KR101559974B1 - Recombinant protein for siRNA delivery and composition comprising the same - Google Patents
Recombinant protein for siRNA delivery and composition comprising the same Download PDFInfo
- Publication number
- KR101559974B1 KR101559974B1 KR1020130117420A KR20130117420A KR101559974B1 KR 101559974 B1 KR101559974 B1 KR 101559974B1 KR 1020130117420 A KR1020130117420 A KR 1020130117420A KR 20130117420 A KR20130117420 A KR 20130117420A KR 101559974 B1 KR101559974 B1 KR 101559974B1
- Authority
- KR
- South Korea
- Prior art keywords
- sirna
- protein
- recombinant protein
- delivery
- seq
- Prior art date
Links
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 125
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 125
- 108020004459 Small interfering RNA Proteins 0.000 title claims abstract description 28
- 239000000203 mixture Substances 0.000 title claims abstract description 19
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 claims abstract description 63
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 claims abstract description 53
- 102000026932 siRNA binding proteins Human genes 0.000 claims abstract description 38
- 108091008481 siRNA binding proteins Proteins 0.000 claims abstract description 38
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 36
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 30
- 201000011510 cancer Diseases 0.000 claims abstract description 30
- 230000027455 binding Effects 0.000 claims abstract description 20
- 210000004027 cell Anatomy 0.000 claims description 84
- 108090000623 proteins and genes Proteins 0.000 claims description 60
- 102000004169 proteins and genes Human genes 0.000 claims description 43
- 230000004570 RNA-binding Effects 0.000 claims description 16
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 8
- 239000000710 homodimer Substances 0.000 claims description 8
- 238000000034 method Methods 0.000 claims description 8
- 241000724280 Tomato aspermy virus Species 0.000 claims description 7
- 210000004899 c-terminal region Anatomy 0.000 claims description 6
- 108010044426 integrins Proteins 0.000 claims description 6
- 102000006495 integrins Human genes 0.000 claims description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims 10
- 230000008685 targeting Effects 0.000 abstract description 12
- 108090000790 Enzymes Proteins 0.000 abstract description 5
- 102000004190 Enzymes Human genes 0.000 abstract description 5
- 108010054624 red fluorescent protein Proteins 0.000 description 35
- 150000001413 amino acids Chemical group 0.000 description 18
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 15
- 230000014509 gene expression Effects 0.000 description 15
- 108020004999 messenger RNA Proteins 0.000 description 14
- 201000010099 disease Diseases 0.000 description 11
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 11
- 230000035699 permeability Effects 0.000 description 11
- 239000003814 drug Substances 0.000 description 10
- 238000001962 electrophoresis Methods 0.000 description 9
- 238000011282 treatment Methods 0.000 description 9
- 230000012202 endocytosis Effects 0.000 description 8
- 108010078791 Carrier Proteins Proteins 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- 230000030279 gene silencing Effects 0.000 description 7
- 230000003834 intracellular effect Effects 0.000 description 7
- 230000002829 reductive effect Effects 0.000 description 7
- 230000002441 reversible effect Effects 0.000 description 7
- AFCARXCZXQIEQB-UHFFFAOYSA-N N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]-2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidine-5-carboxamide Chemical compound O=C(CCNC(=O)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F)N1CC2=C(CC1)NN=N2 AFCARXCZXQIEQB-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 230000015556 catabolic process Effects 0.000 description 6
- SDZRWUKZFQQKKV-JHADDHBZSA-N cytochalasin D Chemical compound C([C@H]1[C@@H]2[C@@H](C([C@@H](O)[C@H]\3[C@]2([C@@H](/C=C/[C@@](C)(O)C(=O)[C@@H](C)C/C=C/3)OC(C)=O)C(=O)N1)=C)C)C1=CC=CC=C1 SDZRWUKZFQQKKV-JHADDHBZSA-N 0.000 description 6
- 238000006731 degradation reaction Methods 0.000 description 6
- 108091006047 fluorescent proteins Proteins 0.000 description 6
- 102000034287 fluorescent proteins Human genes 0.000 description 6
- 238000012226 gene silencing method Methods 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 210000000805 cytoplasm Anatomy 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 210000001163 endosome Anatomy 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 238000004445 quantitative analysis Methods 0.000 description 5
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 4
- 206010057190 Respiratory tract infections Diseases 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 229920006317 cationic polymer Polymers 0.000 description 4
- 231100000135 cytotoxicity Toxicity 0.000 description 4
- 230000003013 cytotoxicity Effects 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 230000009368 gene silencing by RNA Effects 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- AKUVRZKNLXYTJX-UHFFFAOYSA-N 3-benzylazetidine Chemical compound C=1C=CC=CC=1CC1CNC1 AKUVRZKNLXYTJX-UHFFFAOYSA-N 0.000 description 3
- 102000007469 Actins Human genes 0.000 description 3
- 108010085238 Actins Proteins 0.000 description 3
- 208000023275 Autoimmune disease Diseases 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102000006382 Ribonucleases Human genes 0.000 description 3
- 108010083644 Ribonucleases Proteins 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 206010064930 age-related macular degeneration Diseases 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 108010038633 aspartylglutamate Proteins 0.000 description 3
- 125000002091 cationic group Chemical group 0.000 description 3
- -1 cationic phospholipid Chemical class 0.000 description 3
- 229960001657 chlorpromazine hydrochloride Drugs 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 238000000799 fluorescence microscopy Methods 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 230000015788 innate immune response Effects 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 230000004770 neurodegeneration Effects 0.000 description 3
- 208000015122 neurodegenerative disease Diseases 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 238000003757 reverse transcription PCR Methods 0.000 description 3
- 238000004088 simulation Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- QDRGPQWIVZNJQD-CIUDSAMLSA-N Ala-Arg-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(O)=O QDRGPQWIVZNJQD-CIUDSAMLSA-N 0.000 description 2
- UISQLSIBJKEJSS-GUBZILKMSA-N Arg-Arg-Ser Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(O)=O UISQLSIBJKEJSS-GUBZILKMSA-N 0.000 description 2
- QKSAZKCRVQYYGS-UWVGGRQHSA-N Arg-Gly-His Chemical compound N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O QKSAZKCRVQYYGS-UWVGGRQHSA-N 0.000 description 2
- FSNVAJOPUDVQAR-AVGNSLFASA-N Arg-Lys-Arg Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FSNVAJOPUDVQAR-AVGNSLFASA-N 0.000 description 2
- CVXXSWQORBZAAA-SRVKXCTJSA-N Arg-Lys-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCN=C(N)N CVXXSWQORBZAAA-SRVKXCTJSA-N 0.000 description 2
- CLICCYPMVFGUOF-IHRRRGAJSA-N Arg-Lys-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O CLICCYPMVFGUOF-IHRRRGAJSA-N 0.000 description 2
- PYZPXCZNQSEHDT-GUBZILKMSA-N Arg-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N PYZPXCZNQSEHDT-GUBZILKMSA-N 0.000 description 2
- VWADICJNCPFKJS-ZLUOBGJFSA-N Asn-Ser-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O VWADICJNCPFKJS-ZLUOBGJFSA-N 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- NNQHEEQNPQYPGL-FXQIFTODSA-N Gln-Ala-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(O)=O NNQHEEQNPQYPGL-FXQIFTODSA-N 0.000 description 2
- JRHPEMVLTRADLJ-AVGNSLFASA-N Gln-Lys-Lys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)N)N JRHPEMVLTRADLJ-AVGNSLFASA-N 0.000 description 2
- ZCOJVESMNGBGLF-GRLWGSQLSA-N Glu-Ile-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O ZCOJVESMNGBGLF-GRLWGSQLSA-N 0.000 description 2
- UXSATKFPUVZVDK-KKUMJFAQSA-N His-Lys-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CN=CN1)N UXSATKFPUVZVDK-KKUMJFAQSA-N 0.000 description 2
- UBHUJPVCJHPSEU-GRLWGSQLSA-N Ile-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N UBHUJPVCJHPSEU-GRLWGSQLSA-N 0.000 description 2
- URJUVJDTPXCQFL-IHPCNDPISA-N Leu-Trp-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC3=CN=CN3)C(=O)O)N URJUVJDTPXCQFL-IHPCNDPISA-N 0.000 description 2
- WZVSHTFTCYOFPL-GARJFASQSA-N Lys-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCCCN)N)C(=O)O WZVSHTFTCYOFPL-GARJFASQSA-N 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- WXHHTBVYQOSYSL-FXQIFTODSA-N Met-Ala-Ser Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O WXHHTBVYQOSYSL-FXQIFTODSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- FYPGHGXAOZTOBO-IHRRRGAJSA-N Pro-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@@H]2CCCN2 FYPGHGXAOZTOBO-IHRRRGAJSA-N 0.000 description 2
- WTWGOQRNRFHFQD-JBDRJPRFSA-N Ser-Ala-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WTWGOQRNRFHFQD-JBDRJPRFSA-N 0.000 description 2
- YQQKYAZABFEYAF-FXQIFTODSA-N Ser-Glu-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQQKYAZABFEYAF-FXQIFTODSA-N 0.000 description 2
- PPCZVWHJWJFTFN-ZLUOBGJFSA-N Ser-Ser-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O PPCZVWHJWJFTFN-ZLUOBGJFSA-N 0.000 description 2
- ROLGIBMFNMZANA-GVXVVHGQSA-N Val-Glu-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C(C)C)N ROLGIBMFNMZANA-GVXVVHGQSA-N 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 108010006195 arginyl-glycyl-aspartyl-cysteine Proteins 0.000 description 2
- FVDYHOGCIRNKAY-UHFFFAOYSA-N benzyl thiohypofluorite Chemical compound FSCC1=CC=CC=C1 FVDYHOGCIRNKAY-UHFFFAOYSA-N 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 239000012888 bovine serum Substances 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 2
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 2
- 108010038983 glycyl-histidyl-lysine Proteins 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 108010016686 methionyl-alanyl-serine Proteins 0.000 description 2
- 238000007431 microscopic evaluation Methods 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 108010005652 splenotritin Proteins 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- AEGSIYIIMVBZQU-CIUDSAMLSA-N (3s)-3-[[2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]acetyl]amino]-4-[[(1r)-1-carboxy-2-sulfanylethyl]amino]-4-oxobutanoic acid Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CS)C(O)=O AEGSIYIIMVBZQU-CIUDSAMLSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- RAXXELZNTBOGNW-UHFFFAOYSA-N 1H-imidazole Chemical compound C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 1
- VZSRBBMJRBPUNF-UHFFFAOYSA-N 2-(2,3-dihydro-1H-inden-2-ylamino)-N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]pyrimidine-5-carboxamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C(=O)NCCC(N1CC2=C(CC1)NN=N2)=O VZSRBBMJRBPUNF-UHFFFAOYSA-N 0.000 description 1
- WQVYAWIMAWTGMW-ZLUOBGJFSA-N Ala-Asp-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N WQVYAWIMAWTGMW-ZLUOBGJFSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- WEDGJJRCJNHYSF-SRVKXCTJSA-N Asp-Cys-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)N WEDGJJRCJNHYSF-SRVKXCTJSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102100021277 Beta-secretase 2 Human genes 0.000 description 1
- 101710150190 Beta-secretase 2 Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- CEZSLNCYQUFOSL-BQBZGAKWSA-N Cys-Arg-Gly Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O CEZSLNCYQUFOSL-BQBZGAKWSA-N 0.000 description 1
- OLIYIKRCOZBFCW-ZLUOBGJFSA-N Cys-Asp-Cys Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CS)N)C(=O)O OLIYIKRCOZBFCW-ZLUOBGJFSA-N 0.000 description 1
- 238000000116 DAPI staining Methods 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- WZZSKAJIHTUUSG-ACZMJKKPSA-N Glu-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(O)=O WZZSKAJIHTUUSG-ACZMJKKPSA-N 0.000 description 1
- OAGVHWYIBZMWLA-YFKPBYRVSA-N Glu-Gly-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)NCC(O)=O OAGVHWYIBZMWLA-YFKPBYRVSA-N 0.000 description 1
- QSTLUOIOYLYLLF-WDSKDSINSA-N Gly-Asp-Glu Chemical compound [H]NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O QSTLUOIOYLYLLF-WDSKDSINSA-N 0.000 description 1
- UFPXDFOYHVEIPI-BYPYZUCNSA-N Gly-Gly-Asp Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O UFPXDFOYHVEIPI-BYPYZUCNSA-N 0.000 description 1
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 231100000002 MTT assay Toxicity 0.000 description 1
- 238000000134 MTT assay Methods 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 206010061603 Respiratory syncytial virus infection Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 108700012920 TNF Proteins 0.000 description 1
- 244000299461 Theobroma cacao Species 0.000 description 1
- 235000005764 Theobroma cacao ssp. cacao Nutrition 0.000 description 1
- 235000005767 Theobroma cacao ssp. sphaerocarpum Nutrition 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 229960004104 amiloride hydrochloride Drugs 0.000 description 1
- LTKVFMLMEYCWMK-UHFFFAOYSA-N amiloride hydrochloride dihydrate Chemical compound [H+].O.O.[Cl-].NC(=N)NC(=O)C1=NC(Cl)=C(N)N=C1N LTKVFMLMEYCWMK-UHFFFAOYSA-N 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 235000001046 cacaotero Nutrition 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- IMQSIXYSKPIGPD-UHFFFAOYSA-N filipin III Natural products CCCCCC(O)C1C(O)CC(O)CC(O)CC(O)CC(O)CC(O)CC(O)C(C)=CC=CC=CC=CC=CC(O)C(C)OC1=O IMQSIXYSKPIGPD-UHFFFAOYSA-N 0.000 description 1
- IMQSIXYSKPIGPD-YQRUMEKGSA-N filipin III Chemical compound CCCCC[C@@H](O)[C@@H]1[C@@H](O)C[C@@H](O)C[C@@H](O)C[C@@H](O)C[C@@H](O)C[C@@H](O)C[C@H](O)\C(C)=C\C=C\C=C\C=C\C=C\[C@H](O)[C@@H](C)OC1=O IMQSIXYSKPIGPD-YQRUMEKGSA-N 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 210000003953 foreskin Anatomy 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- VMPHSYLJUKZBJJ-UHFFFAOYSA-N lauric acid triglyceride Natural products CCCCCCCCCCCC(=O)OCC(OC(=O)CCCCCCCCCCC)COC(=O)CCCCCCCCCCC VMPHSYLJUKZBJJ-UHFFFAOYSA-N 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 229960003511 macrogol Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- 108020004084 membrane receptors Proteins 0.000 description 1
- 210000001700 mitochondrial membrane Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 208000030925 respiratory syncytial virus infectious disease Diseases 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 108091069025 single-strand RNA Proteins 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- A61K38/1761—Apoptosis related proteins, e.g. Apoptotic protease-activating factor-1 (APAF-1), Bax, Bax-inhibitory protein(s)(BI; bax-I), Myeloid cell leukemia associated protein (MCL-1), Inhibitor of apoptosis [IAP] or Bcl-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/555—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound pre-targeting systems involving an organic compound, other than a peptide, protein or antibody, for targeting specific cells
Abstract
본 발명은 siRNA 결합 단백질 및 RGD (Arg-Gly-Asp) 펩타이드를 포함하는 siRNA 전달용 재조합 단백질 및 이를 포함하는 조성물에 관한 것이다. 보다 구체적으로는 다양한 목적의 siRNA가 상기 siRNA 전달용 재조합 단백질에 결합하여 각종 분해효소와 같은 외부공격으로부터 안정성을 확보할 수 있으며, 다양한 암세포를 표적으로 하는 RGD 펩타이드에 의하여 암세포에 선택적 결합력을 가질 수 있다.The present invention relates to a recombinant protein for siRNA delivery comprising a siRNA binding protein and an RGD (Arg-Gly-Asp) peptide, and a composition comprising the same. More specifically, siRNAs for various purposes bind to the recombinant proteins for siRNA delivery, thereby securing stability against external attack such as various decomposing enzymes. The RGD peptide targeting various cancer cells can have a selective binding ability to cancer cells have.
Description
본 발명은 siRNA 결합 단백질 및 RGD (Arg-Gly-Asp) 펩타이드를 포함하는 siRNA 전달용 재조합 단백질 및 이를 포함하는 조성물에 관한 것이다. 보다 구체적으로는 다양한 목적의 siRNA가 상기 siRNA 전달용 재조합 단백질에 결합하여 각종 분해효소와 같은 외부공격으로부터 안정성을 확보할 수 있으며, 다양한 암세포를 표적으로 하는 RGD 펩타이드에 의하여 암세포에 선택적 결합력을 가질 수 있다.
The present invention relates to a recombinant protein for siRNA delivery comprising a siRNA binding protein and an RGD (Arg-Gly-Asp) peptide, and a composition comprising the same. More specifically, siRNAs for various purposes bind to the recombinant proteins for siRNA delivery, thereby securing stability against external attack such as various decomposing enzymes. The RGD peptide targeting various cancer cells can have a selective binding ability to cancer cells have.
RNA 간섭현상(RNA interference, RNAi)은 표적 유전자의 mRNA와 상동인 서열을 가지는 센스 RNA와 이것과 상보적인 서열을 가지는 안티센스 RNA로 구성되는 이중사슬 RNA(double strand RNA)을 세포 등에 도입하여 선택적으로 표적 유전자의 mRNA의 분해를 유도하거나 표적 유전자의 발현을 억제할 수 있는 현상을 말한다. RNAi 는 처음에 선충에서 발견되었지만, 현재는 효모, 곤충, 식물, 인간 등 각종 동식물에서 매우 잘 보존이 되어 있는 생명현상으로 관찰되고 있다. RNA interference (RNAi) is a phenomenon in which a double strand RNA consisting of a sense RNA having a sequence homologous to the mRNA of a target gene and an antisense RNA having a sequence complementary thereto is introduced into a cell, Refers to a phenomenon capable of inducing degradation of mRNA of a target gene or inhibiting expression of a target gene. RNAi was initially found in nematodes, but is now being observed as a very well-preserved life phenomenon in yeast, insects, plants, humans, and other plants and animals.
small interference RNA(siRNA)는 RNAi를 유도하는 물질로서, 약 20 내지 30개의 뉴클레오타이드(nucleotides)로 구성된 짧은 RNA 이중나선 가닥을 말한다. siRNA를 세포 내로 주입시켜 이 siRNA와 염기서열이 상보적인 mRNA를 표적으로 삼아 유전자 발현을 억제하게 된다. siRNA는 질병에 대한 치료 효과를 가지며, 쉬운 제조법 및 높은 표적 선택성 등으로 인해 표적이 되는 생명 프로세스를 조절할 수 있는 효과적인 수단으로 각광을 받고 있다. Small interference RNA (siRNA) is a short RNA duplex strand composed of about 20 to 30 nucleotides that induces RNAi. The siRNA is injected into the cell and the gene expression is suppressed by targeting the mRNA complementary to the siRNA and the base sequence. siRNA has a therapeutic effect on diseases and is attracting attention as an effective means of controlling the target life process due to easy preparation and high target selectivity.
현재 siRNA를 이용하여 치료할 수 있는 질환으로, 암, 바이러스 감염 질환, 자가면역 질환, 신경퇴행성 질환 등이 연구되고 있으며, 임상적 시도로서 노인성 황반변성 (베바시라닙; Opko Health, Inc., Miami, FL, USA; 임상 3상), 호흡기 신시치아 바이러스 감염증 (ALN-RSV01; Alnylam, Cambridge, MA, USA; 임상 2상)에 대한 치료제로서의 가능성이 보고되었다 (Melnikova I. Nat Rev Drug Discov 2007, 6, 863-864). 또한 트랜스페린을 표적으로 하는 사이클로덱스트린 기반의 나노입자 중합체 (CALAA-01; Calando Pharmaceuticals, Pasadena, CA, USA; 임상 1상)를 이용하여 인간 암 치료에서 siRNA의 전달 시스템이 가능함이 보고되었다 (Oh YK. et al., Adv Drug Deliver Rev 2009, 61, 850-862).Currently, siRNA-based therapies for cancer, viral infections, autoimmune diseases, and neurodegenerative diseases have been studied. As clinical trials, there have been reports of senile AMD (Opko Health, Inc., Miami, FLN, USA), and respiratory syncytial virus infection (ALN-RSV01; Alnylam, Cambridge, MA, USA;
그러나, siRNA는 안정성이 낮아 생체 내에서 단시간에 분해되며, siRNA의 음이온성으로 인하여 같은 음전하를 띄는 세포막을 쉽게 투과하기 힘들어 세포 내로의 전달성이 떨어진다는 문제가 있어, 이들의 세포 내 전달을 용이하게 하는 효과적인 전달체 제조 기술이 요구되고 있다. 이와 같이 siRNA를 세포 내로 효율적으로 전달하기 위해서는, 분해효소 저항성을 가지며 장시간 생체 내에서 순환하며 임상적으로 가능한 주입경로를 통해 표적 세포에 도달할 수 있고 세포투과 후에는 효과적인 세포질 방출이 가능한 효과적인 새로운 전달 시스템이 필요하다. However, since siRNA has low stability, it is degraded in a short time in the living body, and it is difficult to easily penetrate the cell membrane having the same negative charge due to the anionic nature of the siRNA, An effective delivery vehicle manufacturing technique is required. In order to efficiently deliver the siRNA into cells, it is necessary to efficiently deliver the siRNA into the cell, which is capable of reaching the target cell through a pathway that is resistant to the enzyme and circulated in the body for a long time and clinically possible, We need a system.
기존의 siRNA 전달체로, siRNA를 발현하는 재조합 플라스미드 또는 바이러스 벡터가 사용되거나, 리포펙틴, 리포펙타민, 셀펙틴, 양이온성 인지질 나노입자, 양이온성 고분자, 또는 리포좀에 기반한 전달체가 주로 사용되었다. 그러나, 바이러스성 전달체의 경우 전달하려는 유전자의 크기에 제한을 받게 되고 바이러스 벡터의 표면 단백질의 면역원성으로 인한 면역 부작용을 일으켜 체내 안정성이 보장되지 못하는 문제가 지적되었다. 또한, 양이온성 분자 또는 합성 고분자를 이용한 전달체의 경우 세포 내로의 수송 효율이 낮으며 세포 내로의 유전자 전달과정에서 유발될 수 있는 세포 독성에 대한 문제가 지적되었다.As a conventional siRNA delivery vehicle, recombinant plasmids or viral vectors expressing siRNA were used, or a carrier based on lipofectin, lipofectamine, cell pectin, cationic phospholipid nanoparticles, cationic polymer, or liposome was mainly used. However, it has been pointed out that the viral transducer is limited in the size of the gene to be transduced, and the immunogenicity of the surface protein of the viral vector causes immunosuppressive effects, thus failing to ensure the stability in the body. In addition, the transport efficiency of the carrier using the cationic molecule or the synthetic polymer is low, and the problem of cytotoxicity that can be induced in gene transfer into the cell has been pointed out.
또한 양이온성 합성 고분자 전달체의 경우 높은 양이온 전하 밀도와 제한된 생분해성으로 인해 세포 내로의 siRNA 전달과정에서 세포막 혹은 미토콘드리아 막을 파괴함으로써 세포괴사나 세포사멸이 유발될 수 있는 세포 독성에 대한 문제점이 있어 왔다 (Cho KC. et al., Macromol. Res. 2006, 14, 348-353). 따라서 독성문제를 해결하기 위해 독성이 감소된 다양한 신규 양이온성 고분자를 제조하거나 기존의 양이온성 고분자를 변형함으로써 독성이 감소된 양이온성 고분자 전달체를 개발하여 왔으나 여전히 siRNA가 지니는 낮은 전하 밀도와 고유의 견고한 구조 때문에 세포 내로의 수송효율이 낮다는 문제점이 남아있다.In addition, the cationic synthetic polymeric carrier has a problem of cytotoxicity that can induce cell death or apoptosis by destroying the cell membrane or mitochondrial membrane during siRNA delivery into cells due to high cationic charge density and limited biodegradability (Cho KC et al., Macromol. Res., 2006, 14, 348-353). Therefore, in order to solve the toxicity problem, a cationic polymer transporter having reduced toxicity has been developed by preparing a variety of new cationic polymers with reduced toxicity or by modifying existing cationic polymers. However, the low charge density and intrinsic rigidity There is a problem that the efficiency of transport into cells is low due to the structure.
또한, 상기 siRNA 전달체들은 모두 특이적인 표적성을 가지고 있지 않아, 세포구별 능력 없이 단순히 세포의 투과성만을 구현하였다는 문제가 있다. 이러한 배경하에, 본 발명자들은 암표적 RGD 펩타이드와 RNA 결합 2b 단백질을 융합하여 암세포 특이적인 표적성 및 세포투과성을 모두 나타내는 siRNA 전달용 재조합 단백질을 개발하였다. 이를 통해 생체독성을 획기적으로 감소시키고 암세포 선택적인 siRNA 전달이 가능하도록 하여 세포독성의 위험성이 감소된, siRNA 전달용 재조합 단백질 및 이를 포함하는 조성물을 제공하도록 하였다.
In addition, since all of the siRNA transporters do not have a specific targeting property, they have a problem that they only implement cell permeability without cell differentiation ability. Under these circumstances, the present inventors have developed a recombinant protein for siRNA delivery that fuses cancer-specific RGD peptide and RNA-bound 2b protein to express both cancer cell-specific targeting and cell permeability. Thus, the present invention provides a recombinant protein for siRNA delivery and a composition comprising the same, wherein the risk of cytotoxicity is reduced by enabling the reduction of biotoxicity dramatically and the delivery of cancer cell selective siRNA is enabled.
본 발명의 목적은 siRNA 결합 단백질 및 RGD (Arg-Gly-Asp) 펩타이드를 포함하며, 상기 siRNA 결합 단백질의 N 말단 또는 C 말단에 RGD 펩타이드가 융합됨을 특징으로 하는 siRNA 전달용 재조합 단백질을 제공하는 것이다.An object of the present invention is to provide a recombinant protein for siRNA delivery, which comprises an siRNA binding protein and an RGD (Arg-Gly-Asp) peptide, wherein the RGD peptide is fused to the N-terminal or C-terminal of the siRNA binding protein .
본 발명의 또 다른 목적은 siRNA 결합 단백질의 N 말단 또는 C 말단에 RGD 펩타이드를 융합시키는 단계를 포함하는 siRNA 전달용 재조합 단백질 제조방법을 제공하는 것이다.It is still another object of the present invention to provide a method for producing a recombinant protein for siRNA delivery comprising the step of fusing an RGD peptide at the N-terminal or C-terminal of an siRNA binding protein.
본 발명의 또 다른 목적은 siRNA 전달용 재조합 단백질 및 상기 siRNA 전달용 재조합 단백질에 결합된 siRNA를 포함하는 siRNA 전달용 조성물을 제공하는 것이다.It is still another object of the present invention to provide a siRNA delivery composition comprising a recombinant protein for siRNA delivery and siRNA bound to the siRNA delivery recombinant protein.
본 발명의 또 다른 목적은 siRNA 결합 단백질의 N 말단 또는 C 말단에 RGD 펩타이드를 융합시켜 siRNA 전달용 재조합 단백질을 제조하는 단계; 및 상기 siRNA 전달용 재조합 단백질을 siRNA 와 반응시키는 단계를 포함하는 siRNA 전달용 조성물 제조방법을 제공하는 것이다.It is still another object of the present invention to provide a method for producing siRNA, which comprises: preparing a recombinant protein for siRNA delivery by fusing an RGD peptide at the N-terminal or C-terminal of an siRNA binding protein; And a step of reacting the recombinant protein for siRNA delivery with siRNA.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 국한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당업자에게 명확하게 이해될 수 있을 것이다.
However, the technical problem to be solved by the present invention is not limited to the above-mentioned problems, and other matters not mentioned can be clearly understood by those skilled in the art from the following description.
상기의 목적을 해결하기 위한 양태로서, 본 발명은 siRNA 결합 단백질 및 표적지향성 RGD (Arg-Gly-Asp) 펩타이드를 포함하며, 상기 siRNA 결합 단백질의 N 말단 또는 C 말단에 RGD 펩타이드가 융합됨을 특징으로 하는, siRNA 전달용 재조합 단백질에 관한 것이다. In order to solve the above object, the present invention provides a siRNA binding protein comprising a siRNA binding protein and a target-directed RGD (Arg-Gly-Asp) peptide, characterized in that the RGD peptide is fused to the N- or C- To a recombinant protein for siRNA delivery.
상기 siRNA 결합 단백질은 토마토 아스퍼미 바이러스(Tomato Aspermy Virus)에 존재하는 단백질이며 20 내지 23 뉴클레이오티드 길이의 이중가닥 RNA와 높은 친화력으로 결합하는 단백질일 수 있다. 바람직하게는 RNA 결합 2b 단백질(RNA binding 2b protein, GenBank 등재번호가 CAC86465.1)일 수 있으며, 더 바람직하게는 서열번호 1의 아미노산 서열을 포함하는 단백질일 수 있다. 가장 바람직한 예로는 서열번호 1의 아미노산 서열을 가지는 RNA 결합 2b 단백질(RNA binding 2b protein, GenBank 등재번호가 CAC86465.1)일 수 있으나, 이에 한정되지 않고 siRNA와 결합체를 형성할 수 있는 한, 상기 서열번호 1의 일부를 치환, 삽입 또는 결실한 변형체를 모두 포함한다. 또한, 본 발명의 siRNA 결합 단백질은 호모다이머(homodimer)를 형성하며, 각 siRNA 결합 단백질의 N 말단 또는 C 말단에 표적지향성 RGD (Arg-Gly-Asp) 펩타이드가 융합될 수 있다.The siRNA binding protein is a protein present in Tomato Aspermy Virus and may be a protein that binds with high affinity to double stranded RNA of 20 to 23 nucleotides in length. Preferably an RNA-binding 2b protein (RNA binding 2b protein, GenBank accession number CAC86465.1), and more preferably a protein comprising the amino acid sequence of SEQ ID NO: 1. As the most preferred example, the RNA binding 2b protein having the amino acid sequence of SEQ ID NO: 1 (RNA binding 2b protein, GenBank accession number CAC86465.1) may be used, but not limited thereto, Inserted, or deleted in a portion of SEQ ID NO: 1. In addition, the siRNA binding protein of the present invention forms a homodimer, and a target-directed RGD (Arg-Gly-Asp) peptide can be fused to the N-terminus or C-terminus of each siRNA binding protein.
본 발명의 일 구현예에 따른 RNA 결합 2b 단백질은 식물, 즉 토마토 아스퍼미 바이러스(Tomato Aspermy Virus)에 존재하는 단백질로서 20 이상, 바람직하게는 20 내지 23 뉴클레오티드 길이의 이중가닥 RNA와 높은 친화력으로 결합할 수 있으나, 단일가닥 RNA, 이중가닥 DNA 및 리보솜 RNA와는 결합하지 않는 특이성을 가지므로, 본 발명의 siRNA 결합 단백질로 적합하며, RNA 결합 2b 단백질은 호모다이머(homodimer)를 형성함으로써 siRNA와 결합체를 형성하게 된다. The RNA-binding 2b protein according to an embodiment of the present invention is a protein present in a plant, that is, Tomato Aspermy Virus, and binds with double-stranded RNA having a length of 20 or more, preferably 20 to 23 nucleotides, But it is suitable as the siRNA binding protein of the present invention because it has the specificity not to bind single strand RNA, double strand DNA and ribosomal RNA, and the RNA binding 2b protein forms a homodimer, Respectively.
본 발명에서 RNA 결합 2b 단백질은 유전자 재조합 방법을 이용하여 다양한 표적지향성 펩타이드를 도입하여 표적 세포로의 전달성을 향상시킬 수 있고, 한편으로는 RNA 결합 2b 단백질의 호모다이머(homodimer)가 형성하는 결합자리에 siRNA를 결합시킴으로써 외부 공격으로부터 siRNA를 보호하여 생체 내 안정성을 높일 수 있어, 효과적인 siRNA 전달체로 이용할 수 있다는 장점이 있다.In the present invention, the RNA-binding 2b protein can be transferred to target cells by introducing a variety of target-oriented peptides by using a recombinant method, and on the other hand, the RNA- SiRNA binding to the site can protect the siRNA from external attack and enhance the stability in vivo, so that it can be used as an effective siRNA delivery system.
본 발명의 표적지향성 펩타이드는 siRNA 전달용 재조합 단백질의 N 말단 또는 C 말단에 도입되어 표적 세포로의 전달을 지시하는 펩타이드를 말하며, 상기 표적지향성 펩타이드는 암세포에 특이적으로 과발현되어 있는 인테그린(integrin) 막단백질에 결합하며 HeyA8, A549, MDA-MB231, SKOV3ip1, B16F10 또는 HeLa 세포와 같은 각종 암세포를 표적세포로 하는 펩타이드일 수 있으며, 바람직하게는 서열번호 3의 아미노산 서열을 포함하는 펩타이드일 수 있으며, 더 바람직하게는 RGD 펩타이드(Cys-Asp-Cys-Arg-Gly-Asp-Cys-Phe-Cys, 서열번호 3) 일 수 있으나, 이에 제한되는 것은 아니다. RGD 펩타이드는 Arg-Gly-Asp 서열을 포함하는 것을 특징으로 하며, Arg-Gly-Asp 서열 앞뒤의 서열은 암세포를 표적으로 하는 펩타이드가 유지될 수 있으면 자유롭게 변경하여 사용할 수 있다. The targeting peptide of the present invention refers to a peptide that is introduced at the N-terminus or C-terminus of a recombinant protein for siRNA delivery and directs the delivery to a target cell. The targeting peptide is an integrin that is specifically over- The peptide may be a peptide that binds to membrane proteins and uses various cancer cells such as HeyA8, A549, MDA-MB231, SKOV3ip1, B16F10 or HeLa cells as target cells, preferably a peptide comprising the amino acid sequence of SEQ ID NO: 3, More preferably an RGD peptide (Cys-Asp-Cys-Arg-Gly-Asp-Cys-Phe-Cys, SEQ ID NO: 3). The RGD peptide is characterized in that it contains an Arg-Gly-Asp sequence, and the sequences before and after the Arg-Gly-Asp sequence can be freely modified and used as long as the peptide targeting the cancer cells can be retained.
RGD 펩타이드는 siRNA 전달용 siRNA 전달용 재조합 단백질의 외부에 노출되어, 암세포에 특이적으로 과발현되어 있는 인테그린(integrin) 막단백질에 결합함으로써 암세포 특이적인 세포 타겟팅을 나타낼 수 있다.RGD peptides can be exposed to the outside of siRNA delivery siRNA recombinant recombinant proteins and can be targeted to cancer cell-specific cell targeting by binding to integrin membrane proteins that are specifically overexpressed in cancer cells.
본 발명의 일 구현예로, 상기 siRNA 결합 단백질과 표적지향성 펩타이드 사이에 링커 펩타이드를 추가로 포함할 수 있다.In one embodiment of the present invention, a linker peptide may be further included between the siRNA binding protein and the target-directed peptide.
본 발명의 링커 펩타이드는 RNA 결합 2b 단백질과 RGD 펩타이드를 연결하는 펩타이드로서, RNA 결합 2b 단백질이 호모다이머(homodimer)를 형성하는 것을 방해하지 않으면서 결과적으로 siRNA 전달용 재조합 단백질이 siRNA 결합능력을 갖도록 하며, 또한 RGD 펩타이드가 자유로이 표면에 노출되도록 하는 것이라면 특별히 제한되지 않는다. 바람직하게는, 상기 링커 펩타이드는 9 개의 아미노산으로 구성된 서열번호 2로 나타내는 펩타이드(GSGGGDEAD)일 수 있다.The linker peptide of the present invention is a peptide linking an RNA-bound 2b protein and an RGD peptide, so that the RNA-binding 2b protein does not interfere with the homodimer formation and consequently the recombinant protein for siRNA delivery has siRNA binding ability And is not particularly limited so long as it allows the RGD peptide to be freely exposed to the surface. Preferably, the linker peptide may be a peptide (GSGGGDEAD) represented by SEQ ID NO: 2 consisting of 9 amino acids.
보다 구체적인 양태로, 본 발명의 siRNA 전달용 재조합 단백질은 서열번호 4의 아미노산 서열로 이루어진 재조합 단백질을 포함하는 것일 수 있다.In a more specific embodiment, the recombinant protein for delivering siRNA of the present invention may comprise a recombinant protein consisting of the amino acid sequence of SEQ ID NO: 4.
본 발명의 일 구현예로, 하기 구조를 포함하는 siRNA 전달용 재조합 단백질일 수 있다.In one embodiment of the present invention, it may be a recombinant protein for siRNA delivery comprising the following structure.
A-B-CA-B-C
상기에서, A 는 siRNA 결합 단백질이며;In the above, A is an siRNA binding protein;
B 는 링커 펩타이드이며; 및B is a linker peptide; And
C 는 RGD 펩타이드이다.C is an RGD peptide.
본 발명의 다른 일 구현예로, 하기 구조를 포함하는 siRNA 전달용 재조합 단백질일 수 있다.In another embodiment of the present invention, it may be a recombinant protein for siRNA delivery comprising the following structure.
A-B-CA-B-C
상기에서, A 는 토마토 아스퍼미 바이러스(tomato aspermy virus)에서 유래한 RNA 결합 2b 단백질이며;In the above, A is an RNA-binding 2b protein derived from tomato aspermy virus;
B 는 링커 펩타이드이며; 및B is a linker peptide; And
C 는 RGD 펩타이드이다.C is an RGD peptide.
본 발명의 또 다른 일 구현예로, 하기 구조를 포함하는 siRNA 전달용 재조합 단백질일 수 있다.In another embodiment of the present invention, it may be a recombinant protein for siRNA delivery comprising the following structure.
A-B-CA-B-C
상기에서, A 는 서열번호 1의 아미노산 서열로 이루어진 siRNA 결합 단백질이며;In the above, A is an siRNA binding protein consisting of the amino acid sequence of SEQ ID NO: 1;
B 는 서열번호 2의 아미노산 서열로 이루어진 링커 펩타이드이며; 및B is a linker peptide consisting of the amino acid sequence of SEQ ID NO: 2; And
C 는 서열번호 3의 아미노산 서열로 이루어진 RGD 펩타이드이다.C is an RGD peptide consisting of the amino acid sequence of SEQ ID NO: 3.
본 발명의 구체적인 구현예로, RNA 결합 2b 단백질의 69번째 아미노산 자리에 링커 펩타이드 및 RGD 펩타이드가 순차적으로 연결된 siRNA 전달용 재조합 단백질을 디자인 하였고, 또한 실제로 상기 디자인된 siRNA 전달용 재조합 단백질을 대장균 대량발현시스템을 이용하여 제조하였다(실시예 1 참조).In a specific embodiment of the present invention, a recombinant protein for siRNA delivery in which the linker peptide and the RGD peptide are sequentially connected to the 69th amino acid site of the RNA-bound 2b protein was designed. In addition, the designed recombinant protein for siRNA delivery was mass- System (see Example 1).
상기 제조한 siRNA 전달용 재조합 단백질의 정량분석을 통하여 두 개의 siRNA 전달용 재조합 단백질 당 한 개의 siRNA duplex를 봉입할 수 있음을 확인하였다(실시예 1 참조).Quantitative analysis of the recombinant protein for siRNA delivery indicated that one siRNA duplex per two recombinant proteins for siRNA delivery could be encapsulated (see Example 1).
또한, 상기 siRNA 전달용 재조합 단백질은 MTT 분석 결과 5μM까지 우수한 생체적합성이 있음을 확인하였으며(실시예 3 참조), 산성 조건에서 siRNA 가 상기 siRNA 전달용 재조합 단백질로부터 해리되므로 엔도솜에서 세포질로의 방출 기전(endosomal escape)을 통하여 효과적으로 siRNA를 세포질로 전달할 수 있음을 확인하였다(실시예 4 참조). siRNA는 상기 siRNA 전달용 재조합 단백질이 형성하는 결합자리의 내부에 결합됨으로 각종 리보뉴클레아제에 의한 외부 공격으로부터 안정성을 유지하고(실시예 5 참조), 상기 siRNA 전달용 재조합 단백질 표면에 도입된 표적지향성 RGD 펩타이드에 의하여 암세포 선택적인 세포 투과성을 나타내며(실시예 6 참조), 세포질로 전달되어 표적 유전자의 사일런싱을 일으키므로(실시예 7 참조), siRNA 전달체로 유용하게 사용될 수 있다.As a result of MTT analysis, the recombinant protein for siRNA delivery showed excellent biocompatibility up to 5 μM (see Example 3). Since the siRNA is dissociated from the recombinant protein for siRNA delivery under acidic conditions, the release of cytoplasm from endosomes It was confirmed that siRNA could be efficiently transferred to the cytoplasm through endosomal escape (see Example 4). siRNA is bound to the inside of the binding site formed by the recombinant protein for siRNA delivery, so that stability is maintained from external attack by various ribonuclease (see Example 5), and the target introduced into the surface of the recombinant protein for siRNA delivery (See Example 6), and it is transferred to the cytoplasm to cause silencing of the target gene (see Example 7), so that it can be usefully used as an siRNA delivery vehicle.
또 다른 양태로서 본 발명은 상기 siRNA 전달용 재조합 단백질 및 siRNA를 포함하며, 상기 siRNA이 재조합 단백질 내부에 위치함을 특징으로 하는 siRNA 전달용 조성물에 관한 것이다. 바람직하게 siRNA 는 20 내지 30 개의 뉴클레오티드로 이루어질 수 있으며, 더 바람직하게는 서열번호 4의 센스 서열 및 서열번호 5의 안티센스 서열을 포함할 수 있으며, 가장 바람직한 예로 서열번호 4의 센스 서열 및 서열번호 5의 안티센스 서열일 수 있다.In another aspect, the present invention relates to a siRNA delivery composition comprising the siRNA-transferring recombinant protein and the siRNA, wherein the siRNA is located inside the recombinant protein. Preferably, the siRNA may comprise 20 to 30 nucleotides, more preferably the sense sequence of SEQ ID NO: 4 and the antisense sequence of SEQ ID NO: 5, most preferably the sense sequence of SEQ ID NO: 4 and SEQ ID NO: Lt; / RTI > sequence.
또 다른 양태로서, 본 발명은 siRNA 전달용 재조합 단백질 및 상기 siRNA 전달용 재조합 단백질에 결합된 siRNA를 포함하는, siRNA 전달용 조성물에 관한 것이다. 바람직하게 본 발명은 siRNA 결합 단백질은 호모다이머를 형성하고, 각 siRNA 결합 단백질의 N 말단 또는 C 말단에 RGD 펩타이드가 융합되며, 상기 siRNA 결합 단백질의 결합 자리에 siRNA 가 결합되어 있는 것인, siRNA 전달용 조성물일 수 있다.In another aspect, the present invention relates to a siRNA delivery composition comprising a recombinant protein for siRNA delivery and siRNA bound to the recombinant protein for siRNA delivery. Preferably, the siRNA binding protein forms a homodimer, wherein the RGD peptide is fused to the N-terminus or C-terminus of each siRNA binding protein, and siRNA is bound to the binding site of the siRNA binding protein. / RTI >
siRNA는 본 발명의 siRNA 전달용 재조합 단백질을 구성하는 siRNA 결합 단백질에 결합하므로, siRNA 전달용 재조합 단백질 내부에 보호된다. 이와 같이 siRNA 전달용 재조합 단백질 내부에 결합된 siRNA는 외부와 물리적으로 차단되므로 뉴클레아제(nuclease)와 같은 분해효소로부터 자유로워 안정성이 우수하다. 이와 같은 본 발명의 siRNA 전달용 조성물은 siRNA를 전달용 재조합 단백질 외부에 노출된 표적지향성 펩타이드에 의해 효과적으로 표적 세포에 결합한 후 엔도시토시스 (endocytosis) 에 의하여 세포 내로 투과될 수 있도록 한다. 세포 내 투과 후, siRNA 결합단백질과 결합되어 있는 siRNA는 세포 내 엔도솜(endosome)의 산성 조건에서 siRNA 결합단백질과 해리되어 엔도솜으로부터 세포질로 방출(endosomal escape)됨으로써 효과적으로 mRNA의 발현을 억제할 수 있다. 따라서, 질환 유전자를 포함하는 타겟 유전자 발현을 억제하고 질병치료가 가능하게 할 수 있다.The siRNA binds to the siRNA binding protein constituting the recombinant protein for siRNA delivery of the present invention and thus is protected inside the recombinant protein for siRNA delivery. As such, the siRNA bound to the inside of the recombinant protein for siRNA delivery is physically blocked from the outside, so that the siRNA is free from decomposition enzymes such as nuclease and is excellent in stability. The composition for delivering siRNA of the present invention binds siRNA effectively to a target cell by the target-oriented peptide exposed to the outside of the recombinant protein for delivery, and allows the siRNA to be intracellularly permeated by endocytosis. After intracellular permeation, the siRNA bound to the siRNA binding protein is dissociated from the siRNA binding protein under the acidic conditions of the endosome in the cell, and is released into the cytoplasm from the endosomes (endosomal escape), thereby effectively suppressing the expression of mRNA have. Therefore, it is possible to inhibit the expression of the target gene including the disease gene and to enable the treatment of the disease.
또 다른 양태로서, 본 발명은 siRNA 결합 단백질의 N 말단 또는 C 말단에 RGD 펩타이드를 융합시켜 siRNA 전달용 재조합 단백질을 제조하는 단계, 및 상기 siRNA 전달용 재조합 단백질을 siRNA 와 반응시키는 단계를 포함하는, siRNA 전달용 조성물 제조방법에 관한 것이다. 바람직하게, 상기 siRNA 결합 단백질은 토마토 아스퍼미 바이러스(tomato aspermy virus)에서 유래한 RNA 결합 2b 단백질일 수 있으며, 보다 바람직하게 서열번호 1의 아미노산 서열로 이루어진 것일 수 있다. 또한 상기 siRNA 결합 단백질은 호모다이머(homodimer)를 형성하여 N 말단 또는 C 말단에 RGD 펩타이드가 융합되도록 하는 것이 바람직하다.In another embodiment, the present invention provides a method for producing a recombinant protein, comprising: preparing a recombinant protein for siRNA delivery by fusing an RGD peptide at the N-terminal or C-terminal of an siRNA binding protein; and reacting the recombinant protein for siRNA delivery with siRNA. to a method for preparing a composition for delivering siRNA. Preferably, the siRNA binding protein may be an RNA-binding 2b protein derived from tomato aspermy virus, more preferably an amino acid sequence of SEQ ID NO: 1. It is also preferable that the siRNA binding protein forms a homodimer so that the RGD peptide is fused to the N-terminal or C-terminal.
바람직하게 상기 RGD 펩타이드는 서열번호 3의 아미노산 서열로 이루어진 것일 수 있으며, 암세포에 특이적으로 과발현되어 있는 인테그린(integrin) 막수용체에 결합한다. 가장 바람직하게는 siRNA 결합 단백질의 N 말단 또는 C 말단 및 RGD 펩타이드 사이에 링커 펩타이드를 융합시키는 단계를 더 포함할 수 있다.Preferably, the RGD peptide comprises the amino acid sequence of SEQ ID NO: 3 and binds to an integrin membrane receptor that is specifically over-expressed in cancer cells. Most preferably, fusing the linker peptide between the N-terminus or C-terminus of the siRNA binding protein and the RGD peptide.
또한 본 발명은 상기 siRNA 전달용 재조합 단백질 및 siRNA를 포함하며, 상기 siRNA 가 재조합 단백질의 내부에 위치함을 특징으로 하는, 암, 노인성 황반변성, 바이러스 감염 질환, 자가면역 질환 및 신경퇴행성 질환으로 이루어진 군에서 선택되는 siRNA 관련 질환의 치료용 조성물에 관한 것이다.The present invention also relates to a pharmaceutical composition comprising the siRNA-transferring recombinant protein and the siRNA, wherein the siRNA is located inside the recombinant protein, wherein the siRNA is in the form of a cancer, senile macular degeneration, viral infectious disease, autoimmune disease and neurodegenerative disease The present invention relates to a composition for treating an siRNA-related disease selected from the group consisting of:
siRNA는 질환 관련 유전자의 mRNA의 발현을 억제함으로써 질환 치료 효과를 유도할 수 있는 것이라면 제한 없이 사용할 수 있으며, 바람직하게는 20 내지 30 개의 뉴클레오티드로 이루어진 것을 포함한다. The siRNA may be used without limitation as long as it can induce the therapeutic effect of the disease by inhibiting the expression of the mRNA of the disease-related gene, preferably 20 to 30 nucleotides.
상기 siRNA 관련 질환은 이에 한정되지는 않지만, siRNA로 치료할 수 있음이 알려진 질환들을 포함할 수 있으며, 바람직하게는 암, 노인성 황반변성, 바이러스 감염 질환, 자가면역 질환 및 신경퇴행성 질환으로 이루어진 군에서 선택되는 질환을 포함할 수 있다. 상기 암은 유방암, 폐암, 두경부암, 뇌암, 복부암, 결장암, 식도암, 위암, 위장암, 간암, 설암, 신경아세포종, 골육종, 난소암, 췌장암, 전립선암, 빌립스 종양, 망막아세포종, 다발성 골수종, 피부암, 림프종 및 혈액암 등을 포함하나 특별히 이에 한정되지 않는다.The siRNA-related diseases may include, but are not limited to, diseases known to be treatable with siRNA, preferably selected from the group consisting of cancer, senile AMD, viral infectious disease, autoimmune disease, and neurodegenerative disease ≪ / RTI > Wherein the cancer is selected from the group consisting of breast cancer, lung cancer, head and neck cancer, brain cancer, abdominal cancer, colon cancer, esophageal cancer, stomach cancer, gastric cancer, liver cancer, stomach cancer, neuroblastoma, osteosarcoma, ovarian cancer, pancreatic cancer, prostate cancer, , Skin cancer, lymphoma, and blood cancer, but are not limited thereto.
상기 치료용 조성물은 사람을 포함하는 포유동물에 다양한 경로로 투여될 수 있으며, 목적하는 방법에 따라 경구 투여하거나 비경구투여(예를 들어, 정맥 내, 피하, 복강 내 또는 국소에 적용)할 수 있으며, 투여량은 환자의 상태 및 체중, 질병의 정도, 약물형태, 투여경로 및 시간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다.The therapeutic composition may be administered to a mammal including a human in various routes and may be administered orally or parenterally (for example, intravenously, subcutaneously, intraperitoneally or topically) depending on the intended method And the dose varies depending on the condition and the weight of the patient, the degree of disease, the drug form, the administration route and time, but can be appropriately selected by those skilled in the art.
본 발명에 따른 상기 치료용 조성물을 제제화할 경우, 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제조될 수 있다.When the therapeutic composition according to the present invention is formulated, it may be prepared by using a diluent such as a filler, an extender, a binder, a wetting agent, a disintegrant, a surfactant, or an excipient.
경구투여를 위한 고형 제제에는 정제, 환자, 산제, 과립제, 캡슐제, 트로키제 등이 포함되며, 이러한 고형 제제는 하나 이상의 본 발명로 표시되는 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로스(sucrose) 또는 락토오스(lactose) 또는 젤라틴 등을 섞어 조제된다. 또한, 단순한 부형제 외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다. 경구 투여를 위한 액상 제제로는 현탁제, 내용액제, 유제 또는 시럽제 등이 해당되는데, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.Solid formulations for oral administration include tablets, patients, powders, granules, capsules, troches and the like, which may contain one or more excipients such as starch, calcium carbonate Sucrose, lactose, or gelatin. In addition to simple excipients, lubricants such as magnesium stearate talc are also used. Liquid preparations for oral administration include suspensions, solutions, emulsions or syrups. Various excipients such as wetting agents, sweeteners, fragrances, preservatives and the like are included in addition to commonly used simple diluents such as water and liquid paraffin. .
비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁용제, 유제, 동결건조제제, 좌제 등이 포함된다.Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, suppositories, and the like.
비수성용제, 현탁용제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세롤, 젤라틴 등이 사용될 수 있다.Examples of the non-aqueous solvent and suspending agent include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like. As a base for suppositories, witepsol, macrogol, tween 61, cacao paper, laurin, glycerol, gelatin and the like can be used.
본 발명에 따른 치료용 조성물은 약학적으로 유효한 양으로 투여한다. 본 발명에 있어서, "약학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효용량 수준은 환자의 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 치료용 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.The therapeutic composition according to the present invention is administered in a pharmaceutically effective amount. In the present invention, "pharmaceutically effective amount" means an amount sufficient to treat a disease at a reasonable benefit / risk ratio applicable to medical treatment, and the effective dose level is determined by the type of disease, severity, , Sensitivity to the drug, time of administration, route of administration and rate of release, duration of treatment, factors including co-administered drugs, and other factors well known in the medical arts. The therapeutic composition of the present invention can be administered as an individual therapeutic agent or in combination with other therapeutic agents, and can be administered sequentially or simultaneously with conventional therapeutic agents, and can be administered singly or in multiple doses. It is important to take into account all of the above factors and to administer the amount in which the maximum effect can be obtained in a minimal amount without side effects, which can be easily determined by those skilled in the art.
구체적으로, 본 발명에 따른 화합물의 유효량은 환자의 나이, 성별, 체중에 따라 달라질 수 있으며, 일반적으로는 체중 1 ㎏당 0.1 내지 100 mg, 바람직하게는 0.5 내지 10 mg을 매일 또는 격일 투여하거나 1일 1 내지 3회로 나누어 투여할 수 있다. 그러나 투여 경로, 비만의 중증도, 성별, 체중, 연령 등에 따라서 증감될 수 있으므로 상기 투여량이 어떠한 방법으로도 본 발명의 범위를 한정하는 것은 아니다.
Specifically, the effective amount of the compound according to the present invention may vary depending on the age, sex, and body weight of the patient. In general, 0.1 to 100 mg, preferably 0.5 to 10 mg per kg of body weight is administered daily or every other day or 1 It may be administered one to three times a day. However, the dosage may be varied depending on the route of administration, the severity of obesity, sex, weight, age, etc. Therefore, the dosage is not limited to the scope of the present invention by any means.
본 발명의 siRNA 전달용 재조합 단백질은 각종 분해효소와 같은 외부공격으로부터 siRNA의 안정성을 확보할 수 있으며, 암세포를 표적으로 하는 표적지향성 RGD 펩타이드에 의하여 siRNA를 암세포 및 암조직으로 선택적으로 전달할 수 있다. 이에 따라, 본 발명은 생체 내 안정성을 향상시킨 siRNA 치료제, 세포기반 약물 스크리닝 조성물 및 연구용 siRNA 전달체로서 효과적으로 이용될 수 있다.
The recombinant protein for delivering siRNA of the present invention can secure the stability of siRNA from external attack such as various decomposing enzymes and can selectively deliver siRNA into cancer cells and cancer tissues by target-oriented RGD peptide targeting cancer cells. Accordingly, the present invention can be effectively used as an siRNA therapeutic agent, a cell-based drug screening composition, and an siRNA carrier for research, which have improved in vivo stability.
도 1은 실시예 1에서 제조한 siRNA 전달용 재조합 단백질이 포함하는 아미노산 서열을 나타낸 것이다(RNA 결합 2b 단백질(대시 박스), RNA 결합 2b 단백질 및 RGD 펩타이드를 연결하는 링커 펩타이드(실선 밑줄), RGD 펩타이드(점선 박스)의 아미노산 서열을 나타낸다).
도 2는 본 발명의 siRNA 전달용 재조합 단백질의 3차원 분자구조를 시뮬레이션한 결과를 나타낸 것이다.
도 3은 본 발명의 siRNA 전달용 재조합 단백질을 대장균 대량발현 시스템을 이용하여 발현 유도 하였을 때의 전기영동 결과를 나타낸 것이다.
도 4는 본 발명의 siRNA 전달용 재조합 단백질을 액체 크로마토그래피의 히스티딘 친화도(Histidine affinity) 컬럼을 사용하여 정제한 결과를 보여주는 전기영동 결과를 나타낸 것이다.
도 5는 본 발명의 siRNA 전달용 재조합 단백질과 siRNA의 결합비율을 확인하기 위해서 siRNA 전달용 재조합 단백질의 농도에 따라 결합하는 siRNA의 양을 정량분석한 전기영동한 결과를 나타낸 것이다(siRNA 양을 고정하면서 siRNA 전달용 재조합 단백질의 양을 변화시킬 때 결합에 참여한 siRNA는 2b-RGD/siRNA 밴드로, 결합에 참여하지 못한 siRNA는 free siRNA 밴드로 나타난다).
도 6은 MTT 분석를 통하여 본 발명 2b-RGD/siRNA 결합체의 농도에 따른 세포 독성 및 생체적합성을 시험한 결과를 나타낸 것이다.
도 7은 2b-RGD/siRNA 결합체의 결합되어 있는 siRNA가 pH가 감소할수록 해리되는 것을 보여주는 전기영동 결과를 나타낸 것이다.
도 8은 10% FBS(fatal bovine serum) 조건 하에서 naked siRNA와 siRNA 전달용 재조합 단백질에 결합되어 있는 siRNA의 안정성을 비교한 결과를 나타낸 것이다.
도 9는 형광체 FITC로 표지된 2b-RGD/FITC-siRNA 결합체가 B16F10 암세포에 세포 투과되는 것을 보여주는 형광현미경 분석결과를 나타낸 것이다(DAPI 염색은 세포 핵의 위치를 나타내며 merge 이미지는 각각의 이미지가 중첩된 결과이다).
도 10은 chlorpromazine hydrochloride(CPZ), filipin III(Filip), cytochalasin D(CytoD), amiloride hydrochloride(Amil)로 이루어진 군으로부터 선택된 1종의 저해제를 처리하였을 때의 세포 투과 감소됨을 형광현미경을 통해서 보여주는 결과를 나타낸 것이다.
도 11은 마우스 대식세포를 이용하여 TNF-α 분석을 통해 본 발명의 2b-RGD/siRNA 결합체의 선천성 면역반응(innate immune response)을 분석한 것을 나타낸 것이다.
도 12는 2b-RGD/siRNA 결합체를 형광단백질 RFP가 발현되는 암세포 (RFP/B16F10)에 처리한 후의 형광현미경 분석 결과(그림 A), 이의 정량분석 결과 (그림 B), 시간에 따른 유전자 발현 억제 효과를 보여는 결과(그림 C)를 나타낸 것이다(Control: RFG 유전자가 발현되는 B16F10 세포, 2b-RGD/siRNA: siRNA 전달용 재조합 단백질을 이용하여 siRNA를 세포에 주입한 경우, 2b-RGD/sc siRNA: RFP 유전자에 매칭하지 않는 scramble siRNA를 siRNA 전달용 재조합 단백질에 봉입하여 세포에 주입한 경우, LF/siRNA: 기존 siRNA 전달체인 리포펙타민을 사용한 경우, 2b/siRNA: RGD 펩타이드가 없는 2b protein/siRNA 결합체를 세포에 처리한 경우, 2b-RGD: siRNA 없이 siRNA 전달용 재조합 단백질만을 주입한 경우).
도 13은 RFP 유전자의 mRNA가 siRNA에 의하여 분해되었는지 여부를 RT-PCR을 통하여 확인한 전기영동 결과 및 정량분석 결과를 나타낸 것이다 (Control(1): RFG 유전자가 발현되는 B16F10 세포, 2b-RGD/siRNA(2): siRNA 전달용 재조합 단백질을 이용하여 siRNA를 세포에 주입한 경우, 2b-RGD/sc siRNA(3): RFP 유전자에 매칭하지 않는 scramble siRNA를 siRNA 전달용 재조합 단백질에 봉입하여 세포에 주입한 경우, LF/siRNA(4): 기존 siRNA 전달체인 리포펙타민을 사용한 경우, 2b/siRNA(5): RGD 펩타이드가 없는 2b protein/siRNA 결합체를 세포에 처리한 경우, 2b-RGD(6): siRNA 없이 siRNA 전달용 재조합 단백질만을 주입한 경우).
도 14은 RFP 유전자의 mRNA가 siRNA에 의하여 분해되어 RFP 단백질의 발현이 감소되었음을 RFP 항체를 이용하여 보여주는 western blot 결과를 나타낸 것이다 (1: RFG 유전자가 발현되는 B16F10 세포, 2: siRNA 전달용 재조합 단백질을 이용하여 siRNA를 세포에 주입한 경우, 3: RFP 유전자에 매칭하지 않는 scramble siRNA를 siRNA 전달용 재조합 단백질에 봉입하여 세포에 주입한 경우, 4: 기존 siRNA 전달체인 리포펙타민을 사용한 경우, 5: RGD 펩타이드가 없는 2b protein/siRNA 결합체를 세포에 처리한 경우, 6: siRNA 없이 siRNA 전달용 재조합 단백질만을 주입한 경우).FIG. 1 shows the amino acid sequences of the recombinant proteins for siRNA delivery prepared in Example 1 (RNA binding 2b protein (dash box), linker peptide connecting the RNA binding 2b protein and the RGD peptide (solid line underline), RGD Quot; indicates the amino acid sequence of the peptide (dotted box)).
Fig. 2 shows a simulation result of the three-dimensional molecular structure of the recombinant protein for siRNA delivery of the present invention.
FIG. 3 shows electrophoresis results when the recombinant protein for delivering siRNA of the present invention was induced to express using a large-scale Escherichia coli expression system.
FIG. 4 shows electrophoresis results showing the result of purification of the recombinant protein for siRNA delivery of the present invention using a histidine affinity column of liquid chromatography.
FIG. 5 shows the result of electrophoresis on the quantitative analysis of the amount of siRNA bound according to the concentration of the recombinant protein for siRNA delivery in order to confirm the binding ratio between the recombinant protein for siRNA delivery of the present invention and siRNA And siRNAs that participate in binding are shown as 2b-RGD / siRNA bands, while siRNAs that do not participate in binding appear as free siRNA bands.
FIG. 6 shows the cytotoxicity and biocompatibility of the 2b-RGD / siRNA conjugate according to the present invention through MTT analysis.
FIG. 7 shows electrophoresis results showing that the bound siRNA of the 2b-RGD / siRNA conjugate dissociates as the pH decreases.
Figure 8 shows the results of comparing the stability of naked siRNA and siRNAs bound to recombinant proteins for siRNA delivery under 10% Fatal bovine serum (FBS) conditions.
FIG. 9 shows a fluorescence microscopic analysis showing that the 2b-RGD / FITC-siRNA conjugate labeled with the fluorescent FITC is transfected into B16F10 cancer cells (DAPI staining indicates the location of the cell nucleus, .
Fig. 10 shows the results of fluorescence microscopy showing the decrease in cell permeability when one kind of inhibitor selected from the group consisting of chlorpromazine hydrochloride (CPZ), filipin III (Filip), cytochalasin D (CytoD) and amiloride hydrochloride .
FIG. 11 shows the analysis of the innate immune response of the 2b-RGD / siRNA conjugate of the present invention through TNF-α analysis using mouse macrophages.
FIG. 12 shows fluorescence microscopic analysis (FIG. A) after treatment of 2b-RGD / siRNA conjugate with cancer cell (RFP / B16F10) expressing fluorescent protein RFP (FIG. A) (Fig. C). Control: B16F10 cells expressing the RFG gene and 2b-RGD / siRNA: siRNA were injected into the cells using the recombinant protein for siRNA delivery. siRNA: When scramble siRNA that does not match RFP gene is encapsulated in recombinant protein for siRNA delivery and then injected into cells, LF / siRNA: 2b / siRNA: 2b protein without RGD peptide when using lipofectamine as a conventional siRNA delivery / siRNA < / RTI > conjugate is treated with a cell, only the recombinant protein for siRNA delivery is injected without 2b-RGD: siRNA).
FIG. 13 shows electrophoresis results and quantitative analysis results of RTP-PCR to determine whether or not mRNA of RFP gene was degraded by siRNA (Control (1): B16F10 cells expressing RFG gene, 2b-RGD / siRNA (2): 2b-RGD / sc siRNA (3): When a siRNA is injected into a cell using a recombinant protein for siRNA delivery, a scramble siRNA that does not match the RFP gene is encapsulated in a recombinant protein for
FIG. 14 shows western blot results showing that RFP gene mRNA was degraded by siRNA and decreased expression of RFP protein using RFP antibody (1: B16F10 cell expressing RFG gene, 2: recombinant protein for siRNA delivery 3: When scramble siRNA that does not match with RFP gene is injected into the cell by encapsulating it in the recombinant protein for siRNA delivery. 4: When using lipofectamine, which is a conventional siRNA delivery, 5 : When cells were treated with 2b protein / siRNA conjugate without RGD peptide, only 6: siRNA without recombinant protein for siRNA delivery).
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명이 하기 실시예에 의해 한정되는 것은 아니다.
Hereinafter, the present invention will be described in detail with reference to examples. However, the following examples are illustrative of the present invention, and the present invention is not limited by the following examples.
실시예Example 1. One. siRNAsiRNA 전달용 재조합 단백질의 제조 Preparation of Recombinant Proteins for Delivery
1-1. 1-1. siRNAsiRNA 전달용 재조합 단백질의 디자인 Design of Recombinant Protein for Delivery
본 발명자들은 siRNA 전달용 재조합 단백질을 디자인하고, 3차원 구조분석 시뮬레이션을 실시하였다. 우선, siRNA 전달용 재조합 단백질을 구성하는 아미노산 서열을 결정하였다. 도 1에 나타난 바와 같이, 토마토 아스퍼미 바이러스(Tomato Aspermy Virus)에서 유래한 RNA 결합 2b 단백질(서열번호 1)을 구성하는 전체 69개 아미노산의 C-말단에 링커(linker) 펩타이드로서 9개 아미노산(서열번호 2: GSGGGDEAD)을 사용하여 RGD 펩타이드와 연결하도록 하였다. RGD 펩타이드는 9개 아미노산 (서열번호 3: CDCRGDCFC)을 포함하도록 디자인하였다.The present inventors designed a recombinant protein for siRNA delivery and performed a three-dimensional structural analysis simulation. First, the amino acid sequence constituting the recombinant protein for siRNA delivery was determined. As shown in Fig. 1, the C-terminus of all 69 amino acids constituting the RNA-binding 2b protein (SEQ ID NO: 1) derived from Tomato Aspermy Virus was linked with 9 amino acids SEQ ID NO: 2: GSGGGDEAD) was used to link the RGD peptide. The RGD peptide was designed to contain nine amino acids (SEQ ID NO: 3: CDCRGDCFC).
서열번호 1: MASIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSEQ ID NO: 1: MASIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVEL
SAINSDNSSDEG SAINSDNSSDEG
이와 같이 디자인된 siRNA 전달용 재조합 단백질(서열번호 4)은 Pymol(version 1.4.1, DeLano Scientific LLC) 3차원 구조분석 프로그램을 이용한 구조생물학적 시뮬레이션을 통하여, 도 2에 나타난 바와 같이 3차원 구조를 가지게 되었으며, 상기 siRNA 전달용 재조합 단백질은 2개의 단백질이 호모다이머(homodimer)를 형성하여 하나의 siRNA duplex를 결합할 수 있다.The designed siRNA delivery recombinant protein (SEQ ID NO: 4) has a three-dimensional structure as shown in Fig. 2 through structural biology simulation using Pymol (version 1.4.1, DeLano Scientific LLC) three-dimensional structure analysis program , And the recombinant protein for siRNA delivery can bind a single siRNA duplex by forming two homodimers of two proteins.
서열번호 4: MASIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSEQ ID NO: 4: MASIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVEL
SAINSDNSSDEGGSGGGDEADCDCRGDCFC
SAINSDNSSDEGGSGGGDEADCDCRGDCFC
1-2. 대장균을 이용한 1-2. Using E. coli siRNAsiRNA 전달용 재조합 단백질의 대량 생산 및 정제 Mass production and purification of recombinant recombinant proteins
상기 실시예 1-1에서 디자인된 siRNA 전달용 재조합 단백질을 제조하기 위하여, 먼저 RNA 결합 2b 단백질을 코딩하는 유전자를 정방향 프라이머(서열번호 5) 및 역방향 프라이머(서열번호 6)를 이용하여 PCR 증폭하였다. 이 때 역방향 프라이머에는 링커 펩타이드(서열번호 2)와 RGD 펩타이드(서열번호 3)에 해당되는 유전자가 포함되도록 디자인하여 PCR 증폭한 결과물에서 도 1에 해당되는 아미노산 서열이 가능하도록 유전자 재조합 하였다.In order to prepare the recombinant protein for siRNA delivery designed in Example 1-1, the gene coding for the RNA-binding 2b protein was first amplified by PCR using a forward primer (SEQ ID NO: 5) and a reverse primer (SEQ ID NO: 6) . In this case, the reverse primer was designed so as to include the gene corresponding to the linker peptide (SEQ ID NO: 2) and the RGD peptide (SEQ ID NO: 3), and the resultant PCR product was genetically recombined to enable the amino acid sequence shown in FIG.
서열번호 5: 5’- CATATGGCAAGCATCGAGATCCCT -3’SEQ ID NO: 5: 5'-CATATGGCAAGCATCGAGATCCCT-3 '
서열번호 6: 5’- ATATGCTCGAGTCATGACATCATTGGAACTGAGTCAGGGTACGCCGAATAGTCSEQ ID NO: 6: 5'-ATATGCTCGAGTCATGACATCATTGGAACTGAGTCAGGGTACGCCGAATAGTC
AGCTTCATCACCGCCTCCGGATCCCTCGCTTTCTTTCTT -3’AGCTTCATCACCGCCTCCGGATCCCTCGCTTTCTTTCTT -3 '
상기 PCR 증폭은 각각 변성 단계 95℃/30초, 어닐링 단계 60℃/30초 및 신장 단계 72℃/ 2분의 조건으로 30 사이클 실시하였고, 이를 통하여 RNA 결합 2b 단백질(서열번호 1), 링커 펩타이드(서열번호 2) 및 RGD 펩타이드(서열번호 3)의 각 유전자가 연결된 유전자 컨스트럭트를 얻을 수 있었다.The PCR amplification was carried out for 30 cycles under the conditions of denaturation step of 95 ° C for 30 seconds, annealing step of 60 ° C for 30 seconds, and elongation step of 72 ° C for 2 minutes, whereby RNA-bound 2b protein (SEQ ID NO: 1), linker peptide (SEQ ID NO: 2) and the RGD peptide (SEQ ID NO: 3).
이 때 증폭된 유전자는 NdeI, XhoI 제한 효소자리를 포함하고 있으므로 이에 대한 제한효소를 처리한 후 정제하였다. 마찬가지로 pET28a 벡터(NEB Inc.)도 동일한 제한효소로 처리한 후 정제하였으며 상기 재조합 유전자를 T4 DNA ligase를 이용하여 삽입한 후 competent cell에 Hanahan method(Hanahan, D. Studies on transformation of Escherichia coli with plasmids J. Mol . Biol . 1983, 166, 557-77)를 사용하여 형질전환하고 콜로니 PCR 방법(Sheu DS, Wang YT, Lee CY. Rapid detection of polyhydroxyalkanoate-accumulating bacteria isolated from the environment by colony PCR. Microbiology . 2000, 146, 2019-25)으로 유전자삽입을 확인한 후 최종적으로 DNA 시퀀싱을 통하여 서열을 확인하였다.At this time, the amplified gene contained NdeI and XhoI restriction enzyme sites, and the restriction enzyme was purified and purified. Likewise, the pET28a vector (NEB Inc.) was treated with the same restriction enzymes and then purified. After inserting the recombinant gene with T4 DNA ligase, competent cells were subjected to Hanahan method (Hanahan, D. Studies on transformation of Escherichia coli with plasmids J . Mol. Biol. 1983, 166 , 557-77) and transformed colony PCR method using (Sheu DS, Wang YT, Lee CY. Rapid detection of polyhydroxyalkanoate-accumulating bacteria isolated from the environment by colony PCR. Microbiology. 2000 , 146, 2019-25), and finally sequenced by DNA sequencing.
유전자가 삽입된 발현벡터를 BL21(DE3) 숙주세포(Novagen)에 형질전환을 시킨 후, LB 배지(Sigma-Aldrich)에서 37℃에서 키운 후 OD600 값이 0.5에 도달하면 IPTG(Isopropyl β-D thiogalactoside) 1mM을 이용하여 발현을 유도하였고, 그 결과를 도 3에 나타내었다.(DE3) host cells (Novagen) and grown in LB medium (Sigma-Aldrich) at 37 ° C. After the OD 600 value reached 0.5, IPTG (Isopropyl β-D thiogalactoside), and the results are shown in Fig.
도 3에 나타난 바와 같이, IPTG에 의하여 단백질 발현이 유도된 세포들은 높은 발현량을 보여주었으며 발현된 단백질 대부분이 우수한 용해도를 보여주는 것으로 확인하였다.As shown in FIG. 3, the cells expressing the protein by IPTG showed a high expression level and most of the expressed proteins showed excellent solubility.
이 후 37 ℃에서 6시간을 더 배양한 후 세포를 수거하고 용해 버퍼(50mM Tris-HCl, 8.0, 100mM NaCl, 1mM PMSF(phenylmethylsulfanylfluoride))를 이용하여 세포를 파괴한 후 용해된 부분만을 정제에 이용하였다. 발현 벡터의 특징상 siRNA 전달용 재조합 단백질의 N-말단에 히스티딘-태그가 위치하는 것을 이용하여 친화성 크로마토그래피(affinity chromatography)를 이용한 정제방법을 사용하였다. After the cells were further cultured at 37 ° C for 6 hours, the cells were harvested and the cells were disrupted using a dissolution buffer (50 mM Tris-HCl, 8.0, 100 mM NaCl, 1 mM PMSF (phenylmethylsulfanylfluoride) Respectively. Characterization of Expression Vector The purification method using affinity chromatography was performed using a histidine tag located at the N-terminus of the recombinant protein for siRNA delivery.
친화성 크로마토그래피는 Ni-NTA 컬럼(GE healthcare)을 사용하였으며 A 버퍼(50mM Tris-HCl, 8.0, 100mM NaCl)로 컬럼 준비와 단백질 로딩 후 수세하였다. B 버퍼(50mM Tris-HCl, 8.0, 100mM NaCl, 500mM Immidazole)로 컬럼에 붙어있는 단백질을 용출시킨 후 전기영동(Laemmli, U. K. Nature 1970, 227, 680-685.)을 하였고, 그 결과를 도 4에 나타내었다. Affinity chromatography was performed using a Ni-NTA column (GE healthcare) and washed with A buffer (50 mM Tris-HCl, 8.0, 100 mM NaCl) after column preparation and protein loading. The protein attached to the column was eluted with B buffer (50 mM Tris-HCl, 8.0, 100 mM NaCl, 500 mM Immidazole) and electrophoresed (Laemmli, UK Nature 1970, 227, 680-685) Respectively.
도 4에 나타난 바와 같이, 전기영동을 통하여 분자량을 확인하였다. 정제 후 단백질의 농도는 약 1mg/mL로 농축하였으며 보관조건은 50 mM PBS(7.4)으로 하였다.
As shown in Fig. 4, the molecular weight was confirmed by electrophoresis. After purification, the concentration of the protein was concentrated to about 1 mg / mL. The storage conditions were 50 mM PBS (7.4).
실시예Example 2. 2. siRNAsiRNA 전달용 재조합 단백질의 Of the recombinant recombinant protein siRNAsiRNA 결합력 조사 Bond strength investigation
상기 실시예 1-2에서 제조한 siRNA 전달용 재조합 단백질 내부에 siRNA 를 봉입하여 siRNA 결합력을 조사하였다. 본 실험에서는 RFP(Red Fluorescent Protein) 유전자를 타겟으로 하는 siRNA를 사용하였으며, 사용한 siRNA의 염기 서열은 다음과 같다: The siRNA binding capacity of the recombinant protein for siRNA delivery prepared in Example 1-2 was investigated. In this experiment, siRNA targeting RFP (Red Fluorescent Protein) gene was used. The nucleotide sequence of siRNA used was as follows:
센스 가닥: 5’- UGUAGAUGGACUUGAACUCdTdT -3’ (서열번호 7)Sense strand: 5'-UGUAGAUGGACUUGAACUCdTdT -3 '(SEQ ID NO: 7)
안티센스 가닥: 5’- GAGUUCAAGUCCAUCUACAdTdT -3’ (서열번호 8)Antisense strand: 5'-GAGUUCAAGUCCAUCUACAdTdT -3 '(SEQ ID NO: 8)
상기 siRNA 전달용 재조합 단백질에 결합하는 siRNA의 몰비(mole ration)를 결정하기 위하여, free siRNA의 농도를 고정한 상태에서 상기 siRNA 전달용 재조합 단백질의 농도를 증가시키면서 siRNA 결합량을 전기영동으로 분석하였고, 그 결과를 도 5에 나타내었다.In order to determine the mole ratio of the siRNA binding to the recombinant protein for siRNA delivery, siRNA binding amount was analyzed by electrophoresis while the concentration of the free siRNA was fixed and the concentration of the siRNA delivery recombinant protein was increased. The results are shown in Fig.
도 5에 나타낸 바와 같이, 상기 siRNA 전달용 재조합 단백질의 농도가 높아질수록 결합에 참여하지 못하는 siRNA의 양이 감소하면서 상기 siRNA 전달용 재조합 단백질에 결합되어 젤 이동(gel shift)을 보여주는 밴드의 두께가 증가하였으며, 정량적 분석을 통해서 두 개의 siRNA 전달용 재조합 단백질 당 결합되는 siRNA의 개수는 하나임을 확인할 수 있었다.
As shown in FIG. 5, as the concentration of the recombinant protein for siRNA delivery increases, the amount of siRNA that can not participate in binding decreases, and the band that shows the gel shift due to binding to the recombinant protein for siRNA delivery Quantitative analysis showed that the number of siRNAs bound to each of the two siRNA delivery recombinant proteins was one.
실시예Example 3. 3. siRNAsiRNA 전달용 재조합 단백질의 세포독성 실험 Cytotoxicity test of recombinant protein for delivery
siRNA 전달용 재조합 단백질의 세포 내 생체적합성을 조사하기 MTT 분석을 수행하였다(Choi, Y. H.; Liu, F.; Kim, J. S.; Choi, Y. K.; Park, J. S.; Kim, S. W. J. Control. Rel. 1998, 54, 39-48.). MTT assay was performed to investigate intracellular biocompatibility of siRNA delivery recombinant proteins (Choi, YH; Liu, F.; Kim, JS; Choi, YK; Park, JS; Kim, SWJ Control. , 39-48.).
구체적으로, 기하급수적인 증가 단계(Exponential growth phase)에 있는 B16F10 세포를 96-웰 플레이트에서 웰당 20,000 세포가 되도록 키운 후, 상기 실시예 1-2에서 제조한 siRNA 전달용 재조합 단백질을 다양한 농도로 각 웰에 처리하고 24시간 동안 배양하였다. MTT 용액(0.5mg/mL)을 웰 당 200uL씩 첨가하여 4시간 동안 반응시킨 후 DMSO 200uL를 넣고 10분간 반응시키고 570nm 파장에서 ELISA를 이용하여 측정하였고, 그 결과를 도 6에 나타내었다. Specifically, B16F10 cells in an exponential growth phase were grown in 96-well plates to 20,000 cells per well, and then the recombinant proteins for siRNA delivery prepared in Example 1-2 were cultured at various concentrations Well and cultured for 24 hours. MTT solution (0.5 mg / mL) was added in an amount of 200 μL per well. After reacting for 4 hours, 200 μL of DMSO was added and reacted for 10 minutes. ELISA was performed at 570 nm wavelength, and the result is shown in FIG.
도 6에 나타낸 바와 같이, 상기 siRNA 전달용 재조합 단백질은 5μM까지 우수한 생체적합성을 보여주었으며, 바람직한 농도로서, 상기 siRNA 전달용 재조합 단백질의 농도를 1μM로 결정할 수 있었다.
As shown in FIG. 6, the siRNA delivery recombinant protein showed excellent biocompatibility up to 5 μM, and as a preferable concentration, the concentration of the recombinant protein for siRNA delivery was determined to be 1 μM.
실시예Example 4. 4. siRNAsiRNA 전달용 재조합 단백질의 Of the recombinant recombinant protein pHpH 에 따른 In accordance siRNAsiRNA 결합력 cohesion
siRNA 전달체는 엔도시토시스(endocytosis)에 의하여 세포 내 투과 후 세포질로의 방출을 위해서, 엔도솜(endosome)의 산성조건을 이용하여 엔도솜에서 세포질로의 방출 기전(endosomal escape)을 활용할 경우 매우 유리하다. The siRNA delivery system is highly advantageous when endosomal escape is utilized from the endosomes to the cytoplasmic release by endocytosis using the acidic conditions of the endosome for the release of cytoplasmic after intracellular permeation by endocytosis Do.
이에, 상기 실시예 1-2에서 제조한 siRNA 전달용 재조합 단백질의 pH에 따른 siRNA 결합력을 측정하였다. pH 7.4 조건은 PBS 버퍼, pH 6.0 내지 5.0 조건은 50 mM 아세트산나트륨 버퍼(buffer)를 사용하였고, siRNA 및 siRNA 전달용 재조합 단백질을 상온에서 10분간 각각의 해당되는 pH 조건에서 방치한 후 전기영동(200V, 100mA)을 이용하여 결합 정도를 분석하였고, 그 결과를 도 7에 나타내었다. 참고적으로 상기 siRNA는 분석의 용이성을 위하여 형광체 FITC를 부착하였다. Thus, the siRNA binding ability of the recombinant protein for siRNA delivery prepared in Example 1-2 was measured according to the pH. For pH 7.4, 50 mM sodium acetate buffer was used. For pH 6.0 to 5.0, siRNA and siRNA delivery recombinant proteins were incubated at room temperature for 10 min. 200V, 100mA). The results are shown in FIG. For reference, the siRNA was attached with a fluorescent FITC for ease of analysis.
도 7에 나타낸 바와 같이, 상기 siRNA 전달용 재조합 단백질은 중성 pH에서는 siRNA 결합력이 우수하였으나 pH가 감소할수록 해리되는 것을 확인하였다. 약 pH 6.5에서부터 siRNA의 해리가 확인되었으며, 약 pH 5.0에서는 대부분의 siRNA가 해리되었다.As shown in FIG. 7, the recombinant proteins for siRNA delivery showed excellent binding ability at the neutral pH, but dissociated as the pH decreased. The dissociation of the siRNA was confirmed at about pH 6.5, and at about pH 5.0, most of the siRNA disassociated.
이러한 결과로부터 siRNA 전달용 재조합 단백질이 세포 내 투과 후에 엔도솜에서의 방출 기전(endosomal escape)에 의하여 세포질로 siRNA의 전달이 가능함을 확인하였다.
From these results, it was confirmed that the recombinant protein for siRNA delivery is capable of delivering siRNA into the cytoplasm by endosomal escape after intracellular permeation.
실시예Example 5. 5. siRNAsiRNA 전달용 재조합 단백질에 To the recombinant recombinant protein 봉입된Enclosed siRNAsiRNA 의 생체안정성 조사Biostability studies of
siRNA를 분해할 수 있는 각종 리보뉴클레아제들이 혼재해 있는 10% FBS (fatal bovine serum) 조건하에서 naked siRNA와 상기 실시예 1-2에서 제조된 siRNA 전달용 재조합 단백질에 봉입된 siRNA를 각각 실온에서 시간별로 방치한 후 전기영동을 통해 분해되는 정도를 비교하였고, 그 결과를 도 8에 나타내었다.naked siRNA and the siRNA encapsulated in the recombinant protein for siRNA delivery prepared in Example 1-2 were incubated at room temperature under 10% FBS (fatal bovine serum) conditions in which various ribonuclease agents capable of degrading siRNA were mixed, And the degree of degradation by electrophoresis was compared. The results are shown in FIG.
도 8에 나타낸 바와 같이, naked siRNA의 경우 30분 이내에서 완전히 분해되었으나 상기 siRNA 전달용 재조합 단백질에 봉입되어 보호를 받는 siRNA는 6시간까지 약 50%가 안정적이었으며 24시간까지 분해되지 않고 남아있는 siRNA를 관찰할 수 있었다. As shown in FIG. 8, the naked siRNA was completely degraded within 30 minutes, but the siRNA which was enclosed in the recombinant protein for siRNA delivery and was protected was about 50% stable until 6 hours, and the remaining siRNA .
이러한 결과로부터 siRNA 전달용 재조합 단백질이 siRNA의 생체 안정성을 획기적으로 향상시키는 우수한 전달체임을 확인할 수 있으며, 이는 siRNA 전달용 재조합 단백질의 내부에 봉입된 siRNA는 RNA 결합 2b 단백질에 의하여 물리적으로 외부환경으로부터 보호를 받음으로써, naked siRNA에 비해 각종 리보뉴클레아제(ribonuclease)에 의한 분해 저항성이 뛰어나다는 것을 확인할 수 있었다.
From these results, it can be confirmed that the recombinant protein for siRNA delivery is an excellent transporter that greatly improves the biostability of the siRNA, and that the siRNA encapsulated in the recombinant protein for siRNA delivery is physically protected from the external environment by the RNA- , It was confirmed that ribonuclease was more resistant to degradation than naked siRNA.
실시예Example 6. 6. siRNAsiRNA 전달용 재조합 단백질의 세포투과 활성 Cytotoxic activity of recombinant protein for delivery
마우스 미엘로마(myeloma) 세포주인 B16F10에 대한 세포투과 실험을 수행하였다. 구체적으로 형광현미경에서의 형광 관찰을 용이하게 하기 위하여, 먼저 상기 실시예 1-2에서 제조된 siRNA 전달용 재조합 단백질과 FITC가 부착되어 있는 siRNA(2b-RGD/FITC-siRNA 결합체)를 이용하였다. B16F10 세포에 상기 2b-RGD/FITC-siRNA 결합체를 0.25μM 처리한 후 형광현미경을 이용하여 관찰하였고, 그 결과를 도 9에 나타내었다. 형광현미경으로는 Achroplan IR40 x/0.80W lens, Axiocam black and white CCD camera(Carl Zeiss)가 부착된 Axioskop2 FS plus imaging microscope (ZEISS)을 사용하였다.Cell permeation experiments were performed on the mouse myeloma cell line B16F10. Specifically, in order to facilitate fluorescence observation under a fluorescence microscope, siRNA (2b-RGD / FITC-siRNA conjugate) with FITC attached to the siRNA delivery recombinant protein prepared in Example 1-2 was used. B16F10 cells were treated with 0.25 [mu] M of the 2b-RGD / FITC-siRNA conjugate and observed with a fluorescence microscope. The results are shown in Fig. Axioskop2 FS plus imaging microscope (ZEISS) equipped with Achroplan IR40 x / 0.80W lens and Axiocam black and white CCD camera (Carl Zeiss) was used for fluorescence microscopy.
도 9에 나타낸 바와 같이, 상기 2b-RGD/FITC-siRNA 결합체를 처리한 후 10분 경과부터 2b-RGD/FITC-siRNA 결합체의 세포 내 투과가 관찰되기 시작하였으며 약 30분 경과에서 최대의 세포투과성을 보여주었다. 상기 결과로부터, siRNA 전달용 재조합 단백질은 암세포에 대해서 세포투과성이 매우 우수함을 확인할 수 있었다. 그러나 RGD 펩타이드가 생략된 2b protein/FITC-siRNA 결합체를 처리한 B16F10 암세포에서는 세포투과를 관찰할 수 없었다. 이러한 결과는 본 발명의 siRNA 전달용 재조합 단백질이 표적 펩타이드인 RGD 펩타이드가 암세포 표면의 integrin 막수용체와 결합함으로써 세포 투과되는 것을 나타낸다. As shown in FIG. 9, intracellular permeation of the 2b-RGD / FITC-siRNA conjugate started to be observed 10 minutes after the treatment of the 2b-RGD / FITC-siRNA conjugate, and at about 30 minutes, . From the above results, it was confirmed that the recombinant protein for siRNA delivery has excellent cell permeability to cancer cells. However, cell permeation was not observed in B16F10 cancer cells treated with the 2b protein / FITC-siRNA conjugate in which the RGD peptide was omitted. These results indicate that the recombinant protein for siRNA delivery of the present invention is permeable to the RGD peptide, which is the target peptide, by binding to the integrin membrane receptor on the surface of cancer cells.
약 100배 고농도의 RGD 펩타이드를 먼저 처리한 B16F10 암세포에 대하여 2b-RGD/FITC-siRNA 결합체를 처리한 경우 세포 투과 정도가 크게 감소함을 알 수 있었는데 이러한 결과는 전처리한 RGD 펩타이드가 integrin 막수용체에 경쟁적으로 결합하여 막수용체를 포화시킴으로써 2b-RGD/FITC-siRNA 결합체의 결합을 방해한 것으로 설명할 수 있으며, 이러한 결과로부터 본 발명의 2b-RGD 전달체가 표면에 노출되어있는 RGD 펩타이드에 의하여 세포 투과되는 것을 알 수 있었다. Human foreskin fibroblast (HFF) 정상세포에 대하여 2b-RGD/FITC-siRNA 결합체를 처리한 경우 세포 투과를 관찰할 수 없었는데 이것은 정상세포 표면에 integrin 막수용체가 상대적으로 적기 때문인 것으로 설명할 수 있다. 2b-RGD/siRNA 결합체는 정상세포에는 투과하지 않지만 암 세포에서 우수한 세포투과성을 확인할 수 있었다.It was found that the treatment of 2b-RGD / FITC-siRNA conjugates significantly reduced the cell permeability of B16F10 cancer cells treated with the RGD peptide at a high concentration of about 100 times, The RGD peptide of the present invention can inhibit the binding of the 2b-RGD / FITC-siRNA conjugate by saturating the membrane receptor by competitive binding. From these results, it can be seen that the 2b- . Cellular permeability was not observed when 2b-RGD / FITC-siRNA conjugate was treated with human foreskin fibroblast (HFF) normal cells, which can be explained by the relatively low amount of integrin receptor on the surface of normal cells. The 2b-RGD / siRNA conjugate did not permeabilize normal cells, but showed excellent cellular permeability in cancer cells.
엔도시토시스에 의한 세포 투과를 확인하기 위하여 대표적 엔도시토시스 저해제인 CPZ(Sigma, Ger), Filip(Sigma, Ger), CytoD(Sigma, Ger), 및 Amil(Sigma, Ger)으로 이루어진 군으로부터 선택된 저해제를 상기 siRNA 전달용 재조합 단백질에 처리하였으며, 그 결과를 도 10에 나타내었다. Were selected from the group consisting of CPZ (Sigma, Ger), Filip (Sigma, Ger), CytoD (Sigma, Ger), and Amil (Sigma, Ger) as typical endocytosis inhibitors to confirm cell permeation by endocytosis Inhibitors were treated with the siRNA delivery recombinant proteins and the results are shown in FIG.
도 10에 나타낸 바와 같이, 상기 siRNA 전달용 재조합 단백질의 세포 투과력이 엔도시토시스 저해제를 처리할 경우 현저히 감소되는 것을 관찰하여, siRNA 전달용 재조합 단백질이 엔도시토시스에 의하여 세포투과 되는 것을 확인할 수 있었다. 이를 통해 우수한 세포투과성은 siRNA 전달용 재조합 단백질 표면에 노출되어있는 RGD 펩타이드에 의한 엔도시토시스(endocytosis)에서 기인함을 확인하였다.As shown in FIG. 10, when the cell permeability of the recombinant protein for siRNA delivery was significantly reduced when the endocytosis inhibitor was treated, it was confirmed that the recombinant protein for siRNA delivery was cell permeated by endocytosis . It was confirmed that excellent cell permeability is due to endocytosis caused by the RGD peptide exposed on the surface of the recombinant protein for siRNA delivery.
siRNA는 선천성 면역반응(innate immune response)를 유도한다고 알려져 있다 (Judge AD., et al., Mol. Ther. 2006, 13, 494-505). 마우스 대식세포인 RAW264.7 세포에 대하여 상기 siRNA 전달용 2b-RGD/siRNA 결합체를 처리한 후 효소면역측정법(enzyme-linked immunosorbent assay)을 수행하여 유도된 TNFα를 정량하였다. 대식세포를 96-웰 플레이트에 부착한 후 상기 2b-RGD/siRNA 결합체를 2시간 처리하고 분석키트를 사용하여 TNFα를 정량하였으며, 기저수준(basal level background)이상의 TNFα를 관찰할 수 없었다(도 11). 하지만 0.1μg/mL의 지질다당(lipopolysaccharide, LPS)을 이용하여 대조군(control) 실험을 수행한 경우, 4시간과 24시간후의 TNFα 양이 급속히 증가하였다. 마찬가지 방법으로 측정하였을 때 대조군의 PBS 버퍼, 2b-RGD 단백질, 대표적 상업적 siRNA 전달체인 Lipofectamine/siRNA 복합체에서는 TNFα의 증가가 나타나지 않았다. siRNA is known to induce an innate immune response (Judge AD., et al., Mol. Ther. 2006, 13, 494-505). The mouse macrophage RAW264.7 cells were treated with the
이러한 결과는 상기 siRNA 전달용 2b-RGD/siRNA 결합체가 선천성 면역반응(innate immune response)을 일으키지 않는다는 것을 나타내는 것이다.
These results indicate that the
실시예Example 7. 7. siRNAsiRNA 전달용 재조합 단백질에 의한 세포 내 Intracellular delivery of recombinant proteins for delivery siRNAsiRNA 전달 및 유전자 사일런싱( Transmission and gene silencing ( genegene silencingsilencing ) 조사) Research
siRNA 전달용 재조합 단백질을 전달체로 이용한 siRNA가 세포 내 유전자에 대하여 유전자 사일런싱(gene silencing)을 일으키는 효과를 기존의 siRNA 전달체인 리포펙타민(Invitrogen, USA)과 비교하였다. The effect of siRNA using a recombinant protein for siRNA delivery as a transporter in gene silencing of intracellular genes was compared with lipopectamine (Invitrogen, USA), which is a conventional siRNA delivery.
RFP 형광 단백질을 발현할 수 있는 B16F10 미엘로마 세포주에 동일한 양의 siRNA를 각각 리포펙타민과 상기 실시예 1-2에서 제조한 siRNA 전달용 재조합 단백질에 섞어 준 후 세포 처리하고 24 시간 후 형광현미경으로 관찰하였고, 그 결과를 도 12에 나타내었다.The same amounts of siRNAs were mixed with lipofectamine and the recombinant proteins for siRNA delivery prepared in Example 1-2, respectively, in a B16F10 myeloma cell line capable of expressing RFP fluorescent protein, followed by cell treatment. After 24 hours, the cells were subjected to fluorescence microscopy And the results are shown in Fig.
도 12에 나타낸 바와 같이, siRNA를 처리하지 않은 대조군 세포는 RFP 형광단백질이 발현되어 강한 형광강도를 보였으나 상기 리포펙타민 및 siRNA 전달용 재조합 단백질로 처리한 siRNA는 세포에서 RFP 형광단백질의 발현을 억제함을 확인하였다. 또한, RFP 단백질-코딩 유전자와 매칭(matching)되지 않는 scramble siRNA를 상기 siRNA 전달용 재조합 단백질과 처리하였을 때는 유전자 사일런싱이 거의 관찰되지 않았다. 이러한 RFP 형광단백질의 유전자 사일런싱을 정량적으로 분석하였을 때 상기 리포펙타민을 처리한 siRNA는 약 60%, 상기 siRNA 전달용 재조합 단백질을 처리한 siRNA는 약 70%의 유전자 발현억제를 보여줌을 확인하였다. RGD 펩타이드가 없기 때문에 세포 투과력이 떨어지는 2b protein/siRNA 결합체와 siRNA가 없는 2b-RGD 전달체는 어떠한 유전자 발현억제도 관찰할 수 없었다.As shown in FIG. 12, the control cells without siRNA showed strong fluorescence intensity due to the expression of RFP fluorescent protein. However, the siRNA treated with the lipofectamine and the recombinant protein for siRNA delivery showed the expression of RFP fluorescent protein Respectively. In addition, when scramble siRNA that did not match the RFP protein-coding gene was treated with the siRNA delivery recombinant protein, gene silencing was hardly observed. Quantitative analysis of the gene silencing of the RFP fluorescent protein showed that about 60% of the siRNA treated with the lipofectamine and the siRNA treated with the siRNA delivery recombinant protein showed about 70% of the gene expression inhibition . No 2b protein / siRNA conjugates with reduced cell permeability and no 2b-RGD transporter without siRNAs due to lack of RGD peptide could not observe any gene expression inhibition.
도 12의 그림 C는 시간에 따른 유전자 발현 억제 효과를 정량적으로 나타내는 것으로(Control: RFG 유전자가 발현되는 B16F10 세포, 2b-RGD/siRNA: siRNA 전달용 재조합 단백질을 이용하여 siRNA를 세포에 주입한 경우, 2b-RGD/sc siRNA: RFP 유전자에 매칭하지 않는 scramble siRNA를 siRNA 전달용 재조합 단백질에 봉입하여 세포에 주입한 경우, LF/siRNA: 기존 siRNA 전달체인 리포펙타민을 사용한 경우, 2b/siRNA: RGD 펩타이드가 없는 2b protein/siRNA 결합체를 세포에 처리한 경우, 2b-RGD: siRNA 없이 siRNA 전달용 재조합 단백질만을 주입한 경우), 유전자 발현 억제는 2b-RGD/siRNA 결합체를 처리한지 24시간 경과하였을 때 최대의 억제효과가 나타났고 그 이후로는 점점 감소하였으며 약 3일까지 억제효과가 관찰되었다. FIG. 12 shows quantitatively the effect of suppressing gene expression over time (Control: B16F10 cells expressing the RFG gene, 2b-RGD / siRNA: siRNAs injected into the cells using the recombinant protein for siRNA delivery , 2b-RGD / sc siRNA: scramble siRNA that does not match the RFP gene was injected into the cell for transfection into siRNA delivery recombinant protein. LF / siRNA: 2b / siRNA when using lipofectamine, RGD peptide-free 2b protein / siRNA conjugate was treated with 2b-RGD: no siRNA, only the recombinant protein for siRNA delivery was injected. Inhibition of gene expression was observed 24 hours after 2b-RGD / siRNA conjugate treatment The maximum inhibitory effect was observed, and thereafter, the inhibitory effect was observed until about 3 days.
또한, 본 발명자들은 RT-PCR을 이용하여 세포 내의 RFP mRNA의 양 분석을 통해 상기 siRNA 전달용 재조합 단백질의 siRNA 전달 효과를 확인하였다. The present inventors also confirmed the effect of siRNA delivery of the recombinant protein for siRNA delivery by analyzing the amount of RFP mRNA in cells using RT-PCR.
RFP mRNA에 매칭될 수 있는 프라이머 (정방향 프라이머 5’-GGCTGCTTCATCTACAAGGT-3’ (서열번호 9) 및 역방향 프라이머 5’-GCGTCCACGTAGTAGTAGCC-3’ (서열번호 10)) 및 대조군 실험을 위한 β-actin과 매칭되는 프라이머 (정방향 프라이머 5’-AGAGGGAAATCGTGCGTGAC-3’ (서열번호 11) 및 역방향 프라이머 5’-CAATAGTGATGACCTGGCCGT-3’ (서열번호 12)를 이용하여 세포 내의 RFP 유전자의 mRNA의 양을 정량하기 위한 RT-PCR을 수행하였으며 (변성 단계 95℃/30초, 어닐링 단계 51℃/30초, 신장 단계 72℃/30초, 20 사이클), 전기영동 후 각각의 밴드에 대한 정량은 DNR’s GelQuant (image analysis) 프로그램을 이용하였고, 그 결과를 도 13에 나타내었다. (Forward primer 5'-GGCTGCTTCATCTACAAGGT-3 '(SEQ ID NO: 9) and reverse primer 5'-GCGTCCACGTAGTAGTAGCC-3' (SEQ ID NO: 10)) that can be matched to RFP mRNA and beta-actin RT-PCR to quantify the amount of mRNA of the RFP gene in the cell using the primer (forward primer 5'-AGAGGGAAATCGTGCGTGAC-3 '(SEQ ID NO: 11) and reverse primer 5'-CAATAGTGATGACCTGGCCGT-3' (SEQ ID NO: 12) (Denaturation step of 95 ° C for 30 seconds, annealing step of 51 ° C for 30 seconds, elongation step of 72 ° C for 30 seconds, 20 cycles), quantification of each band after electrophoresis was performed using DNR's GelQuant And the results are shown in Fig.
2b-RGD/siRNA 결합체를 처리하였을 경우 RFP mRNA의 분해가 가장 활발히 이루어졌으며 이것은 RT-PCR에서 증폭되는 RFP RNA의 양이 상대적으로 가장 적게 검출되는 것으로부터 확인하였다. 대조군과 비교시, 상기 리포펙타민과 함께 처리한 siRNA는 약 60%, 상기 siRNA 전달용 재조합 단백질과 함께 처리한 siRNA는 약 80%의 RFP mRNA의 감소를 보여주었다. 또한 2b-RGD/sc siRNA 결합체와 siRNA가 없는 2b-RGD 전달체를 처리한 경우 어떠한 RFP mRNA의 분해를 관찰할 수 없었다.When the 2b-RGD / siRNA conjugate was treated, the degradation of RFP mRNA was most actively detected, and it was confirmed that the amount of RFP RNA amplified by RT-PCR was the least detected. In comparison with the control group, about 60% of the siRNA treated with the lipofectamine and the siRNA treated with the siRNA delivery recombinant protein showed about 80% reduction in RFP mRNA. In addition, no degradation of RFP mRNA was observed when the 2b-RGD / sc siRNA conjugate and siRNA-free 2b-RGD transporter were treated.
또한, RGD 펩타이드가 생략된 2b protein/siRNA 결합체를 처리한 경우도 어떠한 RFP mRNA의 분해를 관찰할 수 없었는데 이러한 결과는 RGD 펩타이드가 없기 때문에 2b protein/siRNA 결합체의 암세포 세포 투과력이 떨어졌기 때문이다.In addition, the degradation of any RFP mRNA could not be observed even when the 2b protein / siRNA conjugate lacking the RGD peptide was treated. This result is because the 2b protein / siRNA conjugate has low permeability to cancer cells due to the absence of the RGD peptide.
도 14에 나타난 바와 같이, RFP 항체를 이용하여 유전자 발현 억제를 확인하였을 때 RFP 형광단백질이 발현되는 대조군 세포와는 다르게 리포펙타민 또는 상기 siRNA 전달용 재조합 단백질를 이용하여 siRNA를 처리한 세포에서는 RFP 단백질의 검출이 현저히 감소하였다. RFP 단백질-코딩 유전자와 매칭(matching)되지 않는 scramble siRNA를 상기 siRNA 전달용 재조합 단백질과 처리하였을 때는 RFP 단백질 감소가 거의 확인되지 않았다. siRNA가 없는 2b-RGD 전달체 및 RGD 펩타이드가 생략된 2b protein/siRNA 결합체를 처리한 경우도 RFP 단백질 감소가 거의 확인되지 않았다. As shown in FIG. 14, when the inhibition of gene expression was confirmed using RFP antibody, unlike control cells expressing RFP fluorescent protein, cells treated with siRNA using lipofectamine or recombinant protein for siRNA delivery showed that RFP protein Was significantly reduced. When scramble siRNA that did not match the RFP protein-coding gene was treated with the siRNA delivery recombinant protein, there was almost no decrease in RFP protein. No reduction in RFP protein was observed when the siRNA-free 2b-RGD transporter and the 2b protein / siRNA conjugate without the RGD peptide were treated.
이를 통해 siRNA 전달용 재조합 단백질에 의한 세포 내로 전달된 siRNA가 사일런싱(gene silencing)임을 일으킴을 확인할 수 있었다.This confirmed that the siRNA delivered into the cell by the recombinant protein for siRNA delivery is gene silencing.
<110> KOREA INSTITUTE OF SCIENCE AND TECHNOLOGY <120> Recombinant protein for siRNA delivery and composition comprising the same <130> DPP20134625KR <160> 12 <170> KopatentIn 1.71 <210> 1 <211> 69 <212> PRT <213> Tomato aspermy virus <220> <221> PEPTIDE <222> (1)..(69) <223> RNA binding 2b protein <400> 1 Met Ala Ser Ile Glu Ile Pro Leu His Glu Ile Ile Arg Lys Leu Glu 1 5 10 15 Arg Met Asn Gln Lys Lys Gln Ala Gln Arg Lys Arg His Lys Leu Asn 20 25 30 Arg Lys Glu Arg Gly His Lys Ser Pro Ser Glu Gln Arg Arg Ser Glu 35 40 45 Leu Trp His Ala Arg Gln Val Glu Leu Ser Ala Ile Asn Ser Asp Asn 50 55 60 Ser Ser Asp Glu Gly 65 <210> 2 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> linker peptide <400> 2 Gly Ser Gly Gly Gly Asp Glu Ala Asp 1 5 <210> 3 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> RGD peptide <400> 3 Cys Asp Cys Arg Gly Asp Cys Phe Cys 1 5 <210> 4 <211> 87 <212> PRT <213> Artificial Sequence <220> <223> recombination protein for siRNA delivery <400> 4 Met Ala Ser Ile Glu Ile Pro Leu His Glu Ile Ile Arg Lys Leu Glu 1 5 10 15 Arg Met Asn Gln Lys Lys Gln Ala Gln Arg Lys Arg His Lys Leu Asn 20 25 30 Arg Lys Glu Arg Gly His Lys Ser Pro Ser Glu Gln Arg Arg Ser Glu 35 40 45 Leu Trp His Ala Arg Gln Val Glu Leu Ser Ala Ile Asn Ser Asp Asn 50 55 60 Ser Ser Asp Glu Gly Gly Ser Gly Gly Gly Asp Glu Ala Asp Cys Asp 65 70 75 80 Cys Arg Gly Asp Cys Phe Cys 85 <210> 5 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> forward primer for RNA 2b protein <400> 5 catatggcaa gcatcgagat ccct 24 <210> 6 <211> 92 <212> DNA <213> Artificial Sequence <220> <223> reverse primer for RNA 2b protein <400> 6 atatgctcga gtcatgacat cattggaact gagtcagggt acgccgaata gtcagcttca 60 tcaccgcctc cggatccctc gctttctttc tt 92 <210> 7 <211> 19 <212> RNA <213> Artificial Sequence <220> <223> siRNA for RFP (sense) <400> 7 uguagaugga cuugaacuc 19 <210> 8 <211> 19 <212> RNA <213> Artificial Sequence <220> <223> siRNA for RFP (anti-sense) <400> 8 gaguucaagu ccaucuaca 19 <210> 9 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer for RFP <400> 9 ggctgcttca tctacaaggt 20 <210> 10 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer for RFP <400> 10 gcgtccacgt agtagtagcc 20 <210> 11 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer for beta actin <400> 11 agagggaaat cgtgcgtgac 20 <210> 12 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer for beta actin <400> 12 caatagtgat gacctggccg t 21 <110> KOREA INSTITUTE OF SCIENCE AND TECHNOLOGY <120> Recombinant protein for siRNA delivery and composition the same <130> DPP20134625 <160> 12 <170> Kopatentin 1.71 <210> 1 <211> 69 <212> PRT <213> Tomato aspermy virus <220> <221> PEPTIDE <222> (1) (69) <223> RNA binding 2b protein <400> 1 Met Ala Ser Ile Glu Ile Pro Leu His Glu Ile Ile Arg Lys Leu Glu 1 5 10 15 Arg Met Asn Gln Lys Lys Gln Ala Gln Arg Lys Arg His Lys Leu Asn 20 25 30 Arg Lys Glu Arg Gly His Lys Ser Pro Ser Glu Gln Arg Arg Ser Ser 35 40 45 Leu Trp His Ala Arg Gln Val Glu Leu Ser Ala Ile Asn Ser Asp Asn 50 55 60 Ser Ser Asp Glu Gly 65 <210> 2 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> linker peptide <400> 2 Gly Ser Gly Gly Gly Asp Glu Ala Asp 1 5 <210> 3 <211> 9 <212> PRT <213> Artificial Sequence <220> <223> RGD peptide <400> 3 Cys Asp Cys Arg Gly Asp Cys Phe Cys 1 5 <210> 4 <211> 87 <212> PRT <213> Artificial Sequence <220> <223> recombination protein for siRNA delivery <400> 4 Met Ala Ser Ile Glu Ile Pro Leu His Glu Ile Ile Arg Lys Leu Glu 1 5 10 15 Arg Met Asn Gln Lys Lys Gln Ala Gln Arg Lys Arg His Lys Leu Asn 20 25 30 Arg Lys Glu Arg Gly His Lys Ser Pro Ser Glu Gln Arg Arg Ser Ser 35 40 45 Leu Trp His Ala Arg Gln Val Glu Leu Ser Ala Ile Asn Ser Asp Asn 50 55 60 Ser Ser Asp Glu Gly Gly Ser Gly Gly Gly Asp Glu Ala Asp Cys Asp 65 70 75 80 Cys Arg Gly Asp Cys Phe Cys 85 <210> 5 <211> 24 <212> DNA <213> Artificial Sequence <220> <223> forward primer for RNA 2b protein <400> 5 catatggcaa gcatcgagat ccct 24 <210> 6 <211> 92 <212> DNA <213> Artificial Sequence <220> <223> reverse primer for RNA 2b protein <400> 6 atatgctcga gtcatgacat cattggaact gagtcagggt acgccgaata gtcagcttca 60 tcaccgcctc cggatccctc gctttctttc tt 92 <210> 7 <211> 19 <212> RNA <213> Artificial Sequence <220> <223> siRNA for RFP (sense) <400> 7 uguagaugga cuugaacuc 19 <210> 8 <211> 19 <212> RNA <213> Artificial Sequence <220> <223> siRNA for RFP (anti-sense) <400> 8 gaguucaagu ccaucuaca 19 <210> 9 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer for RFP <400> 9 ggctgcttca tctacaaggt 20 <210> 10 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> reverse primer for RFP <400> 10 gcgtccacgt agtagtagcc 20 <210> 11 <211> 20 <212> DNA <213> Artificial Sequence <220> <223> forward primer for beta actin <400> 11 agagggaaat cgtgcgtgac 20 <210> 12 <211> 21 <212> DNA <213> Artificial Sequence <220> <223> reverse primer for beta actin <400> 12 caatagtgat gacctggccg t 21
Claims (17)
A-B-C
상기에서, A 는 서열번호 1의 아미노산 서열로 이루어진 siRNA 결합 단백질이며;
B 는 서열번호 2의 아미노산 서열로 이루어진 링커 펩타이드이며; 및
C 는 서열번호 3의 아미노산 서열로 이루어진 RGD 펩타이드이다.
siRNA binding protein and an RGD (Arg-Gly-Asp) peptide, wherein the RGD peptide is fused to the C-terminus of the siRNA binding protein, and the recombinant protein for siRNA delivery having the following structure:
ABC
In the above, A is an siRNA binding protein consisting of the amino acid sequence of SEQ ID NO: 1;
B is a linker peptide consisting of the amino acid sequence of SEQ ID NO: 2; And
C is an RGD peptide consisting of the amino acid sequence of SEQ ID NO: 3.
2. The recombinant protein for siRNA delivery according to claim 1, wherein the siRNA binding protein is an RNA binding 2b protein derived from tomato aspermy virus.
The siRNA delivery recombinant protein of claim 1, wherein the RGD peptide binds to an integrin membrane receptor that is specifically overexpressed in cancer cells.
2. The siRNA delivery recombinant protein of claim 1, wherein the siRNA binding protein forms a homodimer.
7. The recombinant protein for siRNA delivery according to claim 6, wherein the siRNA binding protein forms a homodimer and the RGD peptide is fused to the N-terminal or C-terminal of each siRNA binding protein.
4. The siRNA delivery recombinant protein of claim 1, wherein the recombinant protein comprises the amino acid sequence of SEQ ID NO: 4.
Comprising the step of fusing an RGD peptide consisting of the amino acid sequence of SEQ ID NO: 3 using a linker peptide consisting of the amino acid sequence of SEQ ID NO: 2 at the C terminus of an siRNA binding protein consisting of the amino acid sequence of SEQ ID NO: Lt; RTI ID = 0.0 > siRNA < / RTI >
상기 siRNA 전달용 재조합 단백질에 결합된 siRNA를 포함하는, siRNA 전달용 조성물.
A recombinant protein for siRNA delivery according to claim 1, and
And a siRNA bound to the recombinant protein for siRNA delivery.
The siRNA binding protein according to claim 15, wherein the siRNA binding protein forms a homodimer, wherein the RGD peptide is fused to the N-terminus or C-terminus of each siRNA binding protein, and siRNA is bound to the binding site of the siRNA binding protein. / RTI >
상기 siRNA 전달용 재조합 단백질을 siRNA 와 반응시키는 단계를 포함하는,
제15항의 siRNA 전달용 조성물 제조방법.A recombinant protein for siRNA delivery is prepared by fusing an RGD peptide consisting of the amino acid sequence of SEQ ID NO: 3 using a linker peptide consisting of the amino acid sequence of SEQ ID NO: 2 at the C terminus of the siRNA binding protein comprising the amino acid sequence of SEQ ID NO: ; And
And reacting the recombinant protein for siRNA delivery with siRNA.
16. The method for preparing a siRNA delivery composition according to claim 15.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020130117420A KR101559974B1 (en) | 2013-10-01 | 2013-10-01 | Recombinant protein for siRNA delivery and composition comprising the same |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020130117420A KR101559974B1 (en) | 2013-10-01 | 2013-10-01 | Recombinant protein for siRNA delivery and composition comprising the same |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| KR20150039259A KR20150039259A (en) | 2015-04-10 |
| KR101559974B1 true KR101559974B1 (en) | 2015-10-15 |
Family
ID=53029594
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020130117420A KR101559974B1 (en) | 2013-10-01 | 2013-10-01 | Recombinant protein for siRNA delivery and composition comprising the same |
Country Status (1)
| Country | Link |
|---|---|
| KR (1) | KR101559974B1 (en) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102228271B1 (en) | 2019-07-16 | 2021-03-17 | 한국과학기술연구원 | immune regulatory protein-siRNA complex for anticancer activity |
| JP2023537629A (en) * | 2020-08-14 | 2023-09-04 | コリア・インスティテュート・オブ・サイエンス・アンド・テクノロジー | Immunomodulatory protein-siRNA complexes with anticancer activity |
| NL2033185B1 (en) * | 2022-09-29 | 2024-04-08 | Stichting Vu | Compounds for rna stabilisation and delivery |
-
2013
- 2013-10-01 KR KR1020130117420A patent/KR101559974B1/en active IP Right Grant
Non-Patent Citations (3)
| Title |
|---|
| 논문1: EMBOREPORTS* |
| 논문2: MOL. 석사학위논문, 고려대학교 |
| 논문3: ADV DRUG DELIV REV. |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20150039259A (en) | 2015-04-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR101317100B1 (en) | Peptides useful as cell-penetrating peptides | |
| JP5726299B2 (en) | Cell penetrating peptides and uses thereof | |
| Vasconcelos et al. | Therapeutic potential of cell-penetrating peptides | |
| CN102066405B (en) | For the supercharged proteins of cell-penetrating | |
| US9580468B2 (en) | Methods and reagents for efficient and targeted delivery of therapeutic molecules to CXCR4 cells | |
| JP2016008217A (en) | Supercharged proteins for cell penetration | |
| JP2011523353A5 (en) | ||
| WO2014046481A1 (en) | Cell penetrating peptide, conjugate comprising same, and composition comprising conjugate | |
| KR101647804B1 (en) | Novel Cell Penetrating Peptides and Uses Thereof | |
| KR101258279B1 (en) | Development of the macromolecule transduction domain with improved cell permeability and its applications | |
| KR101559974B1 (en) | Recombinant protein for siRNA delivery and composition comprising the same | |
| KR101430232B1 (en) | p19-YSA Recombinant protein for intracellular delivery of siRNA and composition comprising the same | |
| US10550151B2 (en) | Cell-penetrating compositions and methods using same | |
| EP2970510A1 (en) | Methods and compositions for treating cancer and inflammatory diseases | |
| KR101253261B1 (en) | Recombinant protein for siRNA delivery and composition comprising the same | |
| KR101579879B1 (en) | Hyaluronic acid-cholesterol nanoparticles for siRNA delivery and composition comprising the same | |
| KR101708424B1 (en) | Corynebacterium sp. Bacteria and Minicell Derived from The Same and Uses Thereof | |
| US11834517B2 (en) | Branched peptides for enzymatic assembly and mitochondria drug delivery | |
| WO2022218997A1 (en) | Novel universal vaccine presenting system | |
| KR20140046995A (en) | Cell penetrating peptide comprising np1 polypeptide derived from human nlbp protein and cargo delivery system using the same | |
| AU2009270340A1 (en) | Therapeutic agents |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| A201 | Request for examination | ||
| E902 | Notification of reason for refusal | ||
| E701 | Decision to grant or registration of patent right | ||
| GRNT | Written decision to grant | ||
| FPAY | Annual fee payment |
Payment date: 20181001 Year of fee payment: 4 |