NS1을 96웰 플레이트에 고정화 한 뒤에, NS1@EDB14, NS1@EDB21, NS1@EDB26을 넣고 1시간 동안 정치하였다. Specifically, 5 ug / ml NS1 was immobilized on a 96-well plate, and then NS1 @ EDB14, NS1 @ EDB21, and NS1 @ EDB26 were added and allowed to stand for 1 hour.
그 다음, 0.05% PBST 용액으로 4번 세척한 후, HRP-컨쥬게이트 항체를 이용하여 발색 반응을 관찰하였다. Then, after washing 4 times with 0.05% PBST solution, color development was observed using HRP-conjugated antibody.
그 결과, 도 3에서 확인할 수 있듯이, NS1@EDB14, NS1@EDB21, NS1@EDB26 모두 NS1을 검출할 수 있으며, 이러한 결과를 통해 본 발명에 따른 서열번호 1 내지 3의 NS1@EDB14, NS1@EDB21, NS1@EDB26가 NS1에 대하여 특이성을 나타내는 것을 알 수 있다.As a result, NS1 @ EDB14, NS1 @ EDB21 and NS1 @ EDB26 of NS1 @ EDB14 and NS1 @ EDB21 of SEQ ID NOS: 1 to 3 according to the present invention can detect NS1, , And NS1 @ EDB26 showed specificity for NS1.
<110> Korea Institute of Ceramic Engineering and Technology <120> A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus <130> DP-2018-0080-KR <160> 3 <170> KoPatentIn 3.0 <210> 1 <211> 91 <212> PRT <213> Artificial Sequence <220> <223> NS1@EDB14 <400> 1 Glu Val Pro Gln Leu Thr Asp Leu Ser Phe Val Asp Ile Thr Asp Ser 1 5 10 15 Ser Ile Gly Leu Arg Trp Val Gln Cys Gln Cys Ala Gly Ile Ile Gly 20 25 30 Tyr Arg Ile Thr Val Val Ala Ala Gly Glu Gly Ile Pro Ile Phe Glu 35 40 45 Asp Phe Val Asp Pro Ala Cys Val Tyr Tyr Thr Val Thr Gly Leu Glu 50 55 60 Pro Gly Ile Asp Tyr Asp Ile Ser Val Ile Thr Leu Ile His Arg Ile 65 70 75 80 His Pro Asn Pro Thr Thr Leu Thr Gln Gln Thr 85 90 <210> 2 <211> 91 <212> PRT <213> Artificial Sequence <220> <223> NS1@EDB21 <400> 2 Glu Val Pro Gln Leu Thr Asp Leu Ser Phe Val Asp Ile Thr Asp Ser 1 5 10 15 Ser Ile Gly Leu Arg Trp Val Gln Val Met Arg Met Gly Ile Ile Gly 20 25 30 Tyr Arg Ile Thr Val Val Ala Ala Gly Glu Gly Ile Pro Ile Phe Glu 35 40 45 Asp Phe Val Asp His Pro Ile Arg Tyr Tyr Thr Val Thr Gly Leu Glu 50 55 60 Pro Gly Ile Asp Tyr Asp Ile Ser Val Ile Thr Leu Ile Pro Trp Gln 65 70 75 80 Arg His Arg Pro Thr Thr Leu Thr Gln Gln Thr 85 90 <210> 3 <211> 91 <212> PRT <213> Artificial Sequence <220> <223> NS1@EDB26 <400> 3 Glu Val Pro Gln Leu Thr Asp Leu Ser Phe Val Asp Ile Thr Asp Ser 1 5 10 15 Ser Ile Gly Leu Arg Trp Arg Met Thr Cys Leu Cys Leu Ile Ile Gly 20 25 30 Tyr Arg Ile Thr Val Val Ala Ala Gly Glu Gly Ile Pro Ile Phe Glu 35 40 45 Asp Phe Val Asp Asp Pro Trp Thr Tyr Tyr Thr Val Thr Gly Leu Glu 50 55 60 Pro Gly Ile Asp Tyr Asp Ile Ser Val Ile Thr Leu Ile Thr Gln Lys 65 70 75 80 His Val Lys Pro Thr Thr Leu Thr Gln Gln Thr 85 90 <110> Korea Institute of Ceramic Engineering and Technology <120> A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus <130> DP-2018-0080-KR <160> 3 <170> KoPatentin 3.0 <210> 1 <211> 91 <212> PRT <213> Artificial Sequence <220> <223> NS1 @ EDB14 <400> 1 Glu Val Pro Gln Leu Thr Asp Leu Ser Phe Val Asp Ile Thr Asp Ser 1 5 10 15 Ser Ile Gly Leu Arg Trp Val Gln Cys Gln Cys Ala Gly Ile Ile Gly 20 25 30 Tyr Arg Ile Thr Val Val Ala Ala Gly Glu Gly Ile Pro Ile Phe Glu 35 40 45 Asp Phe Val Asp Pro Ala Cys Val Tyr Tyr Thr Val Thr Gly Leu Glu 50 55 60 Pro Gly Ile Asp Tyr Asp Ile Ser Val Ile Thr Leu Ile His Arg Ile 65 70 75 80 His Pro Asn Pro Thr Thr Leu Thr Gln Gln Thr 85 90 <210> 2 <211> 91 <212> PRT <213> Artificial Sequence <220> <223> NS1 @ EDB21 <400> 2 Glu Val Pro Gln Leu Thr Asp Leu Ser Phe Val Asp Ile Thr Asp Ser 1 5 10 15 Ser Ile Gly Leu Arg Trp Val Gln Val Met Met Met Gly Ile Ile Gly 20 25 30 Tyr Arg Ile Thr Val Val Ala Ala Gly Glu Gly Ile Pro Ile Phe Glu 35 40 45 Asp Phe Val Asp His Pro Ile Arg Tyr Tyr Thr Val Thr Gly Leu Glu 50 55 60 Pro Gly Ile Asp Tyr Asp Ile Ser Val Ile Thr Leu Ile Pro Trp Gln 65 70 75 80 Arg His Arg Pro Thr Thr Leu Thr Gln Gln Thr 85 90 <210> 3 <211> 91 <212> PRT <213> Artificial Sequence <220> <223> NS1 @ EDB26 <400> 3 Glu Val Pro Gln Leu Thr Asp Leu Ser Phe Val Asp Ile Thr Asp Ser 1 5 10 15 Ser Ile Gly Leu Arg Trp Arg Met Thr Cys Leu Cys Leu Ile Ile Gly 20 25 30 Tyr Arg Ile Thr Val Val Ala Ala Gly Glu Gly Ile Pro Ile Phe Glu 35 40 45 Asp Phe Val Asp Asp Pro Trp Thr Tyr Tyr Thr Val Thr Gly Leu Glu 50 55 60 Pro Gly Ile Asp Tyr Asp Ile Ser Val Ile Thr Leu Ile Thr Gln Lys 65 70 75 80 His Val Lys Pro Thr Thr Leu Thr Gln Gln Thr 85 90
Claims (7)
[서열번호 1]
EVPQLTDLSFVDITDSSIGLRWVQCQCAGIIGYRITVVAAGEGIPIFEDFVDPACVYYTVTGLEPGIDYDISVITLIHRIHPNPTTLTQQT
[서열번호 2]
EVPQLTDLSFVDITDSSIGLRWVQVMRMGIIGYRITVVAAGEGIPIFEDFVDHPIRYYTVTGLEPGIDYDISVITLIPWQRHRPTTLTQQT
[서열번호 3]
EVPQLTDLSFVDITDSSIGLRWRMTCLCLIIGYRITVVAAGEGIPIFEDFVDDPWTYYTVTGLEPGIDYDISVITLITQKHVKPTTLTQQT
1. A fibronectin EDB protein scaffold specifically binding to dengue virus comprising one or more amino acid sequences selected from the group consisting of the amino acid sequences of SEQ ID NOS:
[SEQ ID NO: 1]
EVPQLTDLSFVDITDSSIGLRWVQCQCAGIIGYRITVVAAGEGIPIFEDFVDPACVYYTVTGLEPGIDYDISVITLIHRIHPNPTTLTQQT
[SEQ ID NO: 2]
≪
[SEQ ID NO: 3]
EVPQLTDLSFVDITDSSIGLRWRMTCLCLIIGYRITVVAAGEGIPIFEDFVDDPWTYYTVTGLEPGIDYDISVITLITQKHVKPTTLTQQT
상기 피브로넥틴 EDB 단백질 스캐폴드는 뎅기열 바이러스 NS1 도메인에 특이적으로 결합하는 것인,
뎅기열 바이러스에 특이적으로 결합하는 피브로넥틴 EDB 단백질 스캐폴드.
The method according to claim 1,
Wherein the fibronectin EDB protein scaffold specifically binds to the dengue virus NS1 domain.
Fibronectin EDB protein scaffold specifically binding to dengue virus.
A nucleic acid molecule that coats a fibronectin EDB protein scaffold specifically binding to the dengue virus of claim 1 or 4.
A vector for expressing a fibronectin EDB protein scaffold specifically binding to dengue virus comprising the nucleic acid molecule of claim 5.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020180052483A KR101995774B1 (en) | 2018-05-08 | 2018-05-08 | A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020180052483A KR101995774B1 (en) | 2018-05-08 | 2018-05-08 | A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus |
Publications (1)
Publication Number | Publication Date |
---|---|
KR101995774B1 true KR101995774B1 (en) | 2019-07-03 |
Family
ID=67258771
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020180052483A KR101995774B1 (en) | 2018-05-08 | 2018-05-08 | A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR101995774B1 (en) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004067567A2 (en) * | 2003-01-31 | 2004-08-12 | Novartis Ag | Anti-dengue virus antibodies, compositions, methods and uses |
KR101763745B1 (en) | 2016-01-08 | 2017-08-01 | 전북대학교산학협력단 | Monoclonal antibody against envelope domain Ⅲ of four serotype dengue virus and uses thereof |
KR101781907B1 (en) * | 2008-10-31 | 2017-09-26 | 얀센 바이오테크 인코포레이티드 | Fibronectin type iii domain based scaffold compositions, methods and uses |
KR101837856B1 (en) | 2016-10-18 | 2018-03-13 | 단국대학교 산학협력단 | RNA aptamers that inhibit methyltransferase activity of Dengue virus serotype 2 and 3 |
-
2018
- 2018-05-08 KR KR1020180052483A patent/KR101995774B1/en active IP Right Grant
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004067567A2 (en) * | 2003-01-31 | 2004-08-12 | Novartis Ag | Anti-dengue virus antibodies, compositions, methods and uses |
KR101781907B1 (en) * | 2008-10-31 | 2017-09-26 | 얀센 바이오테크 인코포레이티드 | Fibronectin type iii domain based scaffold compositions, methods and uses |
KR101763745B1 (en) | 2016-01-08 | 2017-08-01 | 전북대학교산학협력단 | Monoclonal antibody against envelope domain Ⅲ of four serotype dengue virus and uses thereof |
KR101837856B1 (en) | 2016-10-18 | 2018-03-13 | 단국대학교 산학협력단 | RNA aptamers that inhibit methyltransferase activity of Dengue virus serotype 2 and 3 |
Non-Patent Citations (3)
Title |
---|
PLoS Pathogens, Vol. 4, Issue2, pp.e17(2008.02.) * |
The Journal of Infectious Disease, Vol. 186, pp. 743-751(2002.) * |
Virology Journal, Vol. 13, No. 131, pp. 1-10(2016.) * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111961133B (en) | Monoclonal antibody aiming at novel coronavirus SARS-CoV-2 spinous process protein non-RBD region and application thereof | |
CN113185613B (en) | Novel coronavirus S protein and subunit vaccine thereof | |
CN1325644C (en) | Muteins of human neutrophil gelatinase-associated lipocalin and related proteins | |
CN111548396B (en) | Novel coronavirus T cell epitope peptide, pMHC, preparation and application thereof | |
CN107973850B (en) | Recombinant classical swine fever virus E2 protein swine-derived monoclonal antibody, and preparation method and application thereof | |
WO2015139784A1 (en) | Distinguishing flavivirus infection using a recombinant mutant envelope protein | |
IL139844A (en) | Nucleic acid vaccines for prevention of flavivirus infection | |
EP3068886A1 (en) | Aptamers for binding flavivirus proteins | |
TW201410709A (en) | Peptide libraries and use thereof | |
KR101885573B1 (en) | Affibody specific to dengue virus | |
US8277819B2 (en) | Norovirus particle for use as an antiviral or vaccine | |
CN111132692A (en) | Virus-like particles comprising Zika virus antigen | |
Tan et al. | Rapid purification of recombinant dengue and West Nile virus envelope Domain III proteins by metal affinity membrane chromatography | |
CN111320688B (en) | Flavivirus neutralizing antibody, preparation method and application thereof | |
CN104583408B (en) | For reducing the interference of immunoassays and molecular chaperone molecule companion's fused polypeptide of stable immunoassays | |
CN108676094B (en) | Human IgG antibody Fc segment CH2 structural domain mutant and preparation method and application thereof | |
CN104193805B (en) | Duck tembusu virus envelop E protein inhibitory peptide and application thereof | |
KR101995774B1 (en) | A fibronectin Extra Domain B protein scaffold specifically binding to dengue virus | |
KR102100813B1 (en) | Fusion protein from hepatitis C virus and diagnosing kit comprising the same | |
TW201309720A (en) | Peptide library | |
MXPA03006263A (en) | Peptides having affinity for the gp120 viral protein and use thereof. | |
Ganguly et al. | Enhanced prokaryotic expression of dengue virus envelope protein | |
CN100378123C (en) | Chimeric chains that code for proteins that induce effects directed against viruses | |
CN114891075A (en) | Polypeptide with binding affinity to new coronavirus S protein RBMFP structural domain and application thereof | |
KR101954663B1 (en) | Affibody heterodimer specific to dengue virus ns1 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |