KR101950502B1 - Peptide that significantly reduce airway inflammation and Composition comprising the peptide - Google Patents
Peptide that significantly reduce airway inflammation and Composition comprising the peptide Download PDFInfo
- Publication number
- KR101950502B1 KR101950502B1 KR1020170012928A KR20170012928A KR101950502B1 KR 101950502 B1 KR101950502 B1 KR 101950502B1 KR 1020170012928 A KR1020170012928 A KR 1020170012928A KR 20170012928 A KR20170012928 A KR 20170012928A KR 101950502 B1 KR101950502 B1 KR 101950502B1
- Authority
- KR
- South Korea
- Prior art keywords
- peptide
- gpr
- inflammatory
- protein
- present
- Prior art date
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Marine Sciences & Fisheries (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명에 따른 펩타이드는, GPR(G-protein Regulatory) 펩타이드에 Tat서열을 링크하고, 상기 GPR 펩타이드의 아미노산 서열 중 DDQR(아스파틱산-아스파틱산-글루타민-아르기닌)에서 Q(글루타민)를 A(알라닌)로 치환하여 합성된 것을 특징으로 하며, 상기 GPR 펩타이드는, AGS(Activators of G-protein Signaling)3 단백질에 포함되어 있는 것을 이용한 것을 특징으로 한다.
본 발명에 의하여, 생체 방어 기전에 작용하여 호흡기 염증을 현저히 줄일 수 있는 새로운 신약 후보 물질을 제공할 수 있다.The peptide according to the present invention links a Tat sequence to a GPR (G-protein regulatory) peptide and binds Q (glutamine) to A (alanine (aspartic acid-glutamine-arginine) in the DDQR ), And the GPR peptide is characterized by using the one contained in the AGS (Activators of G-protein Signaling) 3 protein.
According to the present invention, it is possible to provide a novel drug candidate substance which can act on the mechanism of bio-defense and significantly reduce respiratory inflammation.
Description
본 발명은 호흡기 염증을 현저히 줄일 수 있는 GPR 펩타이드 및 이를 포함하는 조성물에 관한 것이다.The present invention relates to a GPR peptide capable of significantly reducing respiratory inflammation and a composition containing the same.
현대 의학은 현대인이 당면한 호흡기 주요 중증 질환들, 즉 비가역적인 염증반응으로 의해 이어지는 난치성 급만성 염증질환의 근원적 치료대책을 마련하지 못하고 있다.Modern medicine has not been able to provide the fundamental treatment of intractable chronic inflammatory diseases caused by irreversible inflammatory reaction, which is the major respiratory diseases of modern people.
이러한 호흡기 중증 염증 질환들의 대표적인 예로는 만성 폐쇄성 질환, 염증성 대사질환, 천식, 비염 등이 있으며, 이들은 대표적인 고비율 저효율 질환군으로 국내 및 전 세계적으로 진료비의 수위를 차지하고 있다. 표 1은 '2009년 보건복지부 건강보험 재정/급여 현황'에서 '다빈도 상병 순위별 현황'을 나타낸 것이다. 표 1에 나타난 바와 같이, 폐렴, 편도염, 기관지염, 상기도감염, 코인두염, 인두염과 같은 호흡기 염증 질환들이 진료건수 및 요양급여비용에서 높은 순위를 차지하고 있음을 알 수 있다.These respiratory diseases are chronic obstructive diseases, inflammatory metabolic diseases, asthma, rhinitis, etc. These are high-rate and low-efficiency diseases which represent the highest level of medical expenses in Korea and the world. Table 1 shows the status of 'DABINDO SOCIETY RATINGS' in '2009 Health and Welfare Department's health insurance finances / salary status'. As shown in Table 1, respiratory inflammatory diseases such as pneumonia, tonsillitis, bronchitis, upper respiratory tract infection, nosephritis, and pharyngitis are highly ranked in the number of medical care and medical care costs.
순위'08
ranking
건수diagnosis
Number
급여
비용Care
salary
cost
순위'08
ranking
건수diagnosis
Number
급여
비용Care
salary
cost
순위'08
ranking
<단위 : 천건, 백만원><Unit: thousand won, million won>
특히, 호흡기에서 비가역적 염증이 유발되면 심각한 장애 및 이차적 사회적 문제가 발생할 수 있어서 개인뿐만 아니라 국가 및 사회가 가져야 할 경제적 부담이 기하급수적으로 상승할 수 있다.In particular, irreversible inflammation in the respiratory tract can lead to severe disability and secondary social problems, which can lead to an exponential increase in economic burdens not only for individuals but also for nations and societies.
지금까지 염증성 질환의 치료 전략으로 염증 세포의 활성화를 차단하는 전략이 주로 사용되어 왔다(COX2 inhibitor 등). 그러나 염증 세포의 활성화 경로를 억제하는 기존에 개발된 수많은 치료 물질들은 치료 효과가 미비하고 일시적 효과만 관찰되었다. 따라서 새로운 대안적 치료 전략의 개발이 매우 필요한 상태이다.So far, strategies to block the activation of inflammatory cells have been used (eg, COX2 inhibitors) as a treatment strategy for inflammatory diseases. However, many therapeutic agents that inhibit the activation pathway of inflammatory cells have not been treated effectively and only transient effects have been observed. Therefore, it is very necessary to develop new alternative treatment strategies.
세포 내 점액과 분비 및 과발현 조절 네트워크는 급성 및 만성 염증 손상으로 진행을 억제하는 생체 내 매우 중요한 방어기전이다. 최근 호흡기나 선천면역학적 분야에서 생체 방어 조절 시스템의 부전이 만성 염증 질환의 새로운 핵심 병인으로 받아들여지고 있다. Intracellular mucus, secretory and overexpression regulatory networks are very important protective mechanisms in vivo that inhibit progression to acute and chronic inflammatory damage. Recently, the deficiency of the bio-defense regulation system in the respiratory or congenital immunological field has been accepted as a new key cause of chronic inflammatory disease.
내인성 방어 기전을 통합적으로 이해하려는 국제적 연구 흐름에 비추어 볼 때, 이 분야 연구의 후보 물질이 매우 필수적이다.Candidates for this field of study are essential in light of international research trends to understand endogenous defense mechanisms in an integrated manner.
본 발명은 호흡기 염증 치료에 있어서 염증 세포의 활성화를 억제하는 기존의 치료 방식을 대체할 수 있는 것으로서, 생체 방어 기전에 작용하여 호흡기 염증을 현저히 줄일 수 있는 새로운 신약 후보 물질을 제공하는 것을 목적으로 한다.It is an object of the present invention to provide a new drug candidates which can replace the existing treatment methods for inhibiting the activation of inflammatory cells in the treatment of respiratory inflammation and can significantly reduce respiratory inflammation by acting on the mechanism of defense against the body .
본 발명에 따른 펩타이드는, GPR(G-protein Regulatory) 펩타이드에 Tat서열을 링크하고, 상기 GPR 펩타이드의 아미노산 서열 중 DDQR(아스파틱산-아스파틱산-글루타민-아르기닌)에서 Q(글루타민)를 A(알라닌)로 치환하여 합성된 것을 특징으로 한다.The peptide according to the present invention links a Tat sequence to a GPR (G-protein regulatory) peptide and binds Q (glutamine) to A (alanine (aspartic acid-glutamine-arginine) in the DDQR ). ≪ / RTI >
상기 본 발명에 따른 펩타이드는, 하기 아미노산 서열(좌측 N-terminal, 우측 C-terminal)을 포함하는 것을 특징으로 한다.The peptide according to the present invention is characterized by comprising the following amino acid sequence (left N-terminal, right C-terminal).
GRKKRRQRRRPPTMGEEDFFDLLAKSQSKRMDDARVDLAKGRKKRRQRRRPPTMGEEDFFDLLAKSQSKRMDDARVDLAK
상기 GPR 펩타이드는, AGS(Activators of G-protein Signaling)3 단백질에 포함되어 있는 것을 이용한 것을 특징으로 한다.The GPR peptide is characterized by using a protein contained in an AGS (Activators of G-protein Signaling) 3 protein.
본 발명에 따른 펩타이드는, GPR(G-protein Regulatory) 펩타이드에 Tat서열을 링크하여 합성된 것을 특징으로 한다.The peptide according to the present invention is characterized in that it is synthesized by linking a Tat sequence to a GPR (G-protein regulatory) peptide.
상기 본 발명에 따른 펩타이드는, 하기 아미노산 서열(좌측 N-terminal, 우측 C-terminal)을 포함하는 것을 특징으로 한다.The peptide according to the present invention is characterized by comprising the following amino acid sequence (left N-terminal, right C-terminal).
GRKKRRQRRRPPTMGEEDFFDLLAKSQSKRMDDQRVDLAKGRKKRRQRRRPPTMGEEDFFDLLAKSQSKRMDDQRVDLAK
상기 GPR 펩타이드는, AGS(Activators of G-protein Signaling)3 단백질에 포함되어 있는 것을 이용한 것을 특징으로 한다.The GPR peptide is characterized by using a protein contained in an AGS (Activators of G-protein Signaling) 3 protein.
본 발명에 따른 조성물은 전술한 어느 하나의 펩타이드를 포함하여 이루어질 수 있다.The composition according to the present invention may comprise any one of the peptides described above.
본 발명에 의하여, 생체 방어 기전에 작용하여 호흡기 염증을 현저히 줄일 수 있는 새로운 신약 후보 물질을 제공할 수 있다.According to the present invention, it is possible to provide a novel drug candidate substance which can act on the mechanism of bio-defense and significantly reduce respiratory inflammation.
도 1은 AGS3 단백질의 구조를 나타내는 것이다.
도 2는 본 발명의 일실시예에 따르는 펩타이드의 아미노산 서열을 나타내는 것이다.
도 3 내지 도 8은 본 발명에 따른 펩타이드를 이용한 실험 결과를 나타내는 도면이다.Figure 1 shows the structure of the AGS3 protein.
Figure 2 shows the amino acid sequence of a peptide according to one embodiment of the present invention.
FIG. 3 to FIG. 8 show experimental results using the peptide according to the present invention.
이하, 본 발명에 대하여 상세히 설명한다. Hereinafter, the present invention will be described in detail.
본 발명의 실시 예를 설명함에 있어, 관련된 공지 구성 또는 기능에 대한 구체적인 설명이 본 발명의 실시 예에 대한 이해를 방해한다고 판단되는 경우에는 그 상세한 설명은 생략한다. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS In the following description of the present invention, detailed description of known functions and configurations incorporated herein will be omitted when it may make the understanding why the present invention is not thereby well understood.
본 발명의 명세서를 통해, 문맥에서 달리 필요하지 않으면, "포함하다" 및 "포함하는"이란 말은 제시된 단계 또는 요소, 또는 단계 또는 요소들의 군을 포함하나, 임의의 다른 단계 또는 요소, 또는 단계 또는 요소들의 군이 배제되지는 않음을 내포하는 것으로 이해하여야 한다.Throughout the specification of the present invention, unless the context requires otherwise, the words " comprises " and " comprising " include any step or element, or group of steps or elements, Or groups of elements are not excluded.
이하, 본 발명의 실시 예들을 도면을 참고하여 상세하게 설명한다.Hereinafter, embodiments of the present invention will be described in detail with reference to the drawings.
[[ 펩타이드Peptides 구성] Configuration]
AGS(activators of G-protein signaling)3 단백질은 많은 세포 내에서 존재한다. 도 1은 AGS3 단백질의 구조를 나타낸다. 도 1에 도시된 바와 같이, AGS3 단백질은 7개의 TPRs(Tetratricopeptide repeats)과 4 개의 GPR(G-protein regulatory) motif로 구성된 모듈 도메인 구조를 가지고 있다. 이 중 4개의 GPR(G-protein Regulatory) 부분은 세포 내 신호전달에 중요한 역할을 하는 G-단백질(G-protein)을 조절한다. GPR 부분의 가장 중요한 기능은 G-단백질(αβγ -subunit로 구성됨)의 α subunit에 결합하여 G-단백질의 신호전달을 억제하는 것이다.Activators of G-protein signaling (AGS) 3 proteins are present in many cells. Figure 1 shows the structure of the AGS3 protein. As shown in FIG. 1, the AGS3 protein has a modular domain structure composed of seven TPRs (tetracyclic peptide repeats) and four GPR (G-protein regulatory) motifs. Four of these GPR (G-protein regulatory) parts regulate G-protein (G-protein), which plays an important role in intracellular signaling. The most important function of the GPR part is to inhibit signal transduction of the G-protein by binding to the alpha subunit of the G-protein (composed of alpha beta gamma-subunits).
발명자는 도 2에 도시된 바와 같이, 28개 아미노산으로 이루어진 GPR 펩타이드에 Tat 서열(GRKKRRQRRRPP)을 링크하여 세포 내로 잘 흡수 될 수 있도록 펩타이드(Tat-GPR)를 합성하였다(좌측 N-terminal, 우측 C-terminal). As shown in Fig. 2, the present inventors synthesized a peptide (Tat-GPR) to link the Tat sequence (GRKKRRQRRRPP) to a 28-amino acid GPR peptide so that it can be easily absorbed into cells (left N-terminal, right C -terminal).
또한 GPR 펩타이드의 기능적 역할을 증명하기 위하여 도 2에 도시된 바와 같이, GPR 펩타이드 중 가장 중요한 부위인 DDQR(아스파틱산-아스파틱산-글루타민-아르기닌) 서열 중 글루타민을 알라닌으로 치환한 변형된 펩타이드(Tat-GPR Q34A)를 제작하였다(좌측 N-terminal, 우측 C-terminal).In order to demonstrate the functional role of the GPR peptide, as shown in Fig. 2, a modified peptide (Tat) in which glutamine in the DDQR (aspartic acid-aspartic acid-glutamine-arginine) sequence which is the most important part of the GPR peptide was substituted with alanine -GPR Q34A) (left N-terminal, right C-terminal).
위 두 개의 펩타이드는 전혀 다른 기능을 수행 할 수 있는 펩타이드이다. The two peptides are peptides that can perform completely different functions.
[작용 효과][Function and effect]
펩타이드가 세포 내로 유입 시 가장 고려할 사항이 독성(toxicity)이기 때문에 독성이 없는 것을 세포사멸분석법을 이용하여 증명하였다.Since the most important consideration when introducing peptides into cells is toxicity, the lack of toxicity is demonstrated using apoptosis assays.
본 발명의 펩타이드를 호흡기 상피 세포 내로 유입시킨 후 염증성 자극을 준 후 염증성 인자 및 항염증 인자의 발현을 확인하였다. 그 결과, 변형된 GPR 펩타이드(Tat-GPR Q34A)가 염증인자의 발현을 줄이고 항염증인자의 발현을 증가시키는 것으로 확인되었다. The peptides of the present invention were infiltrated into respiratory epithelial cells and then the expression of inflammatory and antiinflammatory factors was confirmed after inflammatory stimulation. As a result, it was confirmed that the modified GPR peptide (Tat-GPR Q34A) reduced the expression of inflammatory factors and increased the expression of anti-inflammatory agents.
도 3은 호흡기 상피 세포에서 염증성 인자 및 항염증 인자의 발현을 나타내는 것이다. 도 3에 도시된 바와 같이, Tat-GPR 펩타이드의 경우 그 농도가 증가할수록 염증성 인자(TNFα, IL-6)의 발현이 증가하는 반면, 항염증 인자(MUC1, TGFβ)의 발현이 감소하는 것으로 나타났다. Tat-GPR Q34A 펩타이드의 경우 농도가 증가할수록 염증성 인자(TNFα, IL-6)의 발현이 감소하는 반면, 항염증 인자(MUC1, TGFβ)의 발현이 증가하는 것으로 나타나, 염증 억제 효과가 있음을 확인하였다.Figure 3 shows the expression of inflammatory and anti-inflammatory factors in respiratory epithelial cells. As shown in FIG. 3, the expression of the anti-inflammatory factor (MUC1, TGFβ) was decreased in the Tat-GPR peptide, while the expression of the inflammatory factor (TNFα, IL-6) . In the case of the Tat-GPR Q34A peptide, the expression of inflammatory factors (TNFα, IL-6) decreased while the expression of anti-inflammatory factors (MUC1, TGFβ) Respectively.
위의 실험을 cell-line 세포주가 아닌 정상 사람 호흡기 상피 세포(normal human bronchial epithelial(NHBE))에서도 진행하였으며, 그 결과가 도 4에 도시되어 있다. 도 4에 도시된 바와 같이, Tat-GPR 펩타이드의 경우 그 농도가 증가할수록 염증성 인자(TNFα, IL-6)의 발현이 증가하는 반면, 항염증 인자(MUC1, TGFβ)의 발현이 감소하였고, Tat-GPR Q34A 펩타이드의 경우 그 농도가 증가할수록 염증성 인자(TNFα, IL-6)의 발현이 감소하는 반면 항염증 인자(MUC1, TGFβ)의 발현이 증가하는 것으로 나타났다. 따라서, 정상 사람 호흡기 상피 세포에서도 동일한 결과가 나옴으로써 특정한 세포가 아닌 호흡기 상피에서 공통으로 증명되는 효과임을 입증하였다.The above experiments were also performed in normal human bronchial epithelial cells (NHBE), not cell-line cell lines, and the results are shown in FIG. As shown in FIG. 4, the expression of the anti-inflammatory factors (MUC1, TGFβ) decreased while the expression of the inflammatory factors (TNFα, IL-6) -GPR Q34A peptide, the expression of inflammatory factors (TNFα, IL-6) decreased and the expression of anti-inflammatory factors (MUC1, TGFβ) increased. Thus, the same results were obtained in normal human respiratory epithelial cells, proving to be a common proven effect in the respiratory epithelium rather than in specific cells.
액틴 중합은 세포의 이동 및 면역에 아주 중대한 기능을 하는 세포의 기능 중 하나이다. CXCR4라는 G-단백질 수용체는 이를 매개하는 수용체이며, 염증 반응 시 많은 염증 세포를 모이게 하여 염증도를 더 중증으로 하여 질환을 더 유발시키는 매개체이기도 하다.Actin polymerization is one of the cell functions that plays a crucial role in cell migration and immunity. The G-protein receptor called CXCR4 is a mediator that mediates the inflammatory reaction, which causes many inflammatory cells to aggregate and cause inflammation more severely, leading to further disease.
본 발명에서는 변형된 GPR 펩타이드(Tat-GPR Q34A)가 CXCR4에 의해 일어나는 액틴 중합을 억제하는지 알아보기 위하여 콜라겐이 코팅된 슬라이드에 2차원, 3차원적으로 액틴 중합을 관찰하였으며, 그 결과가 도 5에 나타나 있다.In the present invention, in order to examine whether the modified GPR peptide (Tat-GPR Q34A) inhibits actin polymerization caused by CXCR4, actin polymerization was observed two-dimensionally and three-dimensionally on a slide coated with collagen, Respectively.
도 5에 나타난 바와 같이, 정상 GPR 펩타이드(Tat-GPR)는 액틴 중합 반응이 활발히 일어나 세포 이동 및 염증도가 높아지나, 변형된 GPR 펩타이드(Tat-GPR Q34A)는 현저히 액틴 중합이 감소한 것을 알 수 있다.As shown in FIG. 5, the actin polymerization activity of the normal GPR peptide (Tat-GPR) was actively increased to increase cell migration and inflammation, but it was found that the modified GPR peptide (Tat-GPR Q34A) have.
이 결과는 염증 미세환경에서 변형된 GPR 펩타이드에 의해 염증도가 감소되기 때문에 액틴 중합이 더 이상 일어나지 않음을 증명한 것이다.These results demonstrate that actin polymerization does not occur any more because inflammation is reduced by modified GPR peptides in the inflammatory microenvironment.
세포에서 일어나는 발견이 실험동물에서 일어나는 현상을 관찰하기 위해 쥐를 대상으로 기관절개술을 이용하여 펩타이드 주입 후 24 시간 뒤 또 다시 기관절개술로 염증자극을 투여하였다(도 6 참고). In order to observe the phenomenon occurring in the cells in the cells, rats were subjected to tracheostomy using inflammatory stimulation by tracheostomy again 24 hours after the injection of the peptide (see FIG. 6).
염증 자극 3일째 되는 날 쥐를 희생시켜 기관지세척액(BAL fluid)과 폐를 염색하여 관찰하였으며, 그 결과가 도 7에 나타나 있다.On the third day of inflammatory stimulation, mice were sacrificed and stained with bronchial washing fluid (BAL fluid) and lungs. The results are shown in FIG.
점액세포만 염색되는 AB-PAS 방법으로 보면, 정상 GPR 펩타이드(Tat-GPR)에 의해 더 많은 점액물질을 분비하는 반면(그림 Ac), 변형된 GPR 펩타이드(Tat-GPR Q34A)에 의해서는 현저히 감소되었음(그림 Ad)을 나타내고 있다.In the AB-PAS method, which only stains mucous cells, it secretes more mucus material by the normal GPR peptide (Tat-GPR) (Figure Ac), but it is significantly reduced by the modified GPR peptide (Tat-GPR Q34A) (Figure Ad).
염증 세포의 집중적으로 모이는 현상을 관찰하는 H&E 염색법에 의해서는, 정상 GPR 펩타이드(Tat-GPR)에 의해 더 많은 염증세포가 집중하는 반면(그림 Bc), 변형된 GPR 펩타이드(Tat-GPR Q34A)에 의해서는 염증 세포의 모집이 현저히 감소됨(그림 Bd)을 나타내고 있다.(T-GPR Q34A) by the H & E staining method, which observes intensive aggregation of inflammatory cells, while more inflammatory cells are concentrated by the normal GPR peptide (Tat-GPR) Suggesting that the recruitment of inflammatory cells is significantly reduced (Figure Bd).
또한 희생된 쥐에서 단백질 분석을 하였으며, 그 결과가 도 8에 도시되어 있다. 도 8에 도시된 바와 같이, 기존의 결과와 동일하게 정상 GPR 펩타이드(Tat-GPR) 농도가 증가할수록 염증성 인자(TNFα, IL-6)의 발현이 증가하는 반면, 항염증 인자(MUC1, TGFβ)의 발현이 감소하는 것을 알 수 있다. 변형된 GPR 펩타이드(Tat-GPR Q34A)는 이와 반대로 농도가 증가할수록 염증성 인자의 발현이 감소하는 반면 항염증 인자의 발현이 증가하는 것으로 나타남으로써, 염증 억제 효과가 있음을 확인할 수 있다. Protein analysis was also performed in the sacrificed rats, and the results are shown in Fig. As shown in FIG. 8, as the concentration of normal GPR peptide (Tat-GPR) increases, the expression of inflammatory factors (TNFα, IL-6) increases, while the anti- inflammatory factors (MUC1, TGFβ) Lt; RTI ID = 0.0 > of < / RTI > In contrast, the modified GPR peptide (Tat-GPR Q34A) showed an anti-inflammatory effect by increasing the expression of anti-inflammatory factors while decreasing the expression of inflammatory factors as the concentration increased.
본 발명에 따라 구성된 펩타이드의 작용효과 및 안정성이 실험을 통하여 입증되었으며, 이에 따라 본 발명을 이용하여 기존의 염증을 억제하는 COX-2 억제제가 아닌 세포 내 신호전달 수용체를 억제시키는 새로운 펩타이드 약물을 개발할 수 있다.The action and stability of the peptides constructed according to the present invention have been demonstrated through experiments and the present invention can be used to develop new peptide drugs that inhibit intracellular signal transduction receptors that are not COX-2 inhibitors that inhibit existing inflammation .
세포에서 일어나는 결과, 정상 호흡기 상피세포에서 일어나는 결과, 실험동물에서 일어나는 결과가 모두 동일하기 때문에, 변형된 GPR 펩타이드(Tat-GPR Q34A)의 효율 및 성능, 생리학적 기능은 대단히 우수한 것으로 판명되었다.The results showed that the GPR peptide (Tat-GPR Q34A) showed very good efficiency, performance, and physiological functions, as the results in cells, the results in normal respiratory epithelial cells, and the results in laboratory animals are all the same.
본 발명은 향후 호흡기에서 염증성 치료제 개발에 기초적인 자료를 제공함으로써 신약 개발 후보 물질을 제공할 수 있다.The present invention can provide candidates for new drug development by providing basic data for the development of inflammatory therapeutic agents in the respiratory tract.
내인성 염증 치료 네트워크에 관한 연구는 난치성 및 만성 염증 질환의 새로운 치료적 대안을 제시할 수 있어 펩타이드에 대한 기대 효과 및 전망이 매우 높은 것으로 기대된다.Studies on endogenous inflammation treatment networks are expected to offer novel therapeutic alternatives for intractable and chronic inflammatory diseases and are expected to have very high expectations and prospects for peptides.
본 발명에서, 실험 동물모델에서 억제 단백질 후보 물질에 관한 특이적 신호 네트워크 차단/억제 및 특이적 항염증 기능과 조절 기전에 대한 체계적이고 통합적/총체적 연구는 창의적이고 기능적 내용임을 알 수 있다.In the present invention, systematic and integrated / integrated studies on the specific signaling network blocking / suppression and specific anti-inflammatory functions and regulatory mechanisms of inhibitory protein candidates in experimental animal models are creative and functional.
본 발명에 의하여, 급성/만성 염증성 질환의 근본적인 진단법 혹은 치료법 개발에 있어 국제적으로 경쟁력 있는 핵심 원천적 기반을 제공할 수 있을 것으로 전망된다.The present invention is expected to provide an internationally competitive core base in the development of a fundamental diagnostic or therapeutic method for acute / chronic inflammatory diseases.
최근 대사 및 염증 질환의 병리 기전을 상호 통합적으로 이해하려는 국제적 연구 흐름에 견주어 볼 때 본 발명에 따른 펩타이드는 매우 선도적/창의적 역할을 담당할 수 있을 것으로 기대된다.Peptides according to the present invention are expected to play a very leading / creative role when compared with the international research flow to understand mutually integrated understanding of the pathology of metabolic and inflammatory diseases in recent years.
유전자 정보를 이용한 진단 키트의 세계시장은 2010년 현재 4조원에 이르고 있으며, 생명공학의 눈부신 발전, 일반인들의 건강에 대한 꾸준한 관심의 증가에 힘입어 앞으로 질병을 조기에 빠르고 정확하게 발견할 수 있는 진단 키트/치료제 관련 기술이 꾸준히 증가할 것으로 전망되어지기 때문에 탁월한 항염증 효과가 있는 본 발명의 펩타이드를 이용한 신약의 제공이 필요할 것으로 보인다.The global market for diagnostic kits using genetic information has reached 4 trillion won as of 2010. Thanks to the remarkable development of biotechnology and the steady interest in the health of the general public, / Therapeutics-related technology is expected to steadily increase, it is necessary to provide a new drug using the peptide of the present invention having excellent anti-inflammatory effect.
이상과 같이 도면과 명세서에서 최적 실시 예가 개시되었다. 여기서 특정한 용어들이 사용되었으나, 이는 단지 본 발명을 설명하기 위한 목적에서 사용된 것이지 의미 한정이나 특허청구범위에 기재된 본 발명의 범위를 제한하기 위하여 사용된 것은 아니다. 그러므로 본 기술 분야의 통상의 지식을 가진 자라면 이로부터 다양한 변형 및 균등한 타 실시 예가 가능하다는 점을 이해할 것이다. 따라서 본 발명의 진정한 기술적 보호 범위는 첨부된 특허청구범위의 기술적 사상에 의해 정해져야 할 것이다.As described above, an optimal embodiment has been disclosed in the drawings and specification. Although specific terms have been employed herein, they are used for purposes of illustration only and are not intended to limit the scope of the invention as defined in the claims or the claims. Therefore, those skilled in the art will appreciate that various modifications and equivalent embodiments are possible without departing from the scope of the present invention. Accordingly, the true scope of the present invention should be determined by the technical idea of the appended claims.
<110> KOSIN UNIVERSITY INDUSTRY-ACADEMY COOPERATION <120> Peptide that significantly reduce airway inflammation and Composition comprising the peptide <130> PN16-0659-KR <140> 10-2017-0012928 <141> 2017-01-26 <160> 2 <170> KoPatentIn 3.0 <210> 1 <211> 40 <212> PRT <213> Artificial Sequence <220> <223> Tat-GPR <400> 1 Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg Pro Pro Thr Met Gly Glu 1 5 10 15 Glu Asp Phe Phe Asp Leu Leu Ala Lys Ser Gln Ser Lys Arg Met Asp 20 25 30 Asp Gln Arg Val Asp Leu Ala Lys 35 40 <210> 2 <211> 40 <212> PRT <213> Artificial Sequence <220> <223> Tat-GPR Q34A <400> 2 Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg Pro Pro Thr Met Gly Glu 1 5 10 15 Glu Asp Phe Phe Asp Leu Leu Ala Lys Ser Gln Ser Lys Arg Met Asp 20 25 30 Asp Ala Arg Val Asp Leu Ala Lys 35 40 <110> KOSIN UNIVERSITY INDUSTRY-ACADEMY COOPERATION <120> Peptide that significantly reduces airway inflammation and Composition comprising the peptide <130> PN16-0659-KR <140> 10-2017-0012928 <141> 2017-01-26 <160> 2 <170> KoPatentin 3.0 <210> 1 <211> 40 <212> PRT <213> Artificial Sequence <220> <223> Tat-GPR <400> 1 Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg Pro Pro Thr Met Gly Glu 1 5 10 15 Glu Asp Phe Phe Asp Leu Leu Ala Lys Ser Gln Ser Lys Arg Met Asp 20 25 30 Asp Gln Arg Val Asp Leu Ala Lys 35 40 <210> 2 <211> 40 <212> PRT <213> Artificial Sequence <220> <223> Tat-GPR Q34A <400> 2 Gly Arg Lys Lys Arg Arg Gln Arg Arg Arg Pro Pro Thr Met Gly Glu 1 5 10 15 Glu Asp Phe Phe Asp Leu Leu Ala Lys Ser Gln Ser Lys Arg Met Asp 20 25 30 Asp Ala Arg Val Asp Leu Ala Lys 35 40
Claims (7)
A Tat sequence is linked to a GPR (G-protein Regulatory) peptide consisting of the amino acid sequence of SEQ ID NO: 1 and Q (glutamine) is converted from DDQR (aspartic acid-glutamine-arginine) in the amino acid sequence of the GPR peptide to A Alanine) as an active ingredient. The composition for preventing and treating respiratory inflammatory diseases according to claim 1,
상기 GPR 펩타이드는, 하기 아미노산 서열(좌측 N-terminal, 우측 C-terminal)을 포함하는 것을 특징으로 하는 호흡기염증질환의 예방 및 치료용 조성물.
GRKKRRQRRRPPTMGEEDFFDLLAKSQSKRMDDARVDLAK
The method according to claim 1,
Wherein the GPR peptide comprises the following amino acid sequence (left N-terminal, right C-terminal).
GRKKRRQRRRPPTMGEEDFFDLLAKSQSKRMDDARVDLAK
상기 GPR 펩타이드는, AGS(Activators of G-protein Signaling)3 단백질에 포함되어 있는 것을 이용한 것을 특징으로 하는 호흡기염증질환의 예방 및 치료용 조성물.
The method according to claim 1,
Wherein the GPR peptide is one contained in an AGS (Activators of G-protein Signaling) 3 protein.
상기 조성물은 염증성 인자의 발현을 감소시키며, 항염증 인자의 발현을 증가시키는 것을 특징으로 하는 호흡기염증질환의 예방 및 치료용 조성물.
The method according to claim 1,
Wherein said composition reduces the expression of inflammatory factors and increases the expression of antiinflammatory agents.
상기 염증성 인자는 TNFα 또는 IL-6인 것을 특징으로 하는 호흡기염증질환의 예방 및 치료용 조성물.
5. The method of claim 4,
Wherein the inflammatory factor is TNF? Or IL-6.
상기 항염증 인자는 MUC1 또는 TGFβ인 것을 특징으로 하는 호흡기염증질환의 예방 및 치료용 조성물.
5. The method of claim 4,
Wherein the anti-inflammatory agent is MUC1 or TGF [beta].
상기 호흡기염증질환은 만성 폐쇄성 질환, 염증성대사 질환, 천식, 비염으로 이루어지는 군으로부터 선택되는 하나 이상의 질환인 것을 특징으로 하는 호흡기염증질환의 예방 및 치료용 조성물.
The method according to any one of claims 1 to 6,
Wherein the respiratory inflammatory disease is at least one disease selected from the group consisting of chronic obstructive diseases, inflammatory metabolic diseases, asthma, rhinitis, and the like.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020170012928A KR101950502B1 (en) | 2017-01-26 | 2017-01-26 | Peptide that significantly reduce airway inflammation and Composition comprising the peptide |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020170012928A KR101950502B1 (en) | 2017-01-26 | 2017-01-26 | Peptide that significantly reduce airway inflammation and Composition comprising the peptide |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20180088566A KR20180088566A (en) | 2018-08-06 |
KR101950502B1 true KR101950502B1 (en) | 2019-02-20 |
Family
ID=63252162
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020170012928A KR101950502B1 (en) | 2017-01-26 | 2017-01-26 | Peptide that significantly reduce airway inflammation and Composition comprising the peptide |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR101950502B1 (en) |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2108960A1 (en) | 2008-04-07 | 2009-10-14 | Arena Pharmaceuticals, Inc. | Methods of using A G protein-coupled receptor to identify peptide YY (PYY) secretagogues and compounds useful in the treatment of conditons modulated by PYY |
-
2017
- 2017-01-26 KR KR1020170012928A patent/KR101950502B1/en active IP Right Grant
Non-Patent Citations (4)
Title |
---|
Behavioural Pharmacology, 2010, Vol. 21, p. 500-513 |
Bioorganic and Medicinal Chemistry, 2014, Vol. 22, p. 3423-3434 |
FEBS Letters, Vol. 580 (2006), p. 1993-1998 |
Neuron, 2004, April 22, Vol. 42(2), p. 269-281* |
Also Published As
Publication number | Publication date |
---|---|
KR20180088566A (en) | 2018-08-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Wagner et al. | Regulation of the expression of the Cl-/anion exchanger pendrin in mouse kidney by acid-base status | |
ES2289778T3 (en) | FUSION PROTEINS OF THE CONSTANT REGION OF THE IMMUNOGLOBULIN / RECEIVER TGF-BETA TYPE II. | |
Nurbaeva et al. | Ca2+ transport and signalling in enamel cells | |
US9907837B2 (en) | Composition for preventing or treating cachexia | |
ES2432225T3 (en) | Reagents and procedures for smooth muscle therapies | |
Poulsen et al. | Luminal and parenteral TFF2 and TFF3 dimer and monomer in two models of experimental colitis in the rat | |
CN106795224A (en) | With the method and composition of Follistatin polypeptide therapeutic illness | |
CN110520108A (en) | For preventing radiation injury and promoting the composition and method of regeneration | |
KR20120082909A (en) | Synthetic myostatin peptide antagonists | |
ES2561437T3 (en) | CCN3 peptides and analogs thereof for therapeutic use | |
ITRM970796A1 (en) | PHARMACEUTICAL COMPOSITIONS INCLUDING PENTRAXIN LONG PTX3 FOR THE THERAPY OF INFECTIOUS, INFLAMMATORY OR CANCER TYPE DISEASES, | |
CN108350032A (en) | Adjust γ C- cytokine activities | |
TW201828973A (en) | Methods for the treatment of fibrotic diseases using interferon-lambda | |
ES2296872T3 (en) | PEPTIDES DERIVED FROM TNF FOR USE IN THE EDEMA TREATMENT. | |
AU2012207301B2 (en) | Apolipoprotein AIV as an antidiabetic peptide | |
US20150299280A1 (en) | Medical treatment use of cell-membrane-permeable fibroblast growth factor | |
ES2395260T3 (en) | CCN3 protein for use in the treatment and diagnosis of kidney diseases | |
AT506150B1 (en) | CYCLIC AND CYSTONE FREE PEPTIDE | |
JP4950903B2 (en) | Use of bombesin / gastrin releasing peptide antagonists for the treatment of inflammatory conditions, acute lung injury and bipolar disorder | |
KR101950502B1 (en) | Peptide that significantly reduce airway inflammation and Composition comprising the peptide | |
CN102037133B (en) | The β thymosin fragments improved | |
ES2569552T3 (en) | MNTF peptide compositions and methods of use | |
CN114853911B (en) | Trefoil factor 2/interferon alpha 2 fusion and application thereof in preventing and treating viral infectious diseases | |
WO2019062325A1 (en) | Polypeptide derived from rps23rg1 and uses thereof | |
WO2002030464A1 (en) | Novel drugs for liver diseases |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E90F | Notification of reason for final refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |