KR101917677B1 - Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer - Google Patents

Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer Download PDF

Info

Publication number
KR101917677B1
KR101917677B1 KR1020170068520A KR20170068520A KR101917677B1 KR 101917677 B1 KR101917677 B1 KR 101917677B1 KR 1020170068520 A KR1020170068520 A KR 1020170068520A KR 20170068520 A KR20170068520 A KR 20170068520A KR 101917677 B1 KR101917677 B1 KR 101917677B1
Authority
KR
South Korea
Prior art keywords
mrs
lung cancer
expression level
prognosis
leu
Prior art date
Application number
KR1020170068520A
Other languages
Korean (ko)
Other versions
KR20170136454A (en
Inventor
이동기
장윤수
김은영
장성일
김성훈
권남훈
Original Assignee
연세대학교 산학협력단
재단법인 의약바이오컨버젼스연구단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 연세대학교 산학협력단, 재단법인 의약바이오컨버젼스연구단 filed Critical 연세대학교 산학협력단
Publication of KR20170136454A publication Critical patent/KR20170136454A/en
Application granted granted Critical
Publication of KR101917677B1 publication Critical patent/KR101917677B1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y601/00Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/0101Methionine-tRNA ligase (6.1.1.10)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57423Specifically defined cancers of lung
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/118Prognosis of disease development
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/9015Ligases (6)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hospice & Palliative Care (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Medicinal Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

본 발명은 폐암의 예후 예측용 바이오 마커로서 메티오닐-티알엔에이 합성효소(MRS)의 유용성에 관한 것으로, 보다 상세하게는 폐암 환자의 예후 예측에 필요한 정보를 제공하기 위한 마커로서 메티오닐-티알엔에이 합성효소(methionyl-tRNA synthetase, MRS) 및 이의 용도에 관한 것이다.
본 발명에 따른 폐암 예후 예측용 마커를 이용하면 예후가 양호하지 않은 환자와 양호한 환자를 정확하면서도 신속하게 구분할 수 있고, 이를 통해 암의 예후를 조기에 판단하여 적절한 치료방법을 선택 및 적용함으로써 환자의 생존율을 높이고 재발율을 낮출 수 있다.
The present invention relates to the utility of methionyl-thiolated-ene synthase (MRS) as a biomarker for predicting the prognosis of lung cancer, and more particularly to the use of methionyl-thi ene synthase (MRS) as a marker for providing information necessary for predicting the prognosis of lung cancer patients. Methionyl-tRNA synthetase (MRS) and uses thereof.
Using the marker for predicting the prognosis of lung cancer according to the present invention, it is possible to accurately and promptly distinguish between patients with poor prognosis and those with good prognosis, thereby promptly determining the prognosis of cancer, The survival rate can be increased and the recurrence rate can be lowered.

Description

폐암의 예후 예측용 바이오 마커로서 메티오닐-티알엔에이 합성효소(MRS)의 유용성{Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer}(MRS) as a prognostic biomarker of lung cancer as a biomarker for predicting the prognosis of lung cancer. The use of methionyl-

본 발명은 폐암의 예후 예측용 바이오 마커로서 메티오닐-티알엔에이 합성효소(MRS)의 유용성에 관한 것으로, 보다 상세하게는 폐암 환자의 예후 예측에 필요한 정보를 제공하기 위한 마커로서 메티오닐-티알엔에이 합성효소(methionyl-tRNA synthetase, MRS) 및 이의 용도에 관한 것이다. The present invention relates to the utility of methionyl-thiolated-ene synthase (MRS) as a biomarker for predicting the prognosis of lung cancer, and more particularly to the use of methionyl-thi ene synthase (MRS) as a marker for providing information necessary for predicting the prognosis of lung cancer patients. Methionyl-tRNA synthetase (MRS) and uses thereof.

우리나라에서 2015년에 암으로 사망한 사람은 총 76,855명으로 전체 사망자의 27.9%가 암으로 사망하고 있다 (조사망률: 10만명당 150.8명). 암 사망순위는 폐암, 간암, 위암, 대장암 및 췌장암 순으로, 이들 5대 암에 의한 사망이 전체 암 사망의 약 66.4%를 차지하고 있다. 또한 남성에 있어 주요 암 사망원인은 폐암, 간암, 위암, 및 대장암 등으로 이들 4대 암에 의한 사망자 수(31,297명)가 전체 남성 암 사망자 수(47,678명)의 65.6%를 차지하고 있으며, 여성에 있어 주요 암 사망원인은 폐암, 대장암, 위암, 간암, 및 췌장암 등의 순으로 이들 5대 암에 의한 사망자 수(16,850명)가 전체 여성 암 사망자 수(29,177명)의 57.8%를 차지하고 있다(국가암정보센터: http://www.cancer.go.kr/mbs/cancer/subview.jsp?id=cancer_040202000000).A total of 76,855 people died of cancer in Korea in 2015, with 27.9% of all deaths due to cancer (150.8 deaths per 100,000 people). Cancer death rankings are lung cancer, liver cancer, stomach cancer, colorectal cancer and pancreatic cancer in descending order, and these five cancer deaths account for about 66.4% of all cancer deaths. The major causes of cancer death in males are lung cancer, liver cancer, gastric cancer, and colorectal cancer. The number of deaths from these four types of cancer (31,297) accounted for 65.6% of all male cancer deaths (47,678) The major causes of cancer deaths were lung cancer, colon cancer, stomach cancer, liver cancer, and pancreatic cancer, which accounted for 57.8% of all female cancer deaths (16,850 deaths) (National Cancer Information Center: http://www.cancer.go.kr/mbs/cancer/subview.jsp?id=cancer_040202000000 ).

폐암은 전 세계적으로 암으로 인한 사망 원인의 20∼30%를 차지하고 있어 암으로 인한 사망의 주요 원인 중의 하나이다. 이 중 전체 폐암의 80% 이상이 비소세포폐암 (non-small cell lung cancer, NSCLC)이며, 국내 보고에 의해면 2010-2014년에 발생한 폐암 환자의 5년 상대생존율은 25.1% 에 불과하다. 폐암의 높은 사망률은 절제 불가능한 상태로 발견되는 환자의 비율이 높은 것과 관련되어 있다 (Parkin DM, Bray F, Ferlay J, et al. CA Cancer J Clin 55:74-108, 2005). 또한 절제 가능한 병기의 비소세포폐암 환자 중에서도 외과적으로 절제한 환자의 상당수가 암의 재발로 사망하고 있음이 보고되고 있다 (Arriagada R, Bergman B, Dunant A, et al: Cisplatin-based adjuvant chemotherapy for completely resected non-small-cell lung cancer. N Engl J Med 350:351-60, 2004). 따라서 폐암 환자들에 대한 예후 인자를 이용할 경우, 예후의 예측과 함께 재발의 조기발견을 위한 검사 및 치료법의 선발 및 평가를 위한 수단을 치료를 최적화 할 수 있어 폐암 환자의 맞춤 치료가 가능할 것으로 기대되고 있다. 이에, 폐암 환자의 예후를 예측할 수 있는 분자 마커를 동정하기 위한 집중적인 연구가 국내외적으로 현재 실시되고 있으나, 아직까지 뚜렷한 연구 결과가 없는 실정이다.Lung cancer is one of the leading causes of cancer deaths, accounting for 20-30% of all deaths caused by cancer worldwide. Of these, more than 80% of all lung cancers are non-small cell lung cancer (NSCLC), and the five-year relative survival rate of lung cancer patients in 2010-2014 was only 25.1%. The high mortality rate of lung cancer has been associated with a high proportion of patients found to be in an incontractable state (Parkin DM, Bray F, Ferlay J, et al. CA Cancer J Clin 55: 74-108, 2005). In addition, a large number of surgically resected patients with non-small cell lung cancer who have a resectable stage have been reported to have died from cancer recurrence (Arriagada R, Bergman B, Dunant A, et al .: Cisplatin-based adjuvant chemotherapy for completely N Engl J Med 350: 351-60, 2004). Therefore, when prognostic factors for lung cancer patients are used, tailor-made treatment for lung cancer patients is expected to be possible by optimizing the treatment for predicting prognosis and for selecting and evaluating tests and treatments for early detection of recurrence have. Therefore, intensive studies to identify molecular markers that can predict the prognosis of lung cancer patients have been carried out domestically and internationally, but no studies have been made yet.

이에 본 발명자들은 폐암의 예후를 예측하기 위한 바이오마커를 찾기 위해 노력을 기울인 결과, 폐암 환자의 암조직에서 MRS가 과발현되어 있으며, MRS의 발현 정도를 분석함으로써 폐암 환자의 예후를 보다 정확하게 예측할 수 있음을 확인하고 본 발명을 완성하게 되었다. Therefore, the present inventors have made efforts to find a biomarker for predicting the prognosis of lung cancer. As a result, MRS is overexpressed in the cancer tissue of lung cancer patients and the prognosis of lung cancer patients can be more accurately predicted by analyzing the expression level of MRS And completed the present invention.

따라서, 본 발명의 목적은 폐암 환자의 예후 예측에 필요한 정보를 제공하기 위하여, 환자의 시료로부터 메티오닐-티알엔에이 합성효소 (methionyl-tRNA synthetase, MRS)를 검출하는 방법을 제공하는 것이다. Accordingly, an object of the present invention is to provide a method for detecting methionyl-tRNA synthetase (MRS) from a patient's sample in order to provide information necessary for predicting the prognosis of lung cancer patients.

본 발명의 다른 목적은 MRS의 mRNA 또는 단백질의 발현수준을 측정하는 제제를 포함하는, 폐암의 예후 예측용 조성물을 제공하는 것이다. Another object of the present invention is to provide a composition for predicting the prognosis of lung cancer, which comprises an agent for measuring the expression level of mRNA or protein of MRS.

본 발명의 다른 목적은 폐암의 예후 예측용 조성물을 포함하는 폐암 예후 예측용 키트를 제공하는 것이다. Another object of the present invention is to provide a kit for predicting the prognosis of lung cancer, which comprises a composition for predicting the prognosis of lung cancer.

본 발명의 다른 목적은 (a) 환자로부터 시료를 제공하는 단계; (b) 상기 시료에서 MRS의 mRNA 발현수준 또는 단백질의 발현 수준을 측정하는 단계; 및 (c) 상기 MRS의 mRNA 발현수준 또는 단백질의 발현수준을 정상 대조구 시료의 MRS mRNA의 발현수준 또는 단백질 발현수준과 비교하여 발현수준이 증가한 피검체를 가진 폐암환자에서 예후가 좋지 않음을 판정하는 단계를 포함하는, 폐암 예후 예측용 마커를 검출하는 방법을 제공하는 것이다. Another object of the present invention is to provide a method of treating a patient, comprising: (a) providing a sample from a patient; (b) measuring mRNA expression level or protein expression level of MRS in said sample; And (c) comparing the mRNA expression level or the protein expression level of the MRS with the MRS mRNA expression level or protein expression level of the normal control sample to determine that the prognosis is poor in a patient with lung cancer whose expression level is increased A marker for predicting lung cancer prognosis.

상기한 본 발명의 목적을 달성하기 위하여 본 발명은 폐암 환자의 예후 예측에 필요한 정보를 제공하기 위하여, 환자의 시료로부터 메티오닐-티알엔에이 합성효소(methionyl-tRNA synthetase, MRS)를 검출하는 방법을 제공한다. In order to accomplish the above object, the present invention provides a method for detecting methionyl-tRNA synthetase (MRS) from a sample of a patient to provide information necessary for predicting the prognosis of a patient suffering from lung cancer .

본 발명의 다른 목적을 달성하기 위하여 본 발명은 MRS의 mRNA 또는 단백질의 발현수준을 측정하는 제제를 포함하는, 폐암의 예후 예측용 조성물을 제공한다. According to another aspect of the present invention, there is provided a composition for predicting the prognosis of lung cancer, which comprises an agent for measuring an expression level of MRS mRNA or protein.

본 발명의 다른 목적을 달성하기 위하여 본 발명은 폐암의 예후 예측용 조성물을 포함하는 폐암의 예후 예측용 키트를 제공한다. Another aspect of the present invention provides a kit for predicting the prognosis of lung cancer comprising a composition for predicting the prognosis of lung cancer.

본 발명의 다른 목적을 달성하기 위하여 본 발명은 (a) 환자로부터 시료를 제공하는 단계; (b) 상기 시료에서 MRS의 mRNA 발현수준 또는 단백질의 발현 수준을 측정하는 단계; 및 (c) 상기 MRS의 mRNA 발현수준 또는 단백질의 발현수준을 정상 대조구 시료의 MRS mRNA의 발현수준 또는 단백질 발현수준과 비교하여 발현수준이 증가한 피검체를 폐암에서 예후가 좋지 않은 것으로 판정하는 단계를 포함하는, 폐암 예후 예측용 마커를 검출하는 방법을 제공한다.In order to accomplish another object of the present invention, the present invention provides a method comprising: (a) providing a sample from a patient; (b) measuring mRNA expression level or protein expression level of MRS in said sample; And (c) comparing the mRNA expression level or the protein expression level of the MRS with the MRS mRNA expression level or the protein expression level of the normal control sample to determine that the subject having the increased expression level has poor prognosis in lung cancer A marker for predicting lung cancer prognosis.

이하 본 발명에 대해 상세히 설명한다. Hereinafter, the present invention will be described in detail.

본 발명은 폐암 환자의 예후 예측에 필요한 정보를 제공하기 위하여, 환자의 시료로부터 메티오닐-티알엔에이 합성효소(methionyl-tRNA synthetase, MRS)를 검출하는 방법을 제공한다.The present invention provides a method for detecting methionyl-tRNA synthetase (MRS) from a sample of a patient to provide information necessary for predicting the prognosis of a patient suffering from lung cancer.

본 발명에서 상기 ‘MRS(methionyl-tRNA synthetase)’는 메치오닌 아미노산을 tRNA에 연결시키는 역할을 하는 메치오닐 티알엔에이 중합효소를 의미한다. 인간에서는 MARS 유전자에 암호화되어 있으며, MRS의 서열 정보는 NM_004990(mRNA), NP_004981.2, P56192.2(단백질) 등의 Genbank accession number로 공지되어 있으며, 바람직하게는 서열번호 1로 표시되는 인간의 MRS 단백질 아미노산 서열을 포함하는 것일 수 있다.In the present invention, 'MRS (methionyl-tRNA synthetase)' refers to a methionyl-tRNA synthetase which functions to link a methionine amino acid to a tRNA. In humans, it is encoded in MARS gene, and the sequence information of MRS is known as Genbank accession number such as NM_004990 (mRNA), NP_004981.2, P56192.2 (protein), and preferably, MRS < / RTI > protein amino acid sequence.

<서열번호 1>&Lt; SEQ ID NO.

MRLFVSDGVPGCLPVLAAAG RARGRAEVLISTVGPEDCVV PFLTRPKVPVLQLDSGNYLF STSAICRYFFLLSGWEQDDL TNQWLEWEATELQPALSAAL YYLVVQGKKGEDVLGSVRRA LTHIDHSLSRQNCPFLAGET ESLADIVLWGALYPLLQDPA YLPEELSALHSWFQTLSTQE PCQRAAETVLKQQGVLALRP YLQKQPQPSPAEGRAVTNEP EEEELATLSEEEIAMAVTAW EKGLESLPPLRPQQNPVLPV AGERNVLITSALPYVNNVPH LGNIIGCVLSADVFARYSRL RQWNTLYLCGTDEYGTATET KALEEGLTPQEICDKYHIIH ADIYRWFNISFDIFGRTTTP QQTKITQDIFQQLLKRGFVL QDTVEQLRCEHCARFLADRF VEGVCPFCGYEEARGDQCDK CGKLINAVELKKPQCKVCRS CPVVQSSQHLFLDLPKLEKR LEEWLGRTLPGSDWTPNAQF ITRSWLRDGLKPRCITRDLK WGTPVPLEGFEDKVFYVWFD ATIGYLSITANYTDQWERWW KNPEQVDLYQFMAKDNVPFH SLVFPCSALGAEDNYTLVSH LIATEYLNYEDGKFSKSRGV GVFGDMAQDTGIPADIWRFY LLYIRPEGQDSAFSWTDLLL KNNSELLNNLGNFINRAGMF VSKFFGGYVPEMVLTPDDQR LLAHVTLELQHYHQLLEKVR IRDALRSILTISRHGNQYIQ VNEPWKRIKGSEADRQRAGT VTGLAVNIAALLSVMLQPYM PTVSATIQAQLQLPPPACSI LLTNFLCTLPAGHQIGTVSP LFQKLENDQIESLRQRFGGG QAKTSPKPAVVETVTTAKPQ QIQALMDEVTKQGNIVRELK AQKADKNEVAAEVAKLLDLK KQLAVAEGKPPEAPKGKKKKMRLFVSDGVPGCLPVLAAAG RARGRAEVLISTVGPEDCVV PFLTRPKVPVLQLDSGNYLF STSAICRYFFLLSGWEQDDL TNQWLEWEATELQPALSAAL YYLVVQGKKGEDVLGSVRRA LTHIDHSLSRQNCPFLAGET ESLADIVLWGALYPLLQDPA YLPEELSALHSWFQTLSTQE PCQRAAETVLKQQGVLALRP YLQKQPQPSPAEGRAVTNEP EEEELATLSEEEIAMAVTAW EKGLESLPPLRPQQNPVLPV AGERNVLITSALPYVNNVPH LGNIIGCVLSADVFARYSRL RQWNTLYLCGTDEYGTATET KALEEGLTPQEICDKYHIIH ADIYRWFNISFDIFGRTTTP QQTKITQDIFQQLLKRGFVL QDTVEQLRCEHCARFLADRF VEGVCPFCGYEEARGDQCDK CGKLINAVELKKPQCKVCRS CPVVQSSQHLFLDLPKLEKR LEEWLGRTLPGSDWTPNAQF ITRSWLRDGLKPRCITRDLK WGTPVPLEGFEDKVFYVWFD ATIGYLSITANYTDQWERWW KNPEQVDLYQFMAKDNVPFH SLVFPCSALGAEDNYTLVSH LIATEYLNYEDGKFSKSRGV GVFGDMAQDTGIPADIWRFY LLYIRPEGQDSAFSWTDLLL KNNSELLNNLGNFINRAGMF VSKFFGGYVPEMVLTPDDQR LLAHVTLELQHYHQLLEKVR IRDALRSILTISRHGNQYIQ VNEPWKRIKGSEADRQRAGT VTGLAVNIAALLSVMLQPYM PTVSATIQAQLQLPPPACSI LLTNFLCTLPAGHQIGTVSP LFQKLENDQIESLRQRFGGG QAKTSPKPAVVETVTTAKPQ QIQALMDEVTKQGNIVRELK AQKADKNEVAAEVAKLLDLK KQLAVAEGKPPEAPKGKKKK

상기 MRS와 종양과의 상관관계에 대하여, 대장암에서 MRS의 촉매로서의 활성이 매우 증진되어 있음이 보고된 바 있으며(Proc. Soc. Exp. Biol. Med. 153,273276 (1976), MRS의 기질인 tRNAi Met의 지속적인 과발현이 종양성 전환을 유도할 수 있음이 보고된 바 있으며(Cell 133, 7889, (2008), 악성 섬유성 조직구종, 육종(sarcoma), 악성 신경교종, 교모세포종(glioblastoma)등의 암에서 MRS가 과발현되어 있다는 것이 보고된 바 있으나(Cancer Genet. Cytogenet. 78, 165171 (1994), Cancer Genet Cytogenet. 83, 3236 (1995), Cancer Genet. Cytogenet. 95, 141147 (1997), Cancer Res. 56, 51415145 (1996).), MRS의 발현양상이 폐암 환자의 예후와 밀접하게 관련이 되어 있다는 것에 대해서는 본 발명자가 최초로 공개하는 바이다. It has been reported that the activity of MRS as a catalyst in colorectal cancer is greatly enhanced with respect to the correlation between the MRS and the tumor (Proc. Soc. Exp. Biol. Med. 153,273276 (1976) (1983) reported that the overexpression of tRNA i Met induces tumorigenic transformation (Cell 133, 7889, (2008)), malignant fibrous histiocytoma, sarcoma, malignant glioma, glioblastoma (Cancer Genet. Cytogenet., 78, 165171 (1994), Cancer Genet Cytogenet., 83, 3236 (1995), Cancer Genet., Cytogenet. 95, 141147 (1997) , Cancer Res. 56, 51415145 (1996)), the inventors of the present invention first disclose that the expression pattern of MRS is closely related to the prognosis of lung cancer patients.

본 발명자들은 MRS가 폐암 환자의 암조직에 과발현되어 있다는 것을 확인하였으며, MRS의 과발현 여부가 폐암 환자의 예후와 밀접하게 관련이 되어 있다는 것을 확인하였다. The present inventors confirmed that MRS is overexpressed in cancer tissues of lung cancer patients and confirmed that the overexpression of MRS is closely related to the prognosis of lung cancer patients.

본 발명에서 “예후(prognosis)”는 질병을 진단하여 판단된 장래의 증세 또는 경과에 대한 전망을 말한다. 암 환자에 있어서 예후는 통상적으로 암 발병 또는 외과적 시술 후 일정기간 내의 전이 여부 또는 생존기간을 뜻한다. 예후의 예측 (또는 예후의 진단)은 특히 폐암 환자의 화학치료 여부를 비롯하여 향후 치료의 방향에 대한 단서를 제시하므로 매우 중요한 임상적 과제이다. 예후 예측은 질환 치료제에 대한 환자의 반응, 치료 경과에 대한 예측도 포함한다. 바람직하게는, 본 발명에서 상기 예후란 총생존율(overall survival) 또는 무병생존율(disease free survival rate)를 의미하는 것일 수 있으나 이에 제한되는 것은 아니다. In the present invention, &quot; prognosis &quot; refers to a prospect of future symptoms or progress judged by diagnosing a disease. Prognosis in cancer patients usually refers to the time of metastasis or survival within a period of time after cancer or surgery. Prediction of prognosis (or diagnosis of prognosis) is a very important clinical task, especially because it provides clues to the direction of future treatment including chemotherapy of lung cancer patients. Predictive prognosis also includes the patient's response to the disease treatment and the prediction of the course of treatment. Preferably, in the present invention, the prognosis may be, but is not limited to, an overall survival or a disease free survival rate.

본 발명에서 상기 시료는 폐암 환자의 암 조직일 수 있다. 상기 암 조직에는 일부 정상 세포도 포함되어 있을 수 있으며, 바람직하게는 환자의 암세포를 포함하는 조직의 포르말린 고정 파라핀 포매 (formalinfixedparaffin-embedded, FFPE) 시료일 수 있다.In the present invention, the sample may be a cancerous tissue of a lung cancer patient. The cancer tissue may also include some normal cells, and may be formalin fixed paraffin-embedded (FFPE) samples of tissues, preferably including cancer cells of a patient.

본 발명에서 상기 MRS의 검출은 MRS 유전자의 mRNA 또는 단백질의 발현수준을 측정하는 것을 특징으로 할 수 있다. In the present invention, the detection of the MRS may be characterized by measuring the mRNA or protein expression level of the MRS gene.

본 발명에서 상기 '발현(expression)'은 세포에서 단백질 또는 핵산이 생성되는 것을 의미한다. '단백질'은 '폴리펩타이드(polypeptide)' 또는 '펩타이드(peptide)'와 호환성 있게 사용되며, 예컨대, 자연 상태의 단백질에서 일반적으로 발견되는 바와 같이 아미노산 잔기의 중합체를 말한다. '폴리뉴클레오티드(polynucleotide)' 또는 '핵산'은 단일-또는 이중-가닥의 형태로 된 데옥시리보뉴클레오티드(DNA) 또는 리보뉴클레오티드(RNA)를 말한다. 다른 제한이 없는 한, 자연적으로 생성되는 뉴클레오티드와 비슷한 방법으로 핵산에 혼성화되는 자연적 뉴클레오티드의 공지된 아날로그도 포함된다. 'mRNA'는 단백질 합성 과정에서 특정 유전자로부터 아미노산 서열을 특정하게 되는 리보솜으로 유전 정보(유전자 특이적 염기 서열)를 전달하는 RNA이다. In the present invention, the term 'expression' means that a protein or a nucleic acid is produced in a cell. "Protein" is used interchangeably with "polypeptide" or "peptide" and refers to a polymer of amino acid residues as commonly found in natural state proteins. A "polynucleotide" or "nucleic acid" refers to deoxyribonucleotides (DNA) or ribonucleotides (RNA) in the form of single- or double-stranded. Unless otherwise constrained, also includes known analogs of natural nucleotides that hybridize to nucleic acids in a manner similar to naturally occurring nucleotides. 'mRNA' is RNA that transfers genetic information (gene-specific nucleotide sequence) to a ribosome in which amino acid sequence is specified from a specific gene during protein synthesis.

한편 본 발명의 진단용 조성물이 mRNA의 발현 수준을 측정하기 위한 것일 때에는 mRNA 발현 수준을 측정하는 제제는 MRS의 mRNA에 특이적으로 결합하는 프로브 또는 프라이머 세트일 수 있다. Meanwhile, when the diagnostic composition of the present invention is for measuring the expression level of mRNA, the agent for measuring mRNA expression level may be a probe or a primer set that specifically binds to mRNA of MRS.

상기 MRS의 mRNA는 인간을 포함하는 포유류에서 유래한 것일 수 있으며, 바람직하게는 상기 MRS의 mRNA는 서열번호 2 로 표시되는 염기 서열을 포함하는 것일 수 있다. 상기 MRS의 mRNA 특이적인 프로브 또는 프라이머 세트를 포함하는 본 발명의 진단용 조성물은 공지된 RNA를 감지하는 방법에 필요한 제제를 추가로 포함할 수 있다. 본 조성물을 이용하여 공지된 RNA를 감지하는 방법을 제한없이 사용하여 피검체에서 상기 마커들의 mRNA의 수준을 측정할 수 있다. The mRNA of the MRS may be derived from a mammal including a human, and preferably the mRNA of the MRS may include the nucleotide sequence of SEQ ID NO: 2. The diagnostic composition of the present invention comprising the mRNA-specific probe or primer set of the MRS may further comprise a preparation necessary for a method for detecting known RNA. Methods for detecting known RNA using this composition can be used without limitation to determine the level of mRNA of the markers in a subject.

<서열번호 2> &Lt; SEQ ID NO: 2 &

1 aaatagtcta ctttccggta gcggtgccag ggcagtggcc taatacggaa ctccatttcc1 aaatagtcta ctttccggta gcggtgccag ggcagtggcc taatacggaa ctccatttcc

61 cggcgtgcct cgcggaggcc gctgaactca gaagcgggag gccggttccg gttgcatcag61 cggcgtgcct cgcggaggcc gctgaactca gaagcgggag gccggttccg gttgcatcag

121 cgagggattc acggcgaaat gagactgttc gtgagtgatg gcgtcccggg ttgcttgccg121 cgagggattc acggcgaaat gagactgttc gtgagtgatg gcgtcccggg ttgcttgccg

181 gtgctggccg ccgccgggag agcccggggc agagcagagg tgctcatcag cactgtaggc181 gtgctggccg ccgccgggag agcccggggc agagcagagg tgctcatcag cactgtaggc

241 ccggaagatt gtgtggtccc gttcctgacc cggcctaagg tccctgtctt gcagctggat241 ccggaagatt gtgtggtccc gttcctgacc cggcctaagg tccctgtctt gcagctggat

301 agcggcaact acctcttctc cactagtgca atctgccgat attttttttt gttatctggc301 agcggcaact acctcttctc cactagtgca atctgccgat attttttttt gttatctggc

361 tgggagcaag atgacctcac taaccagtgg ctggaatggg aagcgacaga gctgcagcca361 tgggagcaag atgacctcac taaccagtgg ctggaatggg aagcgacaga gctgcagcca

421 gctttgtctg ctgccctgta ctatttagtg gtccaaggca agaaggggga agatgttctt421 gctttgtctg ctgccctgta ctatttagtg gtccaaggca agaaggggga agatgttctt

481 ggttcagtgc ggagagccct gactcacatt gaccacagct tgagtcgtca gaactgtcct481 ggttcagtgc ggagagccct gactcacatt gaccacagct tgagtcgtca gaactgtcct

541 ttcctggctg gggagacaga atctctagcc gacattgttt tgtggggagc cctataccca541 ttcctggctg gggagacaga atctctagcc gacattgttt tgtggggagc cctataccca

601 ttactgcaag atcccgccta cctccctgag gagctgagtg ccctgcacag ctggttccag601 ttactgcaag atcccgccta cctccctgag gagctgagtg ccctgcacag ctggttccag

661 acactgagta cccaggaacc atgtcagcga gctgcagaga ctgtactgaa acagcaaggt661 acactgagta cccaggaacc atgtcagcga gctgcagaga ctgtactgaa acagcaaggt

721 gtcctggctc tccggcctta cctccaaaag cagccccagc ccagccccgc tgagggaagg721 gtcctggctc tccggcctta cctccaaaag cagccccagc ccagccccgc tgagggaagg

781 gctgtcacca atgagcctga ggaggaggag ctggctaccc tatctgagga ggagattgct781 gctgtcacca atgagcctga ggaggaggag ctggctaccc tatctgagga ggagattgct

841 atggctgtta ctgcttggga gaagggccta gaaagtttgc ccccgctgcg gccccagcag841 atggctgtta ctgcttggga gaagggccta gaaagtttgc ccccgctgcg gccccagcag

901 aatccagtgt tgcctgtggc tggagaaagg aatgtgctca tcaccagtgc cctcccttac901 aatccagtgt tgcctgtggc tggagaaagg aatgtgctca tcaccagtgc cctcccttac

961 gtcaacaatg tcccccacct tgggaacatc attggttgtg tgctcagtgc cgatgtcttt961 gtcaacaatg tcccccacct tgggaacatc attggttgtg tgctcagtgc cgatgtcttt

1021 gccaggtact ctcgcctccg ccagtggaac accctctatc tgtgtgggac agatgagtat1021 gccaggtact ctcgcctccg ccagtggaac accctctatc tgtgtgggac agatgagtat

1081 ggtacagcaa cagagaccaa ggctctggag gagggactaa ccccccagga gatctgcgac1081 ggtacagcaa cagagaccaa ggctctggag gagggactaa ccccccagga gatctgcgac

1141 aagtaccaca tcatccatgc tgacatctac cgctggttta acatttcgtt tgatattttt1141 aagtaccaca tcatccatgc tgacatctac cgctggttta acatttcgtt tgatattttt

1201 ggtcgcacca ccactccaca gcagaccaaa atcacccagg acattttcca gcagttgctg1201 ggtcgcacca ccactccaca gcagaccaaa atcacccagg acattttcca gcagttgctg

1261 aaacgaggtt ttgtgctgca agatactgtg gagcaactgc gatgtgagca ctgtgctcgc1261 aaacgaggtt ttgtgctgca agatactgtg gagcaactgc gatgtgagca ctgtgctcgc

1321 ttcctggctg accgcttcgt ggagggcgtg tgtcccttct gtggctatga ggaggctcgg1321 ttcctggctg accgcttcgt ggagggcgtg tgtcccttct gtggctatga ggaggctcgg

1381 ggtgaccagt gtgacaagtg tggcaagctc atcaatgctg tcgagcttaa gaagcctcag1381 ggtgaccagt gtgacaagtg tggcaagctc atcaatgctg tcgagcttaa gaagcctcag

1441 tgtaaagtct gccgatcatg ccctgtggtg cagtcgagcc agcacctgtt tctggacctg1441 tgtaaagtct gccgatcatg ccctgtggtg cagtcgagcc agcacctgtt tctggacctg

1501 cctaagctgg agaagcgact ggaggagtgg ttggggagga cattgcctgg cagtgactgg1501 cctaagctgg agaagcgact ggaggagtgg ttggggagga cattgcctgg cagtgactgg

1561 acacccaatg cccagtttat cacccgttct tggcttcggg atggcctcaa gccacgctgc1561 acacccaatg cccagtttat cacccgttct tggcttcggg atggcctcaa gccacgctgc

1621 ataacccgag acctcaaatg gggaacccct gtacccttag aaggttttga agacaaggta1621 ataacccgag acctcaaatg gggaacccct gtacccttag aaggttttga agacaaggta

1681 ttctatgtct ggtttgatgc cactattggc tatctgtcca tcacagccaa ctacacagac1681 ttctatgtct ggtttgatgc cactattggc tatctgtcca tcacagccaa ctacacagac

1741 cagtgggaga gatggtggaa gaacccagag caagtggacc tgtatcagtt catggccaaa1741 cagtgggaga gatggtggaa gaacccagag caagtggacc tgtatcagtt catggccaaa

1801 gacaatgttc ctttccatag cttagtcttt ccttgctcag ccctaggagc tgaggataac1801 gacaatgttc ctttccatag cttagtcttt ccttgctcag ccctaggagc tgaggataac

1861 tataccttgg tcagccacct cattgctaca gagtacctga actatgagga tgggaaattc1861 tataccttgg tcagccacct cattgctaca gagtacctga actatgagga tgggaaattc

1921 tctaagagcc gcggtgtggg agtgtttggg gacatggccc aggacacggg gatccctgct1921 tctaagagcc gcggtgtggg agtgtttggg gacatggccc aggacacggg gatccctgct

1981 gacatctggc gcttctatct gctgtacatt cggcctgagg gccaggacag tgctttctcc1981 gacatctggc gcttctatct gctgtacatt cggcctgagg gccaggacag tgctttctcc

2041 tggacggacc tgctgctgaa gaataattct gagctgctta acaacctggg caacttcatc2041 tggacggacc tgctgctgaa gaataattct gagctgctta acaacctggg caacttcatc

2101 aacagagctg ggatgtttgt gtctaagttc tttgggggct atgtgcctga gatggtgctc2101 aacagagctg ggatgtttgt gtctaagttc tttgggggct atgtgcctga gatggtgctc

2161 acccctgatg atcagcgcct gctggcccat gtcaccctgg agctccagca ctatcaccag2161 acccctgatg atcagcgcct gctggcccat gtcaccctgg agctccagca ctatcaccag

2221 ctacttgaga aggttcggat ccgggatgcc ttgcgcagta tcctcaccat atctcgacat2221 ctacttgaga aggttcggat ccgggatgcc ttgcgcagta tcctcaccat atctcgacat

2281 ggcaaccaat atattcaggt gaatgagccc tggaagcgga ttaaaggcag tgaggctgac2281 ggcaaccaat atattcaggt gaatgagccc tggaagcgga ttaaaggcag tgaggctgac

2341 aggcaacggg caggaacagt gactggcttg gcagtgaata tagctgcctt gctctctgtc2341 aggcaacggg caggaacagt gactggcttg gcagtgaata tagctgcctt gctctctgtc

2401 atgcttcagc cttacatgcc cacggttagt gccacaatcc aggcccagct gcagctccca2401 atgcttcagc cttacatgcc cacggttagt gccacaatcc aggcccagct gcagctccca

2461 cctccagcct gcagtatcct gctgacaaac ttcctgtgta ccttaccagc aggacaccag2461 cctccagcct gcagtatcct gctgacaaac ttcctgtgta ccttaccagc aggacaccag

2521 attggcacag tcagtccctt gttccaaaaa ttggaaaatg accagattga aagtttaagg2521 attggcacag tcagtccctt gttccaaaaa ttggaaaatg accagattga aagtttaagg

2581 cagcgctttg gagggggcca ggcaaaaacg tccccgaagc cagcagttgt agagactgtt2581 cagcgctttg gagggggcca ggcaaaaacg tccccgaagc cagcagttgt agagactgtt

2641 acaacagcca agccacagca gatacaagcg ctgatggatg aagtgacaaa acaaggaaac2641 acaacagcca agccacagca gatacaagcg ctgatggatg aagtgacaaa acaaggaaac

2701 attgtccgag aactgaaagc acaaaaggca gacaagaacg aggttgctgc ggaggtggcg2701 attgtccgag aactgaaagc acaaaaggca gacaagaacg aggttgctgc ggaggtggcg

2761 aaactcttgg atctaaagaa acagttggct gtagctgagg ggaaaccccc tgaagcccct2761 aaactcttgg atctaaagaa acagttggct gtagctgagg ggaaaccccc tgaagcccct

2821 aaaggcaaga agaaaaagta aaagaccttg gctcatagaa agtcacttta atagataggg2821 aaaggcaaga agaaaaagta aaagaccttg gctcatagaa agtcacttta atagataggg

2881 acagtaataa ataaatgtac aatctctata tacaaaaaaa aaaaaaaaaa aa//2881 acagtaataa ataaatgtac aatctctata tacaaaaaaa aaaaaaaaaa aa //

'프라이머(primer)'는 DNA 합성의 개시점(starting point)으로 작용하는 짧은 단일가닥 올리고뉴클레오티드(single strand oligonucleotide)이다. 프라이머는 적합한 완충액(buffer)와 온도 조건에서 주형(template)인 폴리뉴클레오티드에 특이적으로 결합하고, DNA 중합효소가 프라이머에 주형 DNA에 상보적인 염기를 갖는 뉴클레오사이드 트리포스페이트를 추가하여 연결함으로써 DNA가 합성된다. 프라이머는 일반적으로 15 내지 30개의 염기서열로 이루어져 있으며, 염기 구성과 길이에 따라 주형 가닥에 결합하는 온도(melting temperature, Tm)가 달라진다.A 'primer' is a short single strand oligonucleotide that serves as a starting point for DNA synthesis. The primer specifically binds to a polynucleotide which is a template under a temperature condition with a suitable buffer, and a DNA polymerase is added to the primer by addition of a nucleoside triphosphate having a base complementary to the template DNA, Is synthesized. The primer generally consists of 15 to 30 nucleotide sequences, and the melting temperature (T m ) varies depending on the base structure and length.

프라이머의 서열은 주형의 일부 염기 서열과 완전하게 상보적인 서열을 가질 필요는 없으며, 주형과 혼성화되어 프라이머 고유의 작용을 할 수 있는 범위 내에서의 충분한 상보성을 가지면 충분하다. 따라서 본 발명에서 상기 마커의 mRNA의 발현 수준을 측정하기 위한 프라이머는 각 유전자 서열에 완벽하게 상보적인 서열을 가질 필요는 없으며, DNA 합성을 통해 mRNA 또는 cDNA의 특정 구간을 증폭하여 mRNA의 양을 측정하려는 목적에 맞는 길이와 상보성을 갖는 것이면 충분하다. 상기 증폭 반응을 위한 프라이머는 증폭하고자 하는 mRNA의 특정 구간의 양쪽 끝부분의 주형(또는 센스, sense)과 반대편(안티센스, antisense)에 각각 상보적으로 결합하는 한 세트(쌍)으로 구성된다. 프라이머는 당업자라면 MRS의 mRNA 또는 cDNA 염기서열을 참조하여 용이하게 디자인할 수 있다. The sequence of the primer does not need to have a sequence completely complementary to a part of the nucleotide sequence of the template. It is sufficient if the primer has sufficient complementarity within a range capable of hybridizing with the template and acting as a primer. Therefore, in the present invention, the primer for measuring the expression level of the mRNA of the marker does not need to have a perfectly complementary sequence in each gene sequence, and amplifies a specific region of mRNA or cDNA through DNA synthesis to measure the amount of mRNA Anything that has a length and complementarity that suits your purpose is sufficient. The primer for the amplification reaction is composed of a pair (pair) complementarily binding to a template (or sense) at opposite ends of a specific region of the mRNA to be amplified and an opposite region (antisense), respectively. The primers can be easily designed by those skilled in the art with reference to the mRNA or cDNA sequence of MRS.

본 발명의 프라이머는 바람직하게는 서열번호 2로 표시되는 MRS의 mRNA 염기서열에 특이적으로 결합하는 한 세트, 한 쌍 또는 이들의 조합일 수 있다. The primer of the present invention may preferably be a set, a pair, or a combination thereof that specifically binds to the mRNA nucleotide sequence of MRS represented by SEQ ID NO: 2.

'프로브(probe)'는 특정 유전자의 mRNA나 cDNA(complementary DNA)에 특이적으로 결합할 수 있는 짧게는 수개 내지 길게는 수백 개의 염기(base pair) 길이의 RNA 또는 DNA 등 폴리뉴클레오티드의 단편을 의미하며, 표지(labeling)되어 있어서 결합하는 대상 mRNA나 cDNA의 존재 유무, 발현양 등을 확인할 수 있다. 본 발명의 목적을 위해서는 MRS의 mRNA에 상보적인 프로브를 피검체의 시료와 혼성화 반응(hybridization)을 수행하여 MRS mRNA의 발현양을 측정함으로써 암의 진단에 이용할 수 있다. 프로브의 선택 및 혼성화 조건은 당업계에 공지된 기술에 따라 적절하게 선택할 수 있다. The term "probe" refers to a fragment of a polynucleotide, such as RNA or DNA having a base pair length of several to several hundreds, which can specifically bind to a specific gene mRNA or cDNA (complementary DNA) And it is labeled so that the presence or expression level of mRNA or cDNA to be bound can be confirmed. For the purpose of the present invention, a probe complementary to MRS mRNA can be used for diagnosis of cancer by measuring the amount of MRS mRNA expression by performing hybridization with a sample of a subject. The selection and hybridization conditions of the probes can be appropriately selected according to techniques known in the art.

본 발명의 프라이머 또는 프로브는 포스포아미다이트(phosphoramidite) 고체지지체 합성법이나 기타 널리 공지 된 방법을 이용하여 화학적으로 합성할 수 있다. 또한 프라이머 또는 프로브는 MRS의 mRNA와의 혼성화를 방해하지 않는 범위에서 당해 기술분야에 공지된 방법에 따라 다양하게 변형시킬 수 있다. 이러한 변형의 예로는 메틸화, 캡화, 천연 뉴클레오티드 하나 이상의 동족체로의 치환 및 뉴클레오티드 간의 변형, 예를 들면 하전되지 않은 연결체(예: 메틸 포스포네이트, 포스포트리에스테르, 포스포로아미데이트, 카바메이트 등) 또는 하전된 연결체(예: 포스포로티오에이트, 포스포로디티오에이트 등), 그리고 형광 또는 효소를 이용한 표지물질(labeling material)의 결합 등이 있다. The primer or probe of the present invention can be chemically synthesized using a phosphoramidite solid support synthesis method or other well-known methods. In addition, the primer or the probe may be variously modified according to methods known in the art, so long as it does not interfere with hybridization of MRS with mRNA. Examples of such modifications include, but are not limited to, methylation, capping, substitution with one or more of the natural nucleotide analogs and modifications between nucleotides, such as uncharged linkers (e.g., methylphosphonate, phosphotriester, phosphoramidate, carbamate, etc.) ) Or charged conjugates (eg, phosphorothioate, phosphorodithioate, etc.), and binding of labeling materials using fluorescence or enzymes.

본 발명의 진단용 조성물이 단백질의 발현 수준을 측정하기 위한 것일 때에는 단백질 발현 수준을 측정하는 제제는 MRS 단백질에 각각 특이적으로 결합하는 항체일 수 있다. When the diagnostic composition of the present invention is for measuring the expression level of a protein, the agent for measuring the protein expression level may be an antibody that specifically binds to the MRS protein, respectively.

'항체(antibody)'는 항원성 부위에 특이적으로 결합하는 면역글로불린(immunoglobulin)을 의미한다. 본 발명에서의 항체는 MRS 단백질 이외에는 다른 종류의 아미노아실 티알엔에이 합성효소를 포함하는 다른 단백질에는 반응하지 않고, MRS 단백질에만 특이적으로 결합하는 항체이다. MRS 항체는 각 유전자를 발현벡터에 클로닝하여 상기 유전자에 의해 암호화되는 단백질을 수득하고, 수득한 단백질로부터 당해 기술분야의 통상적인 방법에 따라 제조할 수 있다. MRS 항원성 부위를 포함하는 MRS 단백질의 단편을 이용하여 각각의 단백질 특이적인 항체를 제조할 수도 있다. 본 발명의 항체의 형태는 특별히 제한되지 않으며, 다클론항체(polyclonal antibody) 또는 단일클론항체(monoclonal antibody)를 포함한다. 또한 항원-항체 결합성을 갖는 것이면 전체 항체의 일부도 본 발명의 항체에 포함되며, MRS에 특이적으로 결합하는 모든 종류의 면역글로불린 항체가 포함된다. 예를 들어 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 갖는 완전한 형태의 항체 뿐 아니라 항체 분자의 기능적인 단편, 즉 항원 결합 기능을 갖는 Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 나아가 본 발명의 항체에는 MRS 단백질에 특이적으로 결합할 수 있는 것이라면 인간화 항체, 키메릭 항체 등의 특수 항체와 재조합 항체도 포함된다. &Quot; Antibody &quot; means an immunoglobulin that specifically binds to an antigenic site. The antibody of the present invention is an antibody that specifically binds only to the MRS protein without reacting with other proteins including other aminoacyl thiourea synthetase other than the MRS protein. The MRS antibody can be produced by cloning each gene into an expression vector to obtain a protein encoded by the gene and obtaining the protein from the obtained protein according to a conventional method in the art. Individual protein specific antibodies may be prepared using fragments of the MRS protein comprising an MRS antigenic site. The form of the antibody of the present invention is not particularly limited and includes a polyclonal antibody or a monoclonal antibody. Also, as long as it has an antigen-antibody binding property, a part of the whole antibody is included in the antibody of the present invention and includes all kinds of immunoglobulin antibodies that specifically bind to MRS. F (ab '), F (ab '), &lt; / RTI &gt; which have antigen binding functions, as well as complete forms of antibodies with two full length light chains and two full length heavy chains, 2, and Fv. Furthermore, the antibody of the present invention includes a special antibody such as a humanized antibody, a chimeric antibody and a recombinant antibody as long as it can specifically bind to the MRS protein.

상기 각 마커 단백질 특이적인 항체를 MRS의 발현 수준을 측정하는 제제로 포함하는 본 발명의 진단용 조성물은 공지된 단백질을 감지하는 방법에 필요한 제제를 추가적으로 포함할 수 있으며, 본 조성물을 이용하여 공지된 단백질을 감지하는 방법을 제한없이 사용하여 피검체에서 MRS 단백질의 수준을 측정할 수 있다. The diagnostic composition of the present invention comprising the marker protein-specific antibody as an agent for measuring the expression level of MRS may further comprise a preparation necessary for a method of detecting a known protein, May be used without limitation to determine the level of MRS protein in the subject.

본 발명은 또한 상기 MRS 검출용 조성물을 포함하는 폐암 예후 예측용 키트를 제공한다. The present invention also provides a lung cancer prognostic prediction kit comprising the composition for detecting MRS.

본 발명의 예후 예측용 키트에는 MRS 단백질을 마커로 인식하는 항체 또는 MRS의 mRNA를 마커로 인식하는 프라이머, 프로브뿐만 아니라 분석 방법에 적합한 한 종류 또는 그 이상의 다른 구성 성분 조성물, 용액 또는 장치가 포함될 수 있다.The prognostic prediction kit of the present invention may include one or more other component compositions, solutions, or devices suitable for the assay as well as primers, probes, and the like that recognize the MRS protein as a marker or recognize the mRNA of the MRS as a marker have.

구체적인 양태로서 상기 진단 키트는 역전사 중합효소반응을 수행하기 위해 필요한 필수 요소를 포함하는 것을 특징으로 하는 진단용 키트일 수 있다. 역전사 중합효소반응 키트는 마커 유전자에 대한 특이적인 각각의 프라이머 쌍을 포함한다. 프라이머는 각 마커 유전자의 핵산서열에 특이적인 서열을 가지는 뉴클레오타이드로서, 약 7bp 내지 50bp의 길이, 보다 바람직하게는 약 10bp 내지 30bp의 길이이다. 또한 대조군 유전자의 핵산 서열에 특이적인 프라이머를 포함할 수 있다. 그 외 역전사 중합효소반응 키트는 테스트 튜브 또는 다른 적절한 컨테이너, 반응 완충액(pH 및 마그네슘 농도는 다양), 데옥시뉴클레오타이드(dNTPs), Taq-폴리머라아제 및 역전사효소와 같은 효소, DNAse, RNAse 억제제 DEPC-수(DEPC-water), 멸균수 등을 포함할 수 있다.In a specific embodiment, the diagnostic kit may be a diagnostic kit comprising essential elements necessary for performing a reverse transcription-polymerase reaction. The RT-PCR kit contains the respective primer pairs specific for the marker gene. A primer is a nucleotide having a sequence specific to a nucleic acid sequence of each marker gene, and has a length of about 7 bp to 50 bp, and more preferably about 10 bp to 30 bp. It may also contain a primer specific for the nucleic acid sequence of the control gene. Other reverse transcription polymerase reaction kits may be used in combination with test tubes or other appropriate containers, reaction buffers (varying in pH and magnesium concentration), deoxynucleotides (dNTPs), enzymes such as Taq polymerase and reverse transcriptase, DNAse, RNAse inhibitor DEPC DEPC-water, sterile water, and the like.

또 다른 양태로는 DNA 칩을 수행하기 위해 필요한 필수 요소를 포함하는 것을 특징으로 하는 진단 키트일 수 있다. DNA 칩 키트는 유전자 또는 그의 단편에 해당하는 cDNA 또는 올리고뉴클레오티드(oligonucleotide)가 부착되어 있는 기판, 및 형광표식 프로브를 제작하기 위한 시약, 제제, 효소 등을 포함할 수 있다. 또한 기판은 대조군 유전자 또는 그의 단편에 해당하는 cDNA 또는 올리고뉴클레오티드를 포함할 수 있다.Another aspect of the present invention is a diagnostic kit characterized in that it includes an essential element necessary for performing a DNA chip. The DNA chip kit may include a substrate to which a cDNA or oligonucleotide corresponding to a gene or a fragment thereof is attached, and reagents, preparations, enzymes, and the like for producing a fluorescent-labeled probe. The substrate may also comprise a cDNA or oligonucleotide corresponding to a control gene or fragment thereof.

본 발명은 또한 (a) 환자로부터 시료를 제공하는 단계; (b) 상기 시료에서 MRS의 mRNA 발현수준 또는 단백질의 발현 수준을 측정하는 단계; 및 (c) 상기 MRS의 mRNA 발현수준 또는 단백질의 발현수준을 정상 대조구 시료의 MRS mRNA의 발현수준 또는 단백질 발현수준과 비교하여 발현수준이 증가한 피검체를 폐암 예후가 좋지 않은 것으로 판정하는 단계를 포함하는, 폐암 예후 예측용 마커를 검출하는 방법을 제공한다. (A) providing a sample from a patient; (b) measuring mRNA expression level or protein expression level of MRS in said sample; And (c) comparing the mRNA expression level or the protein expression level of the MRS with the MRS mRNA expression level or protein expression level of the normal control sample to determine that the lung cancer prognosis is poor in the subject whose expression level is increased A marker for predicting lung cancer prognosis.

본 발명의 방법의 (a) 단계는 환자로부터 시료를 제공하는 단계이다. Step (a) of the method of the present invention is a step of providing a sample from a patient.

상기 시료는 폐암의 예후를 예측하고자 하는 피검체에서 채취된 것이면 제한없이 사용할 수 있으며, 예를 들어 생검 등으로 얻어진 세포나 조직, 혈액, 전혈, 혈청, 혈장, 타액, 뇌척수액, 각종 분비물, 소변, 대변 등일 수 있다. 바람직하게는 혈액, 혈장, 혈청, 타액, 비액, 객담, 관절낭액, 양수, 복수, 자궁경부 또는 질 분비물, 소변 및 뇌척수액일 수 있다. 가장 바람직하게는 암 조직일 수 있다. The sample can be used without limitation as long as it is collected from a subject in order to predict the prognosis of lung cancer. For example, the sample can be a cell or tissue obtained by biopsy, blood, whole blood, serum, plasma, saliva, cerebrospinal fluid, Feces, and the like. Preferably blood, plasma, serum, saliva, saliva, sputum, capsular fluid, amniotic fluid, ascites, cervix or vaginal discharge, urine and cerebrospinal fluid. Most preferably, it may be a cancerous tissue.

본 발명의 방법의 (b) 단계는 (a) 단계에서 제공한 시료에서 MRS의 발현 수준을 측정하는 단계이다. 상기 발현 수준은 MRS의 mRNA 또는 단백질의 발현 수준일 수 있다. Step (b) of the method of the present invention is a step of measuring the expression level of MRS in the sample provided in step (a). The expression level may be an expression level of mRNA or protein of MRS.

단백질의 발현 수준은 단백질에 특이적으로 결합하는 항체를 이용하여 검출하거나 측정할 수 있다. 단백질 특이적인 항체는 본 발명의 진단용 조성물에 서술한 바와 같다. 단백질의 발현 수준을 측정하는 방법은 당업계에서 공지되어 있는 방법은 제한 없이 사용할 수 있으며, 그 예로 웨스턴 블랏팅(western blotting), 닷 블랏팅(dot blotting), 효소면역분석법(enzyme-linked immunosorbent assay, ELISA), 방사능 면역분석법(RIA), 방사면역확산법, 오우크테로니 면역 확산법, 로케트 면역 전기영동, 면역조직화학염색, 면역침전법(immunoprecipitation), 보체 고정 분석법, 유세포 분석법(FACS) 또는 단백질 칩(chip) 방법 등이 있으나, 이들에 한정되는 것은 아니다. 바람직하게는 면역조직화학염색일 수 있다. The level of expression of a protein can be detected or measured using an antibody that specifically binds to the protein. The protein-specific antibody is as described for the diagnostic composition of the present invention. Methods for measuring the expression level of a protein can be performed by any method known in the art including, but not limited to, western blotting, dot blotting, enzyme-linked immunosorbent assay Immunohistochemical staining, immunoprecipitation, complement fixation, flow cytometry (FACS), or immunohistochemical staining with protein (s), immunohistochemistry (ELISA), radioimmunoassay (RIA) A chip method, and the like, but the present invention is not limited thereto. And may preferably be immunohistochemical staining.

MRS의 mRNA 수준은 mRNA에 특이적으로 결합하는 프라이머 세트나 프로브를 이용하여 피검체의 시료로부터 MRS의 mRNA나 cDNA를 증폭하거나, 프로브와 혼성화 반응(hybridization)을 이용하여 피검체 시료 내 MRS의 mRNA의 존재와 발현량을 측정할 수 있다. 프라이머와 프로브는 본 발명의 진단용 조성물에서 서술한 바와 같다. mRNA 발현 수준의 측정은 당업계에서 통상적인 발현 수준 확인 방법을 제한 없이 사용할 수 있으며, 분석 방법의 예로 역전사중합체연쇄반응(reverse transcription polymerase chain reaction, RT-PCR), 경쟁적 RT-PCR(competitive RT-PCR), 실시간 RT-PCR(real-time RT-PCR), RNase 보호 분석법(RPA:RNase protection assay), 노던 블랏팅(northern blotting), DNA 마이크로어레이 칩(microarray chip), RNA 염기서열분석(RNA sequencing), 나노스트링(nanostring)을 이용한 혼성화 방법, 조직 절편의 인시투 혼성화 방법(in situ hybridization) 등이 있으나, 이들에 한정되는 것은 아니다. The mRNA level of MRS can be determined by amplifying MRS mRNA or cDNA from a sample of the subject using a primer set or a probe that specifically binds to mRNA or by amplifying mRNA mRNA or cDNA of the MRS in a test sample using a probe and hybridization And the amount of expression can be measured. The primers and probes are as described in the diagnostic composition of the present invention. The measurement of mRNA expression level can be performed by any method known in the art without any limitations. For example, reverse transcription polymerase chain reaction (RT-PCR), competitive RT- PCR, real-time RT-PCR, RNase protection assay, northern blotting, DNA microarray chip, RNA sequencing sequencing, a hybridization method using a nanostring, and an in situ hybridization method using a tissue section. However, the present invention is not limited thereto.

상기 (c) 단계에서 예후가 좋지 않다는 것은 환자의 무병생존기간, 총 생존기간이 길지 않고, 종양의 현재 STAGE가 나쁠 수 있다는 것을 의미하며, 폐암 완치 환자의 경우에는 재발 위험성이 높다는 것을 의미한다. The poor prognosis in step (c) means that the patient's disease-free survival period, total survival time is not long, and the current STAGE of the tumor is bad, which means that the risk of recurrence is high in patients with lung cancer.

또한, 상기 (c) 단계에서의 정상대조구는 폐암 환자에서 MRS의 발현량이 낮은 환자를 의미하며, 구체적으로는 본 발명의 <실시예 3>에 기재된 바와 같이 MRS의 발현 강도와 빈도 점수가 0 또는 1인 음성인 경우를 의미한다.In addition, as shown in Example 3 of the present invention, the normal control in the step (c) means a patient having a low expression level of MRS in a lung cancer patient. Specifically, the expression intensity and frequency score of MRS are 0 or 1 &quot;. &lt; / RTI &gt;

본 발명의 일실시예에 따르면, 폐암 환자의 폐 조직에서 MRS가 높은 수준으로 발현되는 것을 확인하였고, MRS의 발현 수준이 높을수록 환자의 무병생존기간(Disease free survival) 및 총 생존기간(Overall survival)이 짧은 것으로 확인되었으며, 폐암의 병기(stage)가 높을수록 MRS의 발현량이 증가하는 것으로 확인되었다. 따라서, MRS의 유전자 또는 단백질의 발현량을 측정한 후, 이를 정상 대조구 또는 예후가 좋았던 환자의 폐 조직 내 MRS 발현량과 비교함으로써 폐암 환자의 예후를 예측해 볼 수 있다. According to one embodiment of the present invention, a high level of MRS expression was detected in the lung tissue of lung cancer patients, and the higher the expression level of MRS, the more the disease free survival and overall survival ) Was found to be short, and the expression level of MRS was increased as the stage of lung cancer was higher. Therefore, the prognosis of lung cancer patients can be predicted by measuring the expression level of MRS gene or protein, and then comparing the expression level of MRS gene with the amount of MRS in the lung tissues of patients with normal control or good prognosis.

본 발명에 따른 폐암 예후 예측용 마커를 이용하면 예후가 양호하지 않은 환자와 양호한 환자를 정확하면서도 신속하게 구분할 수 있고, 이를 통해 암의 예후를 조기에 판단하여 적절한 치료방법을 선택 및 적용함으로써 환자의 생존율을 높이고 재발율을 낮출 수 있다. Using the marker for predicting the prognosis of lung cancer according to the present invention, it is possible to accurately and promptly distinguish between patients with poor prognosis and those with good prognosis, thereby promptly determining the prognosis of cancer, The survival rate can be increased and the recurrence rate can be lowered.

도 1A는 야생형 C57BL/6 마우스의 주요 기관의 비 종양 조직에서 MRS의 발현을 IHC를 통해 확인한 결과이다.
도 1B는 야생형 C57BL/6 마우스의 주요 기관의 비 종양 조직 용해물에서 MRS의 발현을 웨스턴 블롯을 통해 확인한 결과이다.
도 2A는 인간의 폐와 인접한 정상조직에서 MRS 발현을 IHC를 통해 확인한 결과이다.
도 2B는 LSL-Kras G12D 및 LSL-Kras G12D:p53fl /fl 마우스의 폐암 조직에서 MRS 발현을 IHC를 통해 확인한 결과이다.
도 3은 폐암 조직 샘플 12종에서 폐암(C)과 암종증 주변의 정상양 조직(N)내 단백질의 발현을 웨스턴 블롯을 통해 확인한 결과이다.
도 4A는 폐암 조직 샘플 내에서 MRS의 발현량을 세포질과 핵으로 구분하여, 면역조직염색법을 통해 확인한 결과이다.
도 4B는 총 231명의 폐암환자 조직샘플에서 MRS의 발현량을 면역조직염색법을 통해 확인한 후, 염색 강도와 염색 빈도를 반영하여 수치화한 후, 각 수치에 해당하는 환자의 비율을 확인한 결과이다.
도 5는 Kaplan-Myer를 이용하여 폐암 환자에서 MRS의 발현과 총생존율 및 무병생존율과의 상관관계를 평가한 결과이다(도 5A는 무병생존율(disease free survival, DFS)의 결과를 나타낸 것이고, 도 5B는 총 생존율(overall survival, OS)를 나타낸 결과이다. No/weak expression은 MRS의 발현점수가 0점 또는 1점인 환자를 의미하며, strong expression은 MRS의 발현점수가 2점 내지 9점인 환자를 의미한다.).
FIG. 1A shows the expression of MRS in non-tumor tissues of major organs of wild-type C57BL / 6 mice through IHC.
Figure 1B shows the results of Western blot analysis of MRS expression in non-tumor tissue lysates of major organs of wild-type C57BL / 6 mice.
FIG. 2A shows MRS expression in normal tissues adjacent to a human lung through IHC.
FIG. 2B shows MRS expression in lung cancer tissues of LSL-Kras G12D and LSL-Kras G12D: p53 fl / fl mice through IHC.
FIG. 3 shows the results of Western blotting the expression of proteins in normal tissue (N) around lung cancer (C) and carcinoma in 12 kinds of lung cancer tissue samples.
FIG. 4A shows the results of immunohistochemical staining for the expression levels of MRS in the lung cancer tissue samples.
FIG. 4B is a result of quantifying the expression level of MRS in a total of 231 lung cancer tissue samples by immunohistochemical staining, reflecting the intensity of staining and the frequency of staining, and then confirming the percentage of patients corresponding to each value.
FIG. 5 shows the results of evaluating the correlation between the expression of MRS and the total survival rate and disease-free survival rate in lung cancer patients using Kaplan-Myer (FIG. 5A shows the results of disease free survival (DFS) No / weak expression means a patient with 0 or 1 point expression of MRS, and strong expression means a patient with 2 to 9 points of MRS expression it means.).

이하 본 발명을 상세히 설명한다.Hereinafter, the present invention will be described in detail.

단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.However, the following examples are illustrative of the present invention, and the present invention is not limited to the following examples.

<실험방법><Experimental Method>

<1-1> 실험동물&Lt; 1-1 >

본 발명의 웨스턴 블로팅 및 면역염색분석에서 사용된 동물 샘플은 8주 된 야생형 C57BL/6 마우스의 주요 장기로부터의 조직 용해물 및 파라핀 내장 조직 블록을 사용하여 수행되었다. 마우스 폐암 조직에서 MRS 발현을 평가하기 위해, LSL-Kras G12D 및 LSL-Kras G12D:p53fl /fl 마우스에 각각 AdCre 바이러스 입자를 흡입시킨 후 24주 및 8주에 희생시켰다(http://mouse.ncifcrf.gov/). 모든 동물 실험은 연세대학교 실험동물운영위원회(2014-0229-1)의 승인을 받고, 미국실험동물관리평가인증협회(American Assessment and Accreditation of Animal Care)의 지침에 따라 수행되었다.Animal samples used in Western blotting and immunostaining analyzes of the present invention were performed using tissue lysates and paraffin embedded tissue blocks from major organs of 8-week-old wild-type C57BL / 6 mice. In order to evaluate MRS expression in mouse lung cancer tissues, LSL-Kras G12D and LSL-Kras G12D: p53 fl / fl mice were sacrificed at 24 and 8 weeks after inoculation with AdCre virus particles, respectively (http: // mouse. ncifcrf.gov/). All animal tests were approved by the Yonsei University Laboratory Animal Care Committee (2014-0229-1) and conducted in accordance with the guidelines of the American Assessment and Accreditation of Animal Care.

<1-2> 임상조직샘플<1-2> Sample of clinical tissue

본 발명의 모든 실험방법들은 강남세브란스 병원의 윤리위원회 (IRB)의 승인을 받아 진행하였다 (IRB # 3-2014-0299). 폐암 환자의 폐 조직에서 MRS의 발현여부를 평가하기 위하여서는 포르말린으로 고정된 파라핀 포매된 비소세포성폐암(NSCLC) 환자의 폐 조직 슬라이드 231개를 면역조직염색에 사용하였다. 1993년부터 2009년까지 연세의료원 산하의 세브란스 병원과 강남 세브란스병원에 내원하여 폐암 진단하에 수술적 치료 받은 환자로부터 총 231개의 폐암 샘플을 수득하였다. 조직샘플은 수술 직후 10% 포르말린으로 고정하고 파라핀 포매하였다. 무병 생존기간은 수술 후로부터 재발 또는 전이가 확인된 일자까지로 계산하였으며, 총 생존기간은 진단일로부터 사망일 또는 마지막 추적 관찰일로부터 추계하였다. 또한 동 기간 동안 폐암 수술을 시행 받고 검체 제공 동의서를 제공한 환자들의 급속 냉동 검체 중 폐암과 암종증 주변의 정상양 조직 12 쌍을 얻어 lysate를 제조하고 웨스턴 블로팅을 시행 폐암 특이적 MRS의 발현 여부를 확인하였다. 면역 화학염색의 결과 분석을 위해 하나의 암종증 slide내에서 암종증 주변에 위치하는 정상양 주변 조직에서 MRS의 발현을 암세포에서의 발현과 비교 분석하였다. All the experimental methods of the present invention were conducted with the approval of the Ethics Committee (IRB) of Gangnam Severance Hospital (IRB # 3-2014-0299). To evaluate the expression of MRS in lung tissues of lung cancer patients, 231 slides of lung tissue of formalin - fixed, non - small cell lung cancer (NSCLC) patients were used for immunohistochemical staining. From 1993 to 2009, a total of 231 lung cancer samples were obtained from patients who underwent surgical treatment under the diagnosis of lung cancer at Severance Hospital and Gangnam Severance Hospital under the Yonsei Medical Center. Tissue samples were fixed in 10% formalin immediately after surgery and embedded in paraffin. Disease free survival was calculated from the postoperative day to the date of recurrence or metastasis, and the total survival time was estimated from the date of diagnosis to the date of death or the last follow - up. In addition, 12 of the normal tissues around lung cancer and carcinomatosis were obtained from the rapid cryopreservation specimens of patients who underwent lung cancer surgery during the same period, and were provided with the consent to provide the sample. Lysate was prepared and Western blotting was performed to determine the expression of lung cancer- Respectively. In order to analyze the results of immunochemical staining, MRS expression was compared with expression in cancer cells in the peritumoral tissues surrounding the carcinomatosis in one carcinomatous slide.

<1-3> <1-3> 웨스턴Western 블로팅Blotting

본 발명에서 사용된 anti-MRS 및 anti-LRS 항체는 Neomix Inc(수원, 경기도, 대한민국)에서 구입하였고, anti-Ki67 항체는 Abcam(Cambridge, UK)으로부터 구입 하였다. 그 외의 다른 모든 항체는 Cell Signaling Technology(Danver, MA, USA)에서 구입하여 사용하였다. 급속 냉동되어 초저온 냉동고에 보관된 폐암과 암종증 주변의 정상양 조직 12 쌍을 확보하여 protease와 phosphatase의 억제물이 포함되어 있는 2X의 램니 검체 버퍼에 넣고, 호모게나이저 및 소니케이션을 통해 웨스턴 블로팅용 lysate를 제작하였다. 30-50 ㎍의 lyate를 7.5 ∼ 12% 의 polyacrylamide gel에서 전기 영동한 뒤 nitrocellulose membrane으로 옮겼으며 이후 1차 및 2차 항체를 붙이고 ECL 키트를 이용하여 단백질 발현을 확인하였다. The anti-MRS and anti-LRS antibodies used in the present invention were purchased from Neomix Inc (Suwon, Gyeonggi-do, Korea) and the anti-Ki67 antibody was purchased from Abcam (Cambridge, UK). All other antibodies were purchased from Cell Signaling Technology (Danver, MA, USA). Twelve pairs of normal tissues around lung cancer and carcinomatosis were rapidly frozen and stored in a cryogenic freezer, and they were placed in a 2X rhamnose sample buffer containing protease and phosphatase inhibitor, and subjected to Western blotting using homogenizer and sonication lysate. 30-50 ㎍ of lyate was electrophoresed on 7.5-12% polyacrylamide gel and transferred to nitrocellulose membrane. The protein expression was confirmed by ECL kit using primary and secondary antibodies.

<1-4> 면역조직화학염색(IHC) 분석<1-4> Immunohistochemical staining (IHC) analysis

면역조직화학염색을 위하여, 조직 샘플을 10% 포르말린으로 고정하고 파라핀 포매하였다. 조직 슬라이드는 자일렌에 침지함으로써 파라핀을 제거하였고, 100%, 90%, 80%, 70% 에탄올에 차례대로 내려가며 재수화하였다. 재수화 후에 슬라이드를 상온에서 증류수로 수차례 세척하였다. 조직 절편은 0.3% 과산화수소로 15분간 인큐베이션 하여 퍼옥시다제를 블로킹 하였으며, PBS로 3차례 세척하고 2시간 동안 상온에서 3% 염소 혈청으로 블로킹하였다. 마지막으로 4℃에서 인간 MRS, Ki67, pS6 및 pGSK-3β에 대한 일차 항체와 함께 밤샘 방치하였다. 이차 항체는 DAKO polymer-HRP goat anti-rabbit IgG를 이용하였다. 세포를 Mayer’s 헤마톡실린으로 대조염색 하였다. 이미지는 광학현미경을 이용하여 관찰하였다. For immunohistochemical staining, tissue samples were fixed with 10% formalin and embedded in paraffin. The tissue slides were immersed in xylene to remove paraffin and rehydrated to 100%, 90%, 80%, 70% ethanol sequentially. After rehydration, the slides were washed several times with distilled water at room temperature. Tissue sections were incubated with 0.3% hydrogen peroxide for 15 minutes to block peroxidase, washed three times with PBS and blocked with 3% goat serum at room temperature for 2 hours. Finally, the cells were allowed to stand at 4 ° C overnight with the primary antibodies against human MRS, Ki67, pS6 and pGSK-3β. The secondary antibody was DAKO polymer-HRP goat anti-rabbit IgG. Cells were counterstained with Mayer's hematoxylin. Images were observed using an optical microscope.

<1-5> 면역조직화학염색(IHC)의 해석<1-5> Analysis of immunohistochemical staining (IHC)

폐암 환자의 암종에서 MRS의 IHC 염색은 (a) 염색의 강도 (intensity) ; 암세포 특이 염색 강도에 따라서 0,1,2,3 으로 나누었고, (b) 염색의 분율 (frequency); 전체 암세포들 중에서 염색에 양성인 세포의 분율에 따라 0, 1, 2 및 3으로 점수화 하였다. 여기서 염색의 분율의 0은 10% 미만, 1은 10~50%, 2는 51 내지 80% 및 3은 80% 이상의 세포에서 염색 양성을 나타낸 경우를 의미한다. (c) 염색의 강도를 나타내는 값과 염색의 분율을 나타내는 값의 곱 (intensity score X frequency score)을 얻어 각 slide에서 MRS의 염색의 점수로 정의하였다. 각각의 조직 샘플에서 MRS의 염색의 점수가 2 이상인 경우를 과발현이라고 정의하였다.The IHC staining of MRS in lung carcinoma carcinoma showed (a) intensity of staining; Divided by 0, 1, 2 and 3 according to the specific staining intensity of cancer cells, (b) the frequency of staining; Of the total cancer cells, 0, 1, 2 and 3 were scored according to the fraction of cells positive for staining. Herein, 0 means less than 10%, 1 means 10 to 50%, 2 means 51 to 80% and 3 means 80% or more. (c) The intensity score (X frequency score) was multiplied by a value indicating the intensity of staining and a value indicating the percentage of staining, and the score was defined as the score of MRS staining on each slide. Over-expression was defined as a score of 2 or more for MRS staining in each tissue sample.

한편, 상기 염색의 강도에 대한 기준은 다음과 같은 기준에 따라 판단하였다:On the other hand, the criteria for the intensity of the staining were judged according to the following criteria:

0; 분명한 MRS의 발현이 암종증에서 관찰되지 않아 염색의 강도가 주변 정상양 조직과 차이가 없는 경우0; The clear MRS expression was not observed in the carcinomatosis and the intensity of the staining was not different from the surrounding normal tissue

1: 암종증 주변의 정상양 조직과는 명확히 구분이 되나 internal reference로 사용된 섬모기관지 상피세포(ciliated bronchial epithelial cell) 및 폐포 대식세포(alveolar macrophages) 등에서 관찰되는 염색강도보다 낮은 경우1: There is a clear distinction from the normal tissue around the carcinoma but it is lower than the staining intensity observed in ciliated bronchial epithelial cells and alveolar macrophages used as an internal reference

2. 암종증 주변의 정상양 조직과는 명확히 구분이 되고 internal reference로 사용된 섬모기관지 상피세포(ciliated bronchial epithelial cell) 및 폐포 대식세포(alveolar macrophages) 등에서 관찰되는 염색의 강도와 유사한 경우2. There is a clear distinction from the normal tissue surrounding the carcinoma and similar to the intensity of staining observed in ciliated bronchial epithelial cells and alveolar macrophages used as internal reference

3. internal reference로 사용된 섬모기관지 상피세포(ciliated bronchial epithelial cell) 및 폐포 대식세포(alveolar macrophages) 등의 염색의 강도보다 명확히 강하게 염색된 경우.3. Staining was clearly stronger than the intensity of staining of ciliated bronchial epithelial cells and alveolar macrophages used as an internal reference.

<1-6> 통계학적 분석<1-6> Statistical analysis

통계학적인 분석은 SPSS 소프트웨어를 이용하였다. MRS의 발현량과 임상병리학적 특성들과의 상관관계에 대해서는 Chi-square 테스트(χ2) 및 Fisher's 테스트를 이용하였다. 총 생존율은 Kaplan-Meier 방법을 이용하여 계산하였으며, 생존곡선의 차이는 log-rank 테스트로써 분석하였다. P-value가 0.05 이하인 경우를 통계학적 유의성이 있다고 평가하였다. Statistical analysis was performed using SPSS software. Chi-square test (χ2) and Fisher's test were used for correlation between MRS outcome and clinicopathologic features. The total survival rate was calculated using the Kaplan-Meier method and the difference in survival curves was analyzed by log-rank test. A P-value <0.05 was considered statistically significant.

<실험결과><Experimental Results>

<< 실시예Example 1> 1>

다양한 마우스 조직에서의 In various mouse tissues MSR의MSR 발현 Expression

폐암의 치료 표적으로서의 MRS의 잠재력을 탐색하기 위해, 면역조직화학염색(IHC) 및 웨스턴 블로팅을 통하여 8주 된 야생형 C57BL/6 마우스의 주요 기관의 비 종양 조직에서 MRS 발현을 평가 하였다. To explore the potential of MRS as a therapeutic target for lung cancer, MRS expression was assessed in non-tumor tissues of major organs of 8-week-old wild-type C57BL / 6 mice by immunohistochemical staining (IHC) and Western blotting.

IHC를 수행한 결과, 도 1A에 나타나 있는 바와 같이 야생형 C57BL/6 마우스에서 MRS는 비장 및 장 상피에서 약하게 발현되었고, 신장, 간 및 폐에서는 미미하게 발현되었다.As a result of IHC, MRS was weakly expressed in spleen and intestinal epithelium in wild-type C57BL / 6 mouse, and only slightly in kidney, liver and lung as shown in Fig. 1A.

또한 조직 용해액의 웨스턴 블로팅을 수행하고 이전의 실험에서 높은 MRS 발현을 보인 대조군으로서 심장조직 용해물을 포함시켰다. 그 결과, 도 1B에 나타나 있는 바와 같이 IHC 결과와 유사하게 MRS 발현 강도는 비장에서 가장 높았고, 그 다음에 장 및 다른 장기들에 미미하게 확인되었다.Western blotting of tissue lysates was also performed and heart tissue lysates were included as controls showing high MRS expression in previous experiments. As a result, as shown in Figure 1B, similar to the IHC results, the MRS expression intensity was highest in the spleen and then slightly in the intestine and other organs.

이와 같이, MRS는 정상 폐조직에서는 약하게 발현되며, 폐암 특이적으로 강하게 발현하는 것을 확인 할 수 있었다.Thus, MRS was weakly expressed in normal lung tissue, and it was confirmed that MRS was strongly expressed in lung cancer.

<< 실시예Example 2> 2>

비소세포Non-small cell 폐암 특이적 MRS의 발현 Expression of lung cancer-specific MRS

MRS 발현이 폐암에 특이적인지를 확인하기 위해, 폐와 인접한 조직에서 MRS 발현을 확인하였다. 도 2A에서 나타나 있는 바와 같이, MRS는 인간의 폐와 인접한 정상조직인 폐포 및 혈관에서 발현되지 않았으며 기관지 상피 세포에서 약하게 발현되었다. 반면, 도 2B에 나타난 바와 같이 LSL-Kras G12D 및 LSL-Kras G12D:p53fl/fl 마우스 폐 조직에서는 MRS가 과 발현 된 것을 확인할 수 있었다.To confirm whether MRS expression is specific for lung cancer, MRS expression was confirmed in tissues adjacent to the lung. As shown in FIG. 2A, MRS was not expressed in alveoli and blood vessels, which are normal tissues adjacent to a human lung, and was weakly expressed in bronchial epithelial cells. On the other hand, as shown in FIG. 2B, MRS was overexpressed in LSL-Kras G12D and LSL-Kras G12D: p53 fl / fl mouse lung tissues.

폐암 특이성 MRS 과발현에 대하여 웨스턴 블로팅을 통하여 추가로 확인하였다. 그 결과, 도 3에 나타나 있는 바와 같이 12쌍의 폐암조직과 폐암 주변 정상양 조직의 비교에서 MRS는 72%의 검체에서 폐암 특이적 과발현을 보이고 있다. 또한 MRS의 과발현을 보이는 검체는 대부분 pS6의 과발현이 동반되어 있음을 확인할 수 있었다.The lung cancer-specific MRS overexpression was further confirmed by Western blotting. As a result, as shown in FIG. 3, MRS showed a specific overexpression of lung cancer in 72% of the samples in comparison with 12 pairs of lung cancer tissues and surrounding normal cancer tissues. In addition, the overexpression of MRS was mostly accompanied by overexpression of pS6.

<< 실시예Example 3> 3>

MRS의 발현과 The expression of MRS 비소세포성폐암Non-small cell lung cancer (( NSCLCNSCLC ) 환자 예후와의 상관관계) Correlation with patient prognosis

도 4A 및 4B에 나타낸 바와 같이, MRS는 폐암 조직의 세포질에서 주로 발현되는 것으로 확인되었다. MRS의 발현 강도와 빈도 점수가 0 또는 1인 경우를 음성으로 정의하였고, 점수가 2 ∼9 인 경우를 MRS 발현 양성이라고 정의하였다. As shown in Figures 4A and 4B, MRS was found to be mainly expressed in the cytoplasm of lung cancer tissues. MRS expression intensity and frequency score were 0 or 1 as negative, and 2 to 9 score was defined as positive MRS expression.

파라핀 포매된 231개의 비소세포성폐암 조직샘플 중에서 179(77.4%)개의 조직샘플에서 세포질 내 MRS의 발현이 양성을 나타내었다.Of the 231 non-small cell lung cancer tissue samples that were embedded in paraffin, 179 (77.4%) tissue samples showed positive cytoplasmic MRS expression.

비소세포성폐암에서 MRS 발현의 임상적 의미를 확인하기 위해, 조직샘플들을 MRS 발현 음성과 양성인 두 그룹으로 나누어 임상/병리학적 특성들을 비교하였다. 표 1에 나타낸 바와 같이 231개의 조직샘플들 중에서 78개(33.8%)가 여성이었으며, 평균연령은 61.6세 이었다. 분석에 사용된 측정 파라미터들 중에서 MRS 양성인 비율은 종양의 병리학적 스테이지가 증가할수록 점차적으로 증가하였다(p=0.018, Pearson’s χ2-test).To confirm the clinical significance of MRS expression in non-small cell lung cancer, tissue samples were divided into two groups positive for MRS expression negative and clinical / pathologic characteristics were compared. As shown in Table 1, 78 of the 231 tissue samples (33.8%) were female and the mean age was 61.6 years. Among the measurement parameters used for the analysis, the MRS positive rate gradually increased with increasing pathologic stage of the tumor (p = 0.018, Pearson's χ 2 -test).

[표 1][Table 1]

Figure 112017052621255-pat00001
Figure 112017052621255-pat00001

Kaplan-Myer를 이용하여 폐암 환자에서 MRS의 발현과 총생존율 및 무병생존율과의 상관관계를 평가하였다. 도 5에 나타낸 바와 같이 평균적인 사후관찰 기간은 121.4달이었으며, 78(32.1%)개의 조직샘플이 폐암이 재발한 조직이었다. 124(51.0%)개의 조직이 사후관찰기간 중 환자가 사망한 조직이었다. MRS 발현이 양성인 그룹에서 음성인 그룹과 비교해 예후가 좋지 못했는데, 구체적으로 무병생존기간이 MRS 발현 양성인 그룹에서 142.3개월인 반면, MRS 발현 음성인 그룹에서는 161.6개월로 나타났다(P=0.014). 또한, 총 생존율에서도 MRS 발현 양성인 그룹이 음성인 그룹과 비교해 더 좋지 않은 예후를 나타냈다.Kaplan-Myer was used to evaluate the correlation between MRS expression and overall survival and disease-free survival in lung cancer patients. As shown in FIG. 5, the average follow-up period was 121.4 months, and 78 (32.1%) tissue samples were tissues in which lung cancer recurred. 124 (51.0%) were tissues in which the patient died during the follow - up period. The prognosis was poor compared with the negative group in the MRS expression positive group. Specifically, the disease free survival period was 142.3 months in the MRS expression positive group and 161.6 months in the negative MRS expression group (P = 0.014). In addition, the overall survival rate was worse than the negative group with MRS expression positive.

한편, Cox regression 위험 모델을 이용하여 단변량분석(univariate analysis)을 수행한 결과, 하기 표 2에 나타낸 바와 같이, MRS의 발현과 병리학적 스테이지가 좋지 않은 무병생존율과 통계학적으로 유의한 상관성을 나타내는 것으로 확인되었다.Univariate analysis using the Cox regression risk model showed that the expression of MRS and the pathological stage showed a statistically significant correlation with the poor disease-free survival rate as shown in Table 2 below Respectively.

[표 2][Table 2]

Figure 112017052621255-pat00002
Figure 112017052621255-pat00002

본 발명에 따른 폐암 예후 예측용 마커를 이용하면 예후가 양호하지 않은 환자와 양호한 환자를 정확하면서도 신속하게 구분할 수 있고, 이를 통해 암의 예후를 조기에 판단하여 재발의 조기발견을 위한 검사 및 치료법의 선발 및 평가를 위한 수단을 선택 및 적용함으로써 환자의 생존율을 높이고 재발율을 낮출 수 있어 산업상 이용가능성이 매우 높다. The marker for predicting the prognosis of lung cancer according to the present invention can be used to accurately and promptly distinguish between patients with poor prognosis and those with good prognosis and to determine the prognosis of cancer early, Selection and application of means for selection and evaluation can increase the survival rate of patients and lower the recurrence rate, which is very likely to be used in industry.

<110> Medicinal Bioconvergence Research Center Industry-Academic Cooperation Foundation, Yonsei University <120> Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer <130> NP16-0019P <150> 10-2016-0068200 <151> 2016-06-01 <160> 1 <170> KopatentIn 2.0 <210> 1 <211> 900 <212> PRT <213> Artificial Sequence <220> <223> human MRS amino acid sequence <400> 1 Met Arg Leu Phe Val Ser Asp Gly Val Pro Gly Cys Leu Pro Val Leu 1 5 10 15 Ala Ala Ala Gly Arg Ala Arg Gly Arg Ala Glu Val Leu Ile Ser Thr 20 25 30 Val Gly Pro Glu Asp Cys Val Val Pro Phe Leu Thr Arg Pro Lys Val 35 40 45 Pro Val Leu Gln Leu Asp Ser Gly Asn Tyr Leu Phe Ser Thr Ser Ala 50 55 60 Ile Cys Arg Tyr Phe Phe Leu Leu Ser Gly Trp Glu Gln Asp Asp Leu 65 70 75 80 Thr Asn Gln Trp Leu Glu Trp Glu Ala Thr Glu Leu Gln Pro Ala Leu 85 90 95 Ser Ala Ala Leu Tyr Tyr Leu Val Val Gln Gly Lys Lys Gly Glu Asp 100 105 110 Val Leu Gly Ser Val Arg Arg Ala Leu Thr His Ile Asp His Ser Leu 115 120 125 Ser Arg Gln Asn Cys Pro Phe Leu Ala Gly Glu Thr Glu Ser Leu Ala 130 135 140 Asp Ile Val Leu Trp Gly Ala Leu Tyr Pro Leu Leu Gln Asp Pro Ala 145 150 155 160 Tyr Leu Pro Glu Glu Leu Ser Ala Leu His Ser Trp Phe Gln Thr Leu 165 170 175 Ser Thr Gln Glu Pro Cys Gln Arg Ala Ala Glu Thr Val Leu Lys Gln 180 185 190 Gln Gly Val Leu Ala Leu Arg Pro Tyr Leu Gln Lys Gln Pro Gln Pro 195 200 205 Ser Pro Ala Glu Gly Arg Ala Val Thr Asn Glu Pro Glu Glu Glu Glu 210 215 220 Leu Ala Thr Leu Ser Glu Glu Glu Ile Ala Met Ala Val Thr Ala Trp 225 230 235 240 Glu Lys Gly Leu Glu Ser Leu Pro Pro Leu Arg Pro Gln Gln Asn Pro 245 250 255 Val Leu Pro Val Ala Gly Glu Arg Asn Val Leu Ile Thr Ser Ala Leu 260 265 270 Pro Tyr Val Asn Asn Val Pro His Leu Gly Asn Ile Ile Gly Cys Val 275 280 285 Leu Ser Ala Asp Val Phe Ala Arg Tyr Ser Arg Leu Arg Gln Trp Asn 290 295 300 Thr Leu Tyr Leu Cys Gly Thr Asp Glu Tyr Gly Thr Ala Thr Glu Thr 305 310 315 320 Lys Ala Leu Glu Glu Gly Leu Thr Pro Gln Glu Ile Cys Asp Lys Tyr 325 330 335 His Ile Ile His Ala Asp Ile Tyr Arg Trp Phe Asn Ile Ser Phe Asp 340 345 350 Ile Phe Gly Arg Thr Thr Thr Pro Gln Gln Thr Lys Ile Thr Gln Asp 355 360 365 Ile Phe Gln Gln Leu Leu Lys Arg Gly Phe Val Leu Gln Asp Thr Val 370 375 380 Glu Gln Leu Arg Cys Glu His Cys Ala Arg Phe Leu Ala Asp Arg Phe 385 390 395 400 Val Glu Gly Val Cys Pro Phe Cys Gly Tyr Glu Glu Ala Arg Gly Asp 405 410 415 Gln Cys Asp Lys Cys Gly Lys Leu Ile Asn Ala Val Glu Leu Lys Lys 420 425 430 Pro Gln Cys Lys Val Cys Arg Ser Cys Pro Val Val Gln Ser Ser Gln 435 440 445 His Leu Phe Leu Asp Leu Pro Lys Leu Glu Lys Arg Leu Glu Glu Trp 450 455 460 Leu Gly Arg Thr Leu Pro Gly Ser Asp Trp Thr Pro Asn Ala Gln Phe 465 470 475 480 Ile Thr Arg Ser Trp Leu Arg Asp Gly Leu Lys Pro Arg Cys Ile Thr 485 490 495 Arg Asp Leu Lys Trp Gly Thr Pro Val Pro Leu Glu Gly Phe Glu Asp 500 505 510 Lys Val Phe Tyr Val Trp Phe Asp Ala Thr Ile Gly Tyr Leu Ser Ile 515 520 525 Thr Ala Asn Tyr Thr Asp Gln Trp Glu Arg Trp Trp Lys Asn Pro Glu 530 535 540 Gln Val Asp Leu Tyr Gln Phe Met Ala Lys Asp Asn Val Pro Phe His 545 550 555 560 Ser Leu Val Phe Pro Cys Ser Ala Leu Gly Ala Glu Asp Asn Tyr Thr 565 570 575 Leu Val Ser His Leu Ile Ala Thr Glu Tyr Leu Asn Tyr Glu Asp Gly 580 585 590 Lys Phe Ser Lys Ser Arg Gly Val Gly Val Phe Gly Asp Met Ala Gln 595 600 605 Asp Thr Gly Ile Pro Ala Asp Ile Trp Arg Phe Tyr Leu Leu Tyr Ile 610 615 620 Arg Pro Glu Gly Gln Asp Ser Ala Phe Ser Trp Thr Asp Leu Leu Leu 625 630 635 640 Lys Asn Asn Ser Glu Leu Leu Asn Asn Leu Gly Asn Phe Ile Asn Arg 645 650 655 Ala Gly Met Phe Val Ser Lys Phe Phe Gly Gly Tyr Val Pro Glu Met 660 665 670 Val Leu Thr Pro Asp Asp Gln Arg Leu Leu Ala His Val Thr Leu Glu 675 680 685 Leu Gln His Tyr His Gln Leu Leu Glu Lys Val Arg Ile Arg Asp Ala 690 695 700 Leu Arg Ser Ile Leu Thr Ile Ser Arg His Gly Asn Gln Tyr Ile Gln 705 710 715 720 Val Asn Glu Pro Trp Lys Arg Ile Lys Gly Ser Glu Ala Asp Arg Gln 725 730 735 Arg Ala Gly Thr Val Thr Gly Leu Ala Val Asn Ile Ala Ala Leu Leu 740 745 750 Ser Val Met Leu Gln Pro Tyr Met Pro Thr Val Ser Ala Thr Ile Gln 755 760 765 Ala Gln Leu Gln Leu Pro Pro Pro Ala Cys Ser Ile Leu Leu Thr Asn 770 775 780 Phe Leu Cys Thr Leu Pro Ala Gly His Gln Ile Gly Thr Val Ser Pro 785 790 795 800 Leu Phe Gln Lys Leu Glu Asn Asp Gln Ile Glu Ser Leu Arg Gln Arg 805 810 815 Phe Gly Gly Gly Gln Ala Lys Thr Ser Pro Lys Pro Ala Val Val Glu 820 825 830 Thr Val Thr Thr Ala Lys Pro Gln Gln Ile Gln Ala Leu Met Asp Glu 835 840 845 Val Thr Lys Gln Gly Asn Ile Val Arg Glu Leu Lys Ala Gln Lys Ala 850 855 860 Asp Lys Asn Glu Val Ala Ala Glu Val Ala Lys Leu Leu Asp Leu Lys 865 870 875 880 Lys Gln Leu Ala Val Ala Glu Gly Lys Pro Pro Glu Ala Pro Lys Gly 885 890 895 Lys Lys Lys Lys 900 <110> Medicinal Bioconvergence Research Center          Industry-Academic Cooperation Foundation, Yonsei University <120> Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic          biomarker of lung cancer <130> NP16-0019P <150> 10-2016-0068200 <151> 2016-06-01 <160> 1 <170> Kopatentin 2.0 <210> 1 <211> 900 <212> PRT <213> Artificial Sequence <220> <223> human MRS amino acid sequence <400> 1 Met Arg Leu Phe Val Ser Asp Gly Val Pro Gly Cys Leu Pro Val Leu   1 5 10 15 Ala Ala Ala Gly Arg Ala Arg Gly Arg Ala Glu Val Leu Ile Ser Thr              20 25 30 Val Gly Pro Glu Asp Cys Val Val Pro Phe Leu Thr Arg Pro Lys Val          35 40 45 Pro Val Leu Gln Leu Asp Ser Gly Asn Tyr Leu Phe Ser Thr Ser Ala      50 55 60 Ile Cys Arg Tyr Phe Leu Leu Ser Gly Trp Glu Gln Asp Asp Leu  65 70 75 80 Thr Asn Gln Trp Leu Glu Trp Glu Ala Thr Glu Leu Gln Pro Ala Leu                  85 90 95 Ser Ala Leu Tyr Tyr Leu Val Val Gln Gly Lys Lys Gly Glu Asp             100 105 110 Val Leu Gly Ser Val Arg Arg Ala Leu Thr His Ile Asp His Ser Leu         115 120 125 Ser Arg Gln Asn Cys Pro Phe Leu Ala Gly Glu Thr Glu Ser Leu Ala     130 135 140 Asp Ile Val Leu Trp Gly Ala Leu Tyr Pro Leu Leu Gln Asp Pro Ala 145 150 155 160 Tyr Leu Pro Glu Glu Leu Ser Ala Leu His Ser Trp Phe Gln Thr Leu                 165 170 175 Ser Thr Gln Glu Pro Cys Gln Arg Ala Ala Glu Thr Val Leu Lys Gln             180 185 190 Gln Gly Val Leu Ala Leu Arg Pro Tyr Leu Gln Lys Gln Pro Gln Pro         195 200 205 Ser Pro Ala Glu Gly Arg Ala Val Thr Asn Glu Pro Glu Glu Glu Glu     210 215 220 Leu Ala Thr Leu Ser Glu Glu Glu Ile Ala Met Ala Val Thr Ala Trp 225 230 235 240 Glu Lys Gly Leu Glu Ser Leu Pro Pro Leu Arg Pro Gln Gln Asn Pro                 245 250 255 Val Leu Pro Val Ala Gly Glu Arg Asn Val Leu Ile Thr Ser Ala Leu             260 265 270 Pro Tyr Val Asn As Val Val Pro His Leu Gly Asn Ile Gly Cys Val         275 280 285 Leu Ser Ala Asp Val Phe Ala Arg Tyr Ser Arg Leu Arg Gln Trp Asn     290 295 300 Thr Leu Tyr Leu Cys Gly Thr Asp Glu Tyr Gly Thr Ala Thr Glu Thr 305 310 315 320 Lys Ala Leu Glu Glu Gly Leu Thr Pro Gln Glu Ile Cys Asp Lys Tyr                 325 330 335 His Ile Ile His Ala Asp Ile Tyr Arg Trp Phe Asn Ile Ser Phe Asp             340 345 350 Ile Phe Gly Arg Thr Thr Thr Pro Gln Gln Thr Lys Ile Thr Gln Asp         355 360 365 Ile Phe Gln Gln Leu Leu Lys Arg Gly Phe Val Leu Gln Asp Thr Val     370 375 380 Glu Gln Leu Arg Cys Glu His Cys Ala Arg Phe Leu Ala Asp Arg Phe 385 390 395 400 Val Glu Gly Val Cys Pro Phe Cys Gly Tyr Glu Glu Ala Arg Gly Asp                 405 410 415 Gln Cys Asp Lys Cys Gly Lys Leu Ile Asn Ala Val Glu Leu Lys Lys             420 425 430 Pro Gln Cys Lys Val Cys Arg Ser Cys Pro Val Val Gln Ser Ser Gln         435 440 445 His Leu Phe Leu Asp Leu Pro Lys Leu Glu Lys Arg Leu Glu Glu Trp     450 455 460 Leu Gly Arg Thr Leu Pro Gly Ser Asp Trp Thr Pro Asn Ala Gln Phe 465 470 475 480 Ile Thr Arg Ser Trp Leu Arg Asp Gly Leu Lys Pro Arg Cys Ile Thr                 485 490 495 Arg Asp Leu Lys Trp Gly Thr Pro Val Leu Glu Gly Phe Glu Asp             500 505 510 Lys Val Phe Tyr Val Trp Phe Asp Ala Thr Ile Gly Tyr Leu Ser Ile         515 520 525 Thr Ala Asn Tyr Thr Asp Gln Trp Glu Arg Trp Trp Lys Asn Pro Glu     530 535 540 Gln Val Asp Leu Tyr Gln Phe Met Ala Lys Asp Asn Val Pro Phe His 545 550 555 560 Ser Leu Val Phe Pro Cys Ser Ala Leu Gly Ala Glu Asp Asn Tyr Thr                 565 570 575 Leu Val Ser His Leu Ile Ala Thr Glu Tyr Leu Asn Tyr Glu Asp Gly             580 585 590 Lys Phe Ser Lys Ser Arg Gly Val Gly Val Phe Gly Asp Met Ala Gln         595 600 605 Asp Thr Gly Ile Pro Ala Asp Ile Trp Arg Phe Tyr Leu Leu Tyr Ile     610 615 620 Arg Pro Glu Gly Gln Asp Ser Ala Phe Ser Trp Thr Asp Leu Leu Leu 625 630 635 640 Lys Asn Asn Ser Glu Leu Leu Asn Asn Leu Gly Asn Phe Ile Asn Arg                 645 650 655 Ala Gly Met Phe Val Ser Lys Phe Phe Gly Gly Tyr Val Pro Glu Met             660 665 670 Val Leu Thr Pro Asp Asp Gln Arg Leu Leu Ala His Val Thr Leu Glu         675 680 685 Leu Gln His Tyr His Gln Leu Leu Glu Lys Val Arg Ile Arg Asp Ala     690 695 700 Leu Arg Ser Ile Leu Thr Ile Ser Arg His Gly Asn Gln Tyr Ile Gln 705 710 715 720 Val Asn Glu Pro Trp Lys Arg Ile Lys Gly Ser Glu Ala Asp Arg Gln                 725 730 735 Arg Ala Gly Thr Val Thr Gly Leu Ala Val Asn Ile Ala Ala Leu Leu             740 745 750 Ser Val Met Leu Gln Pro Tyr Met Pro Thr Val Ser Ala Thr Ile Gln         755 760 765 Ala Gln Leu Gln Leu Pro Pro Ala Cys Ser Ile Leu Leu Thr Asn     770 775 780 Phe Leu Cys Thr Leu Pro Ala Gly His Gln Ile Gly Thr Val Ser Pro 785 790 795 800 Leu Phe Gln Lys Leu Glu Asn Asp Gln Ile Glu Ser Leu Arg Gln Arg                 805 810 815 Phe Gly Gly Gly Gln Ala Lys Thr Ser Pro Lys Pro Ala Val Val Glu             820 825 830 Thr Val Thr Thr Ala Lys Pro Gln Gln Ile Gln Ala Leu Met Asp Glu         835 840 845 Val Thr Lys Gln Gly Asn Ile Val Arg Glu Leu Lys Ala Gln Lys Ala     850 855 860 Asp Lys Asn Glu Val Ala Ala Glu Val Ala Lys Leu Leu Asp Leu Lys 865 870 875 880 Lys Gln Leu Ala Val Ala Glu Gly Lys Pro Pro Glu Ala Pro Lys Gly                 885 890 895 Lys Lys Lys Lys             900

Claims (10)

비소세포폐암 환자의 예후 예측에 필요한 정보를 제공하기 위하여, 환자의 시료로부터 메티오닐-티알엔에이 합성효소(methionyl-tRNA synthetase, MRS)를 검출하는 방법.
A method for detecting methionyl-tRNA synthetase (MRS) from a patient sample to provide information necessary for predicting the prognosis of patients with non-small-cell lung cancer.
제1항에 있어서, 상기 검출은 MRS 유전자의 mRNA 또는 단백질의 발현수준을 측정하는 것을 특징으로 하는 방법.
2. The method according to claim 1, wherein the detection measures the level of expression of the mRNA or protein of the MRS gene.
MRS의 mRNA 또는 단백질의 발현수준을 측정하는 제제를 포함하는, 비소세포폐암의 예후 예측용 조성물.
A composition for predicting the prognosis of non-small cell lung cancer, comprising an agent for measuring an expression level of mRNA or protein of MRS.
제3항에 있어서, 상기 제제는 MRS의 mRNA에 특이적으로 결합하는 프로브 또는 프라이머 세트인 것을 특징으로 하는 조성물.
4. The composition of claim 3, wherein the agent is a probe or primer set that specifically binds to the mRNA of MRS.
제3항에 있어서, 상기 제제는 MRS 단백질에 특이적인 항체인 것을 특징으로 하는 조성물.
4. The composition of claim 3, wherein the agent is an antibody specific for an MRS protein.
제3항 내지 제5항 중 어느 한 항의 조성물을 포함하는 비소세포폐암 예후 예측용 키트.
A kit for predicting prognosis of non-small cell lung cancer comprising the composition of any one of claims 3 to 5.
제6항에 있어서, 상기 키트가 RT-PCR 키트, 마이크로어레이 칩 키트 또는 단백질 칩 키트인 것을 특징으로 하는 키트.
The kit according to claim 6, wherein the kit is an RT-PCR kit, a microarray chip kit, or a protein chip kit.
(a) 환자로부터 채취된 시료에서 MRS의 mRNA 발현수준 또는 단백질의 발현 수준을 측정하는 단계; 및
(b) 상기 MRS의 mRNA 발현수준 또는 단백질의 발현수준을 정상 대조구 시료의 MRS mRNA의 발현수준 또는 단백질 발현수준과 비교하여 발현수준이 증가한 피검체를 비소세포폐암 예후가 좋지 않은 것으로 판정하는 단계를 포함하는, 비소세포폐암 예후 예측용 마커를 검출하는 방법.
(a) measuring mRNA expression level or protein expression level of MRS in a sample taken from a patient; And
(b) comparing the mRNA expression level or the protein expression level of the MRS with the MRS mRNA expression level or the protein expression level of the normal control sample to determine that the subject having the increased expression level has a poor prognosis of non-small cell lung cancer Wherein the markers for predicting non-small-cell lung cancer prognosis are detected.
제8항에 있어서, 상기 mRNA의 발현 수준을 측정하는 방법은 역전사효소 중합효소반응, 경쟁적 역전사효소 중합효소반응, 실시간 역전사효소 중합효소반응, RNase 보호 분석법, 노던 블랏팅 및 DNA 칩으로 이루어진 군에서 선택된 어느 하나를 이용하는 것인 방법.
[9] The method according to claim 8, wherein the expression level of the mRNA is measured in a group consisting of a reverse transcriptase polymerase, a competitive reverse transcriptase polymerase, a real-time reverse transcriptase polymerase, an RNase protection assay, a Northern blotting and a DNA chip Lt; RTI ID = 0.0 &gt; 1, &lt; / RTI &gt;
제8항에 있어서, 상기 단백질 발현 수준을 측정하기 위한 방법은 웨스턴 블랏, ELISA, 방사선면역분석, 방사 면역 확산법, 오우크테로니 면역 확산법, 로케트 면역전기영동, 조직면역 염색, 면역침전 분석법, 보체 고정 분석법, FACS 및 단백질 칩 방법으로 이루어진 군에서 선택된 어느 하나를 이용하는 것인 방법.9. The method according to claim 8, wherein the method for measuring the protein expression level comprises the steps of: Western blotting, ELISA, radioimmunoassay, radial immunodiffusion, Oucheroton immunodiffusion, rocket immunoelectrophoresis, A fixed assay method, a FACS and a protein chip method.
KR1020170068520A 2016-06-01 2017-06-01 Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer KR101917677B1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20160068200 2016-06-01
KR1020160068200 2016-06-01

Publications (2)

Publication Number Publication Date
KR20170136454A KR20170136454A (en) 2017-12-11
KR101917677B1 true KR101917677B1 (en) 2018-11-12

Family

ID=60943308

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020170068520A KR101917677B1 (en) 2016-06-01 2017-06-01 Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer

Country Status (1)

Country Link
KR (1) KR101917677B1 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011072265A1 (en) 2009-12-11 2011-06-16 Atyr Pharma, Inc. Aminoacyl trna synthetases for modulating inflammation

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011072265A1 (en) 2009-12-11 2011-06-16 Atyr Pharma, Inc. Aminoacyl trna synthetases for modulating inflammation

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Kim S. 등, Nature Rev Cancer volume 11, pp.708-718 (2011.)
Ko Y.-C. 등, in vivo 29: 83-94 (2015)
Li L. 등, Nature Communications, Vol.5, No.5469, pp.1-12 (2014.11.28.)*

Also Published As

Publication number Publication date
KR20170136454A (en) 2017-12-11

Similar Documents

Publication Publication Date Title
JP5988934B2 (en) Multigene prognostic assay for lung cancer
ES2523683T3 (en) Markers for endometrial cancer
KR102047502B1 (en) Composition for diagnosing cancer using potassium channel protein
AU2013284448A1 (en) Use of markers in the diagnosis and treatment of prostate cancer
US11022612B2 (en) BARD1 isoforms in lung and colorectal cancer and use thereof
KR101851003B1 (en) Composition and method for detecting a diagnostic marker for colon cancer
KR102061891B1 (en) A marker for diagnosis of lung cancer
KR101416147B1 (en) Use of ADCY3 for the Diagnosis and Treatment of Gastric Cancer
WO2019134994A1 (en) Prognostic biomarkers for human papillomavirus positive cancers
KR101917677B1 (en) Usefulness of Methionyl-tRNA synthetase (MRS) as a prognostic biomarker of lung cancer
CA3082650A1 (en) A novel cip2a variant and uses thereof
KR20220129816A (en) Diagnostic Biomarker For Prognosis of Diffuse Type Gastric Cancer
KR101940450B1 (en) Non-Small Cell Lung Cancer diagnosed fusion transcript and new transcript marker
WO2014185466A1 (en) Prognosis evaluation method for pancreatic cancer
KR20170124683A (en) Fusion genes and proteins as a novel biomarker for diagnosis of biliary trat cancer
JP6820014B2 (en) Evaluation method of lymph node metastasis ability of endometrial cancer
KR20190037071A (en) Biomarker for Diagnosis of Anticancer drug Resistance of Colon Cancer and Uses thereof
US20120100144A1 (en) Biomarker and Treatment for Cancer
KR102133432B1 (en) A marker for diagnosis of lung cancer
KR102260756B1 (en) Compositiion for predicting or diagnosing inverted papilloma and method for predicting or diagnosing using the same
JP2024012078A (en) Novel biomarker for predicting prognosis of treatment of her2-positive breast cancer and use thereof
KR20240033766A (en) Copine1 gene marker for prognosing metastasis of HER2 positive breast cancer and uses thereof
KR20230086462A (en) Novel Biomarker for Predicting Therapeutic Response and Prognosis of Metastatic Breast Cancer To Chemotherapeutic Agents and Uses Thereof
KR101188693B1 (en) Prxi, a marker for diagnosing cutaneous Squamous Cell Carcinoma and uses thereof
KR101179651B1 (en) NQO-1, a marker for diagnosing cutaneous Squamous Cell Carcinoma and uses thereof

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant