IL324488A - Switch receptors - Google Patents

Switch receptors

Info

Publication number
IL324488A
IL324488A IL324488A IL32448825A IL324488A IL 324488 A IL324488 A IL 324488A IL 324488 A IL324488 A IL 324488A IL 32448825 A IL32448825 A IL 32448825A IL 324488 A IL324488 A IL 324488A
Authority
IL
Israel
Prior art keywords
cell
domain
seq
chimeric receptor
receptor polypeptide
Prior art date
Application number
IL324488A
Other languages
Hebrew (he)
Inventor
Stephan Gasser
Christian Klein
Dominic Schwarz
Dario Venetz
Original Assignee
Hoffmann La Roche
Stephan Gasser
Christian Klein
Dominic Schwarz
Dario Venetz
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Hoffmann La Roche, Stephan Gasser, Christian Klein, Dominic Schwarz, Dario Venetz filed Critical Hoffmann La Roche
Publication of IL324488A publication Critical patent/IL324488A/en

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/34Antigenic peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/35Cytokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5434IL-12
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23On/off switch
    • A61K2239/24Dimerizable CARs; CARs with adapter
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/43Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Description

P38561-W0 Switch Receptors Sequence Listing The instant application contains a Sequence Listing which has been submitted electronically in XML format compliant with WIPO Standard ST.26 and is hereby incorporated by reference in its entirety. Said XML file, created on May 7, 2024, is named P38561-WO-Seq.xml, and is 88,941 bytes in size.
Field of the invention The present disclosure relates to the fields of molecular biology, more specifically cytokine receptors. The present disclosure also relates to methods of medical treatment and prophylaxis, particularly cellular immunotherapy.
Background Chimeric antigen receptor (CAR) expressing T cells have shown clinical efficacy in different hematologic malignancies. For solid tumor indications CAR-T cell therapies have yet to provide meaningful clinical benefits over conventional chemo- and immunotherapies. This discrepancy can be attributed to several factors, including tumor heterogeneity, limited immune cell tumor infiltration, the tumor microenvironment (TME) as well as the display or secretion of immune inhibitory factors.
Immune inhibitory ligands such as PD-L1, PD-L2, and CTLA-4, are well known to interact with their respective receptors on T cells, leading to T cell exhaustion and impaired anti-tumor response. Moreover, the release of immune-inhibitory cytokines (e.g., IL10, IL4, TGFp) can dampen T cell function and promote tumor immune escape.
Interleukin 23 (IL23) has emerged as a potential factor with pro-carcinogenic properties. IL23, produced by tumour-associated immune cells, can promote tumour growth and metastasis (Li et al., Carcinogenesis 34, no. 3 (March 2013): 658-66.; Zhang et al., Carcinogenesis 35, no. 6 (June 2014): 1330-40.; Langowski et al., Nature 442, no. 7101 (July 2006): 461-65.), angiogenesis, mediate tumour immune evasion and suppression (Fu et AL, European Urology 75, no. 5 (May 2019): 752-63.); Teng, et al. Proceedings of the National Academy of Sciences 107, no. 18 (May 4, 2010): 8328-33.), and shows potential as a diagnostic marker for lung- and breast cancer. (Gangemi et al. Journal of Cellular Biochemistry 113, no. 6 (June 2012): 2122-25.); Zhang et al. Therapeutics and Clinical Risk Management Volume 18 (April 2022): 429-37.).
For instance, one study highlights that IL23 blockade in cancer treatment destabilizes intratumoral Tregs and leads to an advantageous outcome (Wight et al., Proceedings of the National Academy of Sciences 119, no. 18 (May 3, 2022): 62200757119.). This is underlined by the fact that IL23 and IL12 are part of the same receptor superfamily, but their signalling consequences can be opposing (Sieve et al., European Journal of Immunology 40, no. 8 (August 2010): 2236-47.; Teng et al., Cancer Research 72, no. 16 (August 15, 2012): 3987-96.; Kortylewski et al., Cancer Cell 15, no. 2 (February 2009): 114-23.).
P38561-W0 While the potent antitumor function of IL12 is well documented, approaches to induce IL12 signalling in the tumour remain challenging. For example, a method involving systematic and/or untargeted downregulation of IL-23 or upregulation of IL12 signalling would severely interfere with the proper function of the immune system and have serious consequences are risks for the patient’s health. Hence, a strategy that modulates the balance between IL23 and IL12 signalling holds promise in improving CAR-T cell therapy outcomes in solid tumours. On the other hand, while some groups have tried making chimeric receptors (a.k.a. switch receptors) in order to direct the signalling pathway to the desired route, one of the challenges associated with this strategy is finding mutations that efficiently prevent activation by the original ligand without otherwise compromising the receptor’s structure or intrinsic ability to activate gene transcription.
The disclosure provided here provides solutions to the problems existing with previous attempts to manipulate immune cells and potentially offer improved methods for treatments involving cell transfer.
Summary of the invention The present invention generally relates to chimeric cytokine receptors (also referred to as switch receptors or chimeric receptor polypeptides herein) capable of translating an interleukin-23 signal into a cellular response akin to interleukin-12. The chimeric cytokine receptors of the invention are comprised of at least the first extracellular domain of the interleukin-23 receptor and further extracellular domains of the interleukin-12 receptor beta 2, the intracellular domains of the Interleukin-12 receptor beta 2 and the transmembrane domain of either receptor. After engagement of the chimeric cytokine receptor with interleukin-23 and interleukin-12 receptor beta 1, a chimeric receptor complex is formed that leads to an intracellular response akin to interleukin-12, in a dose-dependent manner. The invention also relates to nucleic acid molecules encoding the chimeric cytokine receptors of the present invention, vectors, cells, pharmaceutical compositions, and uses and methods as described below.
In a first aspect, the present disclosure provides a chimeric receptor polypeptide comprising:(i) an extracellular portion comprising an IL23-binding domain;(ii) an intracellular portion comprising the intracellular domains of IL12Rb2 (Interleukin-12 receptor beta 2); and(iii) a transmembrane domain that joins the extracellular portion and the intracellular portion.
In some embodiments, the IL23-binding domain of the chimeric receptor polypeptide binds the p19 subunit of IL23.
In some embodiments, the intracellular portion comprises the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the transmembrane domain is selected from the transmembrane domain of IL12Rb2, IL23Ra, CDS, and CD28.
P38561-W0 In some embodiments, the transmembrane domain comprises an amino acid sequence selected from SEQ ID Nos: 3, 4, 22, 33, or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the chimeric receptor polypeptide further comprises a signal sequence.
In some embodiments, the signal sequence comprises the amino acid sequence of SEQ ID NO: 1 or 16.
In some embodiments, the chimeric receptor polypeptide further comprises one or more linkers.
In some embodiments, the linker is a GS linker, a 2A linker, an a-helical linker, a glycine-alanine polymer linker, an alanine-serine polymer linker, or an lgG4-Fc linker.
In some embodiments, the chimeric receptor polypeptide further comprises a tag polypeptide, e.g. a Flag tag.
In some embodiments, the chimeric receptor polypeptide further comprises a marker, e.g. a fluorescent polypeptide, e.g. GFP or eGFP.
In some embodiments, the chimeric receptor polypeptide comprises from the N-terminus to the C-terminus: Optional signal peptide - optional tag - optional linker - IL23-binding domain -transmembrane domain - intracellular portion comprising the intracellular domains of IL12Rb2 - optional linker - optional marker In some embodiments, the IL23-binding domain comprises an extracellular domain of IL23Ra (a.k.a. IL23R).
In some embodiments, the IL23-binding domain comprises the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the IL23-binding domain comprises the amino acid sequence of SEQ ID NO: 35 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the IL23-binding domain comprises the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
P38561-W0 In some embodiments, the chimeric receptor polypeptide further comprises, between the IL23-binding domain and the transmembrane domain, an amino acid sequence of SEQ ID NO: 47 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the chimeric receptor polypeptide further comprises, between the IL23-binding domain and the transmembrane domain, an amino acid sequence of SEQ ID NO: 48 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the chimeric receptor polypeptide further comprises, between the IL23-binding domain and the transmembrane domain, an amino acid sequence of SEQ ID NO: 15 or an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity thereto.
In some embodiments, the IL23-binding domain comprises a Fv, scFv, Fab, Fab‘, Fab‘-SH, F(ab’)2, crossFab, scFab, a single domain antibody (sdAb), or a designed ankyrin repeat protein (DARPin).
In some embodiments, the chimeric receptor polypeptide comprises an amino acid sequence having at least 80% (preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99%) sequence identity to an amino acid sequence selected from SEQ ID Nos: 36-44.
In a second aspect, the present disclosure provides a nucleic acid, or a plurality of nucleic acids, encoding a chimeric receptor polypeptide disclosed herein, e.g. in the first aspect and the embodiments thereof, and optionally further comprising a nucleic acid sequence encoding a chimeric antigen receptor.
In a third aspect, the present disclosure provides an expression vector, or a plurality of expression vectors, comprising a nucleic acid or a plurality of nucleic acids disclosed herein, e.g. in the second aspect.
In a fourth aspect, the present disclosure provides a cell comprising a chimeric receptor polypeptide according to the first aspect, a nucleic acid or a plurality of nucleic acids according to the second aspect, or an expression vector or a plurality of expression vectors according to the third aspect.
In some embodiments, the cell expresses IL12Rb1 (Interleukin-12 receptor beta 1 chain).
In some embodiments, the cell is a eukaryotic cell. In some embodiments, the eukaryotic cell is an animal cell. In some embodiments, the animal cell is a mammalian cell. In some embodiments, the mammalian cell is a human cell.
In some embodiments, the cell is an immune cell, a neuron, an epithelial cell, an endothelial cell, or a stem cell.
P38561-W0 In some embodiments, the cell is an immune cell.
In some embodiments, the immune cell is a tumor infiltrating lymphocyte (TIL), B cell, a monocyte, a natural killer (NK) cell, a basophil, an eosinophil, a neutrophil, a dendritic cell, a macrophage, a regulatory T cell (Treg), a helper T cell (Th), a cytotoxic T cell (Tctl), an effector T cell, a memory T cell, a Natural Killer T (NKT) cell, or other T cell. In some embodiments, the immune cell further comprises a chimeric antigen receptor (CAR). In some embodiments, the immune cell further comprises an engineered TCR.
In some embodiments, the cell shows a dose-dependent phosphorylation of STAT4 but not STAT3 when treated with IL23.
In some embodiments, the cell is a transduced T cell capable of expressing the chimeric receptor polypeptide according to the first aspect and the embodiments thereof.
In some embodiments, the cell expresses an antigen binding receptor comprising an anchoring transmembrane domain and an extracellular domain, wherein the extracellular domain comprises an antigen binding moiety comprising(i) a heavy chain variable domain (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO:49, a HCDR 2 of SEQ ID NO:50 or SEQ ID NO:51, and a HCDR 3 of SEQ ID NO:52, and(ii) a light chain variable domain (VL) comprising a light chain complementarity determining region (LCDR) 1 of SEQ ID NO:53, a LCDR 2 of SEQ ID NO:54 and a LCDR 3 of SEQ ID NO:55.
In some embodiments, the VH domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO 59.
In some embodiments, the VL domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:60 or SEQ ID NO:61.
In some embodiments, the anchoring transmembrane domain is a transmembrane domain selected from the group consisting of the CDS, the CD4, the CD3z, the FCGR3A, the NKG2D, the CD27, the CD28, the CD137, the OX40, the ICOS, the DAP10 or the DAP12 transmembrane domain or a fragment thereof, in particular wherein the anchoring transmembrane domain is the CDS transmembrane domain or a fragment thereof.
In some embodiments, the antigen binding receptor further comprises at least one stimulatory signalling domain and/or at least one co-stimulatory signalling domain.
In some embodiments, the antigen binding receptor at least one stimulatory signalling domain is individually selected from the group consisting of the intracellular domain of CD3z, of FCGR3A and of NKG2D, or P38561-W0 fragments thereof that retains stimulatory signalling activity, in particular wherein the at least one stimulatory signalling domain is the CD3z intracellular domain or a fragment thereof that retains CD3z stimulatory signalling activity.
In some embodiments, the antigen binding receptor the at least one co-stimulatory signalling domain is individually selected from the group consisting of the intracellular domain of CD27, of CD28, of CD137, of 0X40, of ICOS, of DAP10 and of DAP12, or fragments thereof that retain co-stimulatory signalling activity.
In some embodiments, the antigen binding receptor comprises at least one CD28 costimulatory domain or a fragment thereof that retains CD28 co-stimulatory activity, and/or at least one CD137 costimulatory domain or a fragment thereof that retains CD137 co-stimulatory activity.
In some embodiments, the antigen binding receptor comprises a stimulatory signalling domain comprising the intracellular domain of CD3z, ora fragment thereof that retains CD3z stimulatory signalling activity, and wherein the antigen binding receptor comprises a co-stimulatory signalling domain comprising the intracellular domain of CD28, or a fragment thereof that retains CD28 co-stimulatory signalling activity.
In some embodiments, the antigen binding receptor comprises one stimulatory signalling domain comprising the intracellular domain of CD3z, or a fragment thereof that retains CD3z stimulatory signalling activity, and wherein the antigen binding receptor comprises one co-stimulatory signalling domain comprising the intracellular domain of CD137, or a fragment thereof that retains CD137 co-stimulatory signalling activity.
In some embodiments, the antigen binding moiety is connected at the C-terminus to the N-terminus of the anchoring transmembrane domain, optionally through a peptide linker.
In some embodiments, in the antigen binding receptor the light chain variable domain (VL) of the antigen binding moiety is connected at the C-terminus to the N-terminus of the anchoring transmembrane domain, optionally through a peptide linker, and/or wherein the heavy chain variable domain (VH) is connected at the C-terminus to the N-terminus of the light chain variable domain (VL), optionally through a peptide linker.
In a fifth aspect, the present disclosure provides a pharmaceutical composition comprising the cell according to the fourth aspect, and optionally a pharmaceutically acceptable excipient.
In a fifth aspect, the present disclosure provides the chimeric receptor polypeptide according to the first aspect, or the nucleic acid(s) according to the second aspect, or the cell according to the third aspect, or the pharmaceutical composition according to the fourth aspect, for use in a method of medical treatment of a disease or prophylaxis of a disease. In some embodiments, the method is a cell therapy, e.g. an adoptive cell therapy, the disease is a cancer, an autoimmune disease, or an infection. In some embodiments, the cancer is selected from the group consisting of acute leukemias (including but not limited to acute myeloid leukemia (AML), B-cell acute lymphoid leukemia (BALL), T-cell acute lymphoid leukemia (TALL), and acute P38561-W0 lymphoid leukemia (ALL)), chronic leukemias (including but not limited to chronic myelogenous leukemia (CML) and chronic lymphocytic leukemia (CLL)), multiple myeloma (MM), myelodysplastic syndrome (MDS), myeloproliferative neoplasms (MPNs), chronic myeloid leukemia (CML), and blastic plasmacytoid dendritic cell neoplasm (BPDCN).In some embodiments, the chimeric receptor polypeptide according to the first aspect, or the nucleic acid(s) according to the second aspect, or the cell according to the third aspect, or the pharmaceutical composition according to the fourth aspect, is administered intravenously, intratumorally, or subcutaneously.
In a sixth aspect, the present disclosure provides a method for modulating the activity of an immune cell, said method comprising: administering, to an immune cell, the nucleic acid or plurality of nucleic acids according to the second aspect, or the expression vector or plurality of expression according to the third aspect. In some embodiments, the immune cell is a tumour infiltrating lymphocyte (TIL), B cell, a monocyte, a natural killer (NK) cell, a basophil, an eosinophil, a neutrophil, a dendritic cell, a macrophage, a regulatory T cell (Treg), a helper T cell (Th), a cytotoxic T cell (Tctl), an effector T cell, a memory T cell, a Natural Killer T (NKT) cell, or other T cell.
Brief Description of the Figures Embodiments and experiments illustrating the principles of the present disclosure will now be discussed with reference to the accompanying figures.
Figure 1A.Scientific rationale for the design of IL23-IL12sRs for adoptive cell therapy. A) Heatmap describing the distribution of IL23 in tumour- and normal tissues compiled from >11,000 RNA-seq samples available from the Cancer Genome Atlas (TCGA) database. Several tumours, dominantly lung and colon, display transcriptomic evidence of overexpression of IL23A in the tumour compared to normal tissue. B) Immunohistochemistry staining of HPAF-II (left) and MKN-45 (right) tumours in xenograft mouse models show presence of the protein in epithelial parts of the tumour.
Figure 1B.Schematic representation of wild type IL12 and IL23 receptor complexes and chimeric IL23- IL12 switch Receptors (IL23-IL12sR).
Figure 1C.Depictions of alternative IL23-IL125R formats.
Figure 1D.Overview of expression cassettes of IL23-IL12sR formats in a screening plasmid combined with a downstream GFP reporter.
Figure 1E.Overview of expression cassettes of IL23-IL125R formats as downstream gene element of different CAR constructs including variants with chimeric ECDs. AB-SP: human lgG1 antibody signal peptide; Tag: FLAG epitope tag. E2A can be replaced by another 2A self-cleaving peptide, e.g. T2A.
Figure 1F.Depiction of the mechanism of action of an immune cell engineered with IL23-IL12sRs. ד P38561-W0 Figure 2.Detection of IL23-IL125R on engineered immune cells. A) The expression of engineered IL23- IL12sRs was assessed indirectly by the expression of eGFP, which is placed downstream of the IL23- IL12sR expression cassette separated by a self-cleaving 2A-peptide. B) Detection of the anti P329G-CAR via AF647-labeled Fc molecule with P329G mutation and a FLAG-tagged variant of the IL23-IL12sR Figure 3.T cells engineered with an IL23-IL12sR show dose-dependent phosphorylation of A) STAT4 but not B) STAT3 in response to IL23 stimulation. Data in flow cytometric analysis is gated on lymphocytes and single cells (both FSC and SSC). IL23-IL12sR T cells are additionally gated on GFP reporter fluorescence. C) The upregulation of STAT4 can also be observed in T cells engineered with a P329G CAR and IL23- IL12sR. D) Upregulation of STAT3 in response to IL23 stimulation can only be observed in T cells overexpressing a recombinant wild type IL23R in vitro.
Figure 4.Functional analysis of T cells engineered with an IL23-IL12sR via detection of alternative surface expression of IL12 signalling-related markers in flow cytometry. A) Most prominently, the IL18Ra is upregulated in response to IL23 stimulation, in engineered cells exclusively. The response of an IL23- IL12sR variant with IL12Rb2-TMD appears 10-fold more sensitive. Either response shows a lower ECthan stimulation of wild type cells by IL12. B) In IL23-IL12sRT cells exclusively, the upregulation of IL12Rbvia a feed-forward mechanism triggered by STAT4 phosphorylation can be observed. Here, IL23-IL12sR (IL12Rb2-TMD) T cells show a lower IL12Rb2-baseline, more similar to the wild type cells, when compared to IL23-IL12sR (IL23R-TMD).
Figure 5.Functional analysis ofT cells engineered with a P329G-CAR with 41BB costimulation and IL23- IL12sR via detection of alternative surface expression of IL12 signalling-related markers in flow cytometry. A) Compared to previous results without co-expression of a P329G CAR, the IL18Ra upregulation is 2-fold higher, compared to wild type T cells stimulated with IL12. B) Upregulation of IL12Rb2 via a feed-forward mechanism triggered by STAT4 phosphorylation can be observed as well. C) Secretion of IFNy can be observed in a dose-dependent manner in response to IL23 or IL12. D) Compared to wild type T cells, the IFNy release mediated by IL12 is increased. A similar response is also triggered via stimulation with ILin cells with a P329G-CAR and IL23-IL12sR, but not in cells engineered with an IL23-IL12sR only.
Figure 6.Immune cells engineered with a P329G-CAR and FLAG-tagged IL23-IL12sR show increased killing of MKN-45 and HPAF-II target cells when stimulated with IL23. A) Engineered cells titrated with CEA- CAMS targeted IgG antibody carrying a P329G mutation in the Fc portion (e.g. as disclosed in WO2022029051A1) show dose-dependent killing efficiency in vitro. At suboptimal IgG adaptor concentrations, the addition of IL23 triggering IL23-IL12sRs potentiates target cell growth inhibition, represented as 20-40% increased MKN-45 killing in vitro. B) Likewise, CE AC AM 5 targeted killing of HPAF- II target cells is improved by 10-20%.
Figure 7. Detection and functional characteristics of immune cells engineered with a CEA-CAM5 CAR and non-FLAG-tagged IL23-IL12sR linked with a self-cleaving 2A-peptide. A) anti-CEA-CAM5 CAR expression was assessed with biotinylated CEA-Fc fusion molecule and secondary staining via AF647-labeled P38561-W0 Streptavidin. IL23-IL125R cannot be detected but expected to be similar to the CAR, analogous to previous results. B) T cells engineered with a direct CEA-CAR and IL23-IL12sR show dose dependent upregulation of surface markers IL18Ra and IL12Rb2, CD25 as well as secretion of IFNg. Compared to wild type T cells, the baseline CD25 level is increased.Figure 8. Immune cells engineered with a CEA-CAR and IL23-IL12sR show increased killing of MKN-target cells when stimulated with IL23. A) Especially in conditions with low effector to target (E:T) ratio, the effect is most apparent, ranging from an increase of 10-40% in overall growth inhibition, represented as cell killing. Notably, the increase in killing capacity induced by either IL12 at 100ng/mL or IL23 at 100 or 10ng/mL is very similar. B) Summary of killing capacity plotted as a function of E:T ratio, extracted on day of the experiment.
Figure 9. Alternative IL23-IL125R formats and functional characteristics thereof. A) The expression of alternative IL23-IL12sR formats can be detected indirectly by its effect on P329G-CAR expression, and directly by detection of the N-terminal FLAG-tag. Notably, full IL23R-ECD IL23-IL12sR variants express best and all variants with chimeric ECD influence the expression of the P329G-CAR negatively. B) All IL23- IL12sR formats lead to a similar upregulation of the IL18Ra, IL12Rb2 and IFNg release. Across all readouts, in IL23-IL12sR(1+5) and (3+3 variants, the dose-response is shifted to the left, and overall signal is increased.
Figure 10. Alternative IL23-IL125R formats and resulting increased CAR-T cell killing thereof. All variants except the IL23-IL12sR with IL23R-TMD show increased T cell killing when stimulated with IL23. Notably, variants with IL12Rb2 TMD and variants with (1+5) chimeric ECD show best killing without IL23 stimulation. Variants with (1+5) or (3+3) chimeric ECD show highest response to IL23 across different E:T ratios.
Figure 11. Immune cells engineered with a CEA-CAR and IL23-IL12sR and stimulated with IL23 show persistent killing of HPAF-II target cells in a repetitive killing assay. Effector and target cells were seeded at a ratio of 1:1. Effector cells were transferred to fresh target cells every 2 days with or without the addition of cytokines. Both CEA-CAR T cells and CEA-CAR IL23-IL125R T cells control the growth of HPAF-II cells CEA-CAR IL23-IL12sR T cells show repeated killing of target cells across 5 rounds.
Detailed Description Chimeric antigen receptor (CAR) expressing T cells have shown remarkable clinical efficacy, particularly improving survival rates of patients with advanced haematological malignancies. However, inhibitory factors of the tumour microenvironment, such as checkpoint molecules and immunosuppressive cytokines, limit CAR-T cell function particularly targeting solid cancers thus far. One approach of manipulating the tumour microenvironment used in the present invention is the development of switch receptors that translate an inhibitory signal into a beneficial signal.
We found out that several tumours, dominantly lung and colon, display transcriptomic evidence of overexpression of IL23A in the tumour compared to normal tissue (Figure 1A). Here, we make use of the 9 P38561-W0 evolutionary relationship of the IL23 and IL12 pathways and their shared receptor chain, IL12Rb1. Indeed, as indicated in Figure 1B, both complexes share the IL12Rb1 via their common p40 cytokine subunit. IL12Rb1 is constitutively expressed on the surface of human immune cells. IL12 specifically interacts with the IL12Rb2 via its p35 subunit to promote TYK2 and JAK2-mediated phosphorylation of STAT4. ILspecifically interacts with the IL23R to promote TYK2 and JAK2-mediated phosphorylation of STAT4 and STAT3. Chimeric IL23-IL12 switch receptors are composed of extracellular domains (ECD) of IL23R and intracellular domain (ICD) of IL12Rb2. Together with IL12Rb1, IL23R-IL12Rb2 switch receptors induce IL12-like signalling via phosphorylation of STAT4 upon stimulation with IL23.
The chimeric switch receptors of the present invention translate the pro-carcinogenic signal of IL23 into a cytotoxic IL12 signal. Surprisingly, T cells, e.g. CAR-T cells, engineered with these switch receptors differentially regulate important surface markers and secreted factors in response to stimulation and show increased cancer cell line killing in vitro.
Alternative IL23-IL12sR (sR: Switch Receptor) formats are indicated in Figure 1C. IL23 is bound by the IL23R_ECD1 domain. All chimeric IL23R-IL12Rb1 switch receptors contain the IL23R_ECD1 and C- terminal IL23R ECDs were replaced by the corresponding number of IL12Rb2 ECDs resulting in different chimeric IL23R-IL12Rb2 designs.
An overview of expression cassettes of IL23-IL12sR formats in a screening plasmid combined with a downstream GFP reporter is shown in Figure 1D. Constructs (1) and (2) correspond to SEQ ID Nos: and 37, respectively.
An overview of expression cassettes of I L23-IL12sR formats as downstream gene element of different CAR constructs including variants with chimeric ECDs is indicated in Figure 1E. Constructs (3), (4), (5), (6) and (8) correspond to SEQ ID Nos: 38, 39, 40, 41 and 42, respectively.
The mechanism of action of an immune cell engineered with IL23-IL12sRs is shown in Figure 1F. IL23 is released by cells near engineered immune cells, e.g., in the tumour microenvironment. IL23 is recognized by chimeric IL23-IL12sR and the endogenous IL12Rb1 leading to formation of the chimeric IL23-IL12sR complex and phosphorylation of STAT4. STAT4 signalling leads to the upregulation of IL18Ra, IL12Rb2, CD25 and secretion of IFNy. These effects combined can lead to improved killing of target cells in vitro by IL23-IL12sR engineered immune cells.
In the following detailed description, the illustrative alternatives described in the detailed description and claims are not meant to be limiting. Other alternatives may be used and other changes may be made without departing from the spirit or scope of the subject matter presented here. It will be readily understood that the aspects, as generally described herein, can be arranged, substituted, combined, and designed in a wide variety of different configurations, all of which are explicitly contemplated and make part of this application.
P38561-W0 Definitions The singular form “a”, “an”, and “the ” include plural references unless the context clearly dictates otherwise. For example, the term “a cell” includes one or more cells, including mixtures thereof. “A and/or B” is used herein to include all of the following alternatives: “A”, “B”, “A or B”, and “A and B.” The terms “administration” and “administering”, as used herein, refer to the delivery of a composition or formulation as disclosed herein by an administration route including, but not limited to, intravenous, intra- arterial, intracranial, intramuscular, intraperitoneal, subcutaneous, intramuscular, or combinations thereof. The term includes, but is not limited to, administration by a medical professional and self-administration.
“Cancer” refers to the presence of cells possessing several characteristics typical of cancer-causing cells, such as uncontrolled proliferation, immortality, metastatic potential, rapid growth and proliferation rate, and certain characteristic morphological features. Cancer cells can aggregate into a mass, such as a tumour, or can exist alone within a subject. A tumour can be a solid tumour, a soft tissue tumour, or a metastatic lesion. As used herein, the term “cancer” also encompasses other types of non-tumour cancers. Non- limiting examples include blood cancers or hematological cancers, such as leukemia. Cancer can include premalignant, as well as malignant cancers.
The terms “cell”, “cell culture”, and “cell line” refer not only to the particular subject cell or cell line but also to the progeny or potential progeny of such a cell, cell culture, or cell line, without regard to the number of transfers or passages in culture. It should be understood that not all progeny are exactly identical to the parental cell. This is because certain modifications may occur in succeeding generations due to either mutations (e.g., deliberate or inadvertent mutations) or environmental influences (e.g., methylation or other epigenetic modifications), such that progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein, so long as the progeny retain the same functionality as that of the original cell, cell culture, or cell line.
The term “percent identity”, as used herein in the context of two or more nucleic acids or proteins, refers to two or more sequences or sub-sequences that are the same or have a specified percentage of nucleotides or amino acids that are the same (e.g., about 80% sequence identity, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection. See e.g., the NCBI web site at ncbi.nlm.nih.gov/BLAST . Such sequences are then said to be “substantially identical.” This definition also refers to, or may be applied to, the complement of a sequence. This definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. Sequence identity can be calculated over a region that is at least about 20 amino acids or nucleotides in length, or over a region that is 10-100 amino acids or nucleotides in length, or over the entire length of a given sequence. Sequence identity can be calculated using published techniques and widely available computer programs, such as the GCS program package (Devereux et al, Nucleic Acids Res. 12:387, 1984), BLASTP, BLASTN, FASTA (Atschul et al., J Mol Biol 215:403, 1990).
P38561-W0 Sequence identity can be measured using sequence analysis software such as the Sequence Analysis Software Package of the Genetics Computer Group at the University of Wisconsin Biotechnology Center (1710 University Avenue, Madison, Wis. 53705), with the default parameters thereof.
As used herein, a “subject” or an “individual” includes animals, such as human (e.g., human subject) and non-human animals. In some embodiments, a “subject” or “individual” is a patient under the care of a physician. Thus, the subject can be a human patient or a subject who has, is at risk of having, or is suspected of having a disease of interest (e.g., cancer) and/or one or more symptoms of the disease. The subject can also be a subject who is diagnosed with a risk of the condition of interest at the time of diagnosis or later. The term “non-human animals” includes all vertebrates, e.g., mammals, e.g., rodents, e.g., mice, non-human primates, and other mammals, such as e.g., sheep, dogs, cows, chickens, and non-mammals, such as amphibians, reptiles, etc.
Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.
All ranges disclosed herein also encompass any and all possible sub-ranges and combinations of sub- ranges thereof. Any listed range can be recognized as sufficiently describing and enabling the same range being broken down into at least equal halves, thirds, quarters, fifths, tenths, etc. As a non-limiting example, each range discussed herein can be readily broken down into a lower third, middle third and upper third, and so forth. As will also be understood by one skilled in the art all language such as “up to”, “at least”, “greater than ”, “less than ”, and the like include the number recited and refer to ranges which can be subsequently broken down into sub-ranges as discussed above. Finally, as will be understood by one skilled in the art, a range includes each individual member. Thus, for example, a group having 1-3 articles refers to groups having 1,2, or 3 articles. Similarly, a group having 1-5 articles refers to groups having 1, 2, 3, 4, or 5 articles, and so forth.
It is appreciated that certain features of the disclosure, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the disclosure, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. All combinations of the embodiments pertaining to the disclosure are specifically embraced by the present disclosure and are disclosed herein just as if each and every combination was individually and explicitly disclosed. In addition, all sub-combinations of the various embodiments and elements thereof are also specifically embraced by the present disclosure and are disclosed herein just as if each and every such sub-combination was individually and explicitly disclosed herein.
P38561-W0 Chimeric receptor polypeptides The present disclosure is based, inter alia, on chimeric receptor polypeptides (a.k.a. chimeric receptors or switch receptors) which comprise an extracellular portion comprising an IL23-binding domain, an intracellular portion comprising the intracellular domains of IL12Rb2, and a transmembrane domain that joins the extracellular portion and the intracellular portion. Immune cells expressing these chimeric receptors may be useful in the context of modulating immune cell activity. In some embodiments, the ligand can be added exogenously and not be limited to production within the cell.
The present disclosure also relates to nucleic acid molecules encoding the chimeric cytokine receptors of the present invention, vectors, cells, pharmaceutical compositions, and uses and methods, as described herein, e.g. in the claims.
Antigen-binding moieties In some embodiments, the cell expressing the chimeric receptor polypeptide of the invention also expresses an antigen binding receptor comprising an anchoring transmembrane domain and an extracellular domain.
As used herein, an ‘antigen-binding moiety’ refers to a moiety that binds to a given target antigen.
Antigen-binding moieties include antibodies (/.e. immunoglobulins (lgs)), and antigen-binding fragments and derivatives thereof. In some embodiments, an antigen-binding moiety according to the present disclosure comprises, or consists of, a monoclonal antibody, a monospecific antibody, a multispecific (e.g., bispecific, trispecific, etc.) antibody, a variable fragment (Fv) moiety, a single-chain Fv (scFv) moiety, a fragment antigen-binding (Fab) moiety, a single-chain Fab moiety (scFab), a crossFab moiety, a Fab’ moiety, a Fab’-SH moiety, a F(ab’)2 moiety, a diabody moiety, a triabody moiety, an scFv-Fc moiety, a minibody moiety, a heavy chain only antibody (HCAb) moiety, or a single domain antibody (dAb, VHH) moiety.
Antigen-binding moieties according to the present disclosure also include further target antigen-binding peptides/polypeptides such as peptide aptamers, thioredoxins, anticalins, Kunitz domains, avimers, knottins, fynomers, atrimers, DARPins, affibodys, affilins, armadillo repeat proteins (ArmRPs), OBodys and adnectins (reviewed e.g. in Reverdatto et al., Curr Top Med Chem. 2015; 15(12): 1082-1101, which is hereby incorporated by reference in its entirety (see also e.g. Boersma et al., J Biol Chem (2011) 286:41273-85 and Emanuel et al., Mabs (2011) 3:38-48)). Antigen-binding moieties according to the present disclosure also include target antigen-binding nucleic acids, e.g. nucleic acid aptamers (reviewed, for example, in Zhou and Rossi Nat Rev Drug Discov. 2017 16(3):181-202). Antigen-binding moieties according to the present disclosure also include target antigen-binding small molecules (e.g. low molecular weight (< 1000 daltons, typically between -300-700 daltons) organic compounds).
P38561-W0 In some embodiments, the antigen-binding moieties are capable of binding to a variant Fc domain, e.g. as disclosed in WO2022029051A1, the contents of which is incorporated herein by reference in its entirety. The antigen-binding moieties described herein preferably display specific binding to a variant Fc domain e.g. as disclosed in WO2022029051A1. As used herein, ‘specific binding’ refers to binding which is selective for the target antigen, and which can be discriminated from non-specific binding to non-target antigen. An antigen-binding moiety that specifically binds to a given target antigen preferably binds the target antigen with greater affinity, and/or with greater duration than it binds to other, non-target antigens.
The ability of a given moiety to bind specifically to a given target antigen can be determined by analysis according to methods known in the art, such as by ELISA, Surface Plasmon Resonance (SPR; see e.g. Hearty et al., Methods Mol Biol (2012) 907:411-442), Bio-Layer Interferometry (BLI; see e.g. Lad etal., (2015) J Biomol Screen 20(4): 498-507), flow cytometry, or by a radiolabeled antigen-binding assay (RIA) enzyme-linked immunosorbent assay. Through such analysis binding to a given target antigen can be measured and quantified. In some embodiments, the level of binding may be the response detected in a given assay.
An antigen-binding moiety that ‘does not bind’ or that ‘displays substantially no binding’ to a given antigen displays a level of binding to the given antigen which is similar to the level of binding to an antigen that the antigen-binding moiety is known not to bind, or known to not to bind specifically, e.g. a non-target antigen. In some embodiments, the level of binding of an antigen-binding moiety that does not bind, or that displays substantially no binding, to a given antigen is > 0.5 times and < 2 times, e.g. one of > 0.75 times and < 1.times, > 0.8 times and < 1.4 times, > 0.85 times and < 1.3 times, > 0.9 times and < 1.2 times, > 0.95 times and < 1.1 times the level of binding displayed by the antigen-binding moiety to an antigen that the antigen- binding moiety is known not to bind, or known to not to bind specifically, e.g. a non-target antigen.
Linkers The polypeptides of the present disclosure (e.g. chimeric receptor polypeptides) may additionally comprise further amino acids or sequences of amino acids.
The polypeptides may comprise one or more linker sequences between sequences of amino acids. Byway of example, a linker sequence may be provided between different domains of a chimeric receptor polypeptide (e.g. the extracellular portion and the transmembrane domain, or between the transmembrane domain and the intracellular portion).
Linker sequences are known to the skilled person, and are described, for example in Chen etal., Adv Drug Deliv Rev (2013) 65(10): 1357-1369, which is hereby incorporated by reference in its entirety. In some embodiments, a linker sequence may be a flexible linker sequence. Flexible linker sequences allow for relative movement of the amino acid sequences which are linked by the linker sequence. Flexible linkers are known to the skilled person, and several are identified in Chen etal., Adv Drug Deliv Rev (2013) 65(10): 1357-1369. Flexible linker sequences often comprise high proportions of glycine and/or serine residues.
P38561-W0 In some embodiments, a linker sequence comprises at least one glycine residue and/or at least one serine residue. In some embodiments, the linker sequence comprises or consists of glycine and serine residues. In some embodiments, the linker sequence has the structure: (GxS)n or (GxS)nGm; wherein G = glycine, S = serine, x = 3 or 4, n = 2, 3, 4, 5 or 6, and m = 0, 1,2 or 3. In some embodiments, the linker sequence comprises one or more (e.g. 1,2, 3, 4, 5 or 6) copies (e.g. in tandem) of the sequence motif G4S. In some embodiments, a linker sequence comprises or consists of (G4S)3 or (G4S)4. In some embodiments, the linker sequence has a length of 1-2, 1-3, 1-4, 1-5, 1-10, 1-15, 1-20, 1-25, or 1-30 amino acids. In some embodiments, the linker sequence is one or more repetitions of GGSG.
In some embodiments, the linker sequence comprises one or more copies of an amino acid sequence according to SEQ ID NO:92. In some embodiments, the linker sequence comprises at least 1, 2, 3 or copies of an amino acid sequence according to SEQ ID NO:20.
In some embodiments, the linker sequence comprises, or consists of, an amino acid sequence having at least 60%, preferably one of >70%, >75%, >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99% or 100% amino acid sequence identity to SEQ ID NO:18.
In some embodiments, the linker sequence comprises a cleavage site, e.g. a cleavage site as described hereinbelow.
The polypeptides of the present disclosure may comprise amino acid sequence(s) to facilitate expression, folding, trafficking, processing, purification or detection thereof. For example, chimeric receptor polypeptides of the present disclosure may additionally comprise a sequence of amino acids forming a detectable moiety, e.g. as described hereinbelow.
The polypeptides may additionally comprise a signal peptide (also known as a leader sequence or signal sequence). Signal peptides normally consist of a sequence of 5-30 hydrophobic amino acids, which form a single alpha helix. Secreted proteins and proteins expressed at the cell surface often comprise signal peptides. Signal peptides are known for many proteins, and are recorded in databases such as GenBank, UniProt and Ensembl, and/or can be identified/predicted e.g. using amino acid sequence analysis tools such as SignalP (Petersen et al., 2011 Nature Methods 8: 785-786) or Signal-BLAST (Frank and Sippl, 2008 Bioinformatics 24: 2172-2176).
The signal peptide may be present at the N-terminus of the chimeric receptor polypeptide, and may be present in the newly-synthesised polypeptide. The signal peptide provides for efficient trafficking of the chimeric receptor polypeptide. Signal peptides are often removed by cleavage, and thus are not comprised in the mature chimeric receptor polypeptide.
Signal peptides are known for many proteins, and are recorded in databases such as GenBank, UniProt, Swiss-Prot, TrEMBL, Protein Information Resource, Protein Data Bank, Ensembl, and InterPro, and/or can P38561-W0 be identified/predicted e.g. using amino acid sequence analysis tools such as SignalP (Petersen et al., 2011 Nature Methods 8: 785-786) or Signal-BLAST (Frank and Sippl, 2008 Bioinformatics 24: 2172-2176).
In some embodiments, the signal peptide comprises, or consists of, an amino acid sequence having at least 60%, preferably one of >70%, >75%, >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99% or 100% amino acid sequence identity to SEQ ID NO:1 or SEQ ID NO:16.
In some embodiments, chimeric receptor polypeptides of the present disclosure comprise a detectable moiety, a.k.a. a marker. In some embodiments, a detectable moiety is provided at the N-terminus and/or C-terminus of the polypeptide.
In some embodiments, a detectable moiety is a fluorescent label, phosphorescent label, luminescent label, immuno-detectable label (e.g. an epitope tag), radiolabel, chemical, nucleic acid or enzymatic label. The chimeric receptor polypeptides may be covalently or non-covalently labelled with the detectable moiety.
Fluorescent labels include e.g. fluorescein, rhodamine, allophycocyanin, eosine and NDB, green fluorescent protein (GFP), enhanced GFP (eGFP), chelates of rare earths such as europium (Eu), terbium (Tb) and samarium (Sm), tetramethyl rhodamine, Texas Red, 4-methyl umbelliferone, 7-amino-4-methyl coumarin, Cy3, and Cy5. Radiolabels include radioisotopes such as Hydrogen3, Sulfur35, Carbon14, Phosphorus 32, Iodine123, Iodine125, Iodine126, Iodine131, Iodine133, Bromine77, Technetium 99m, Indium111, lndium113m, Gallium67, Gallium68, Ruthenium 95, Ruthenium 97, Ruthenium 103, Ruthenium 105, Mercury207, Mercury203, Rhenium 99m, Rhenium 101, Rhenium 105, Scandium47, Tellurium121m, Tellurium122m, Tellurium125m, Thulium 165, Thuliuml 167, Thulium 168, Copper67, Fluorine18, Yttrium90, Palladium100, Bismuth 217 and Antimony211. Luminescent labels include as radioluminescent, chemiluminescent (e.g. acridinium ester, luminol, isoluminol) and bioluminescent labels. Immuno-detectable labels include haptens, peptides/polypeptides, antibodies, receptors and ligands such as biotin, avidin, streptavidin or digoxigenin. Nucleic acid labels include aptamers.
In some embodiments, the chimeric receptor polypeptide comprises an epitope tag, e.g. a His, (e.g. 6XHis), FLAG, c-Myc, StrepTag, haemagglutinin, E, calmodulin-binding protein (CBP), glutathione-s-transferase (GST), maltose-binding protein (MBP), thioredoxin, S-peptide, T7 peptide, SH2 domain, avidin, streptavidin, and haptens (e.g. biotin, digoxigenin, dinitrophenol), optionally at the N- or C- terminus of the chimeric receptor polypeptide.
In some embodiments, the chimeric receptor polypeptide comprises a moiety having a detectable activity, e.g. an enzymatic moiety. Enzymatic moieties include e.g. luciferases, glucose oxidases, galactosidases (e.g. beta-galactosidase), glucorinidases, phosphatases (e.g. alkaline phosphatase), peroxidases (e.g. horseradish peroxidase) and cholinesterases.
In some embodiments, a polypeptide of the present disclosure comprises a fluorescent label. In some embodiments, the polypeptide comprises an eGFP moiety. In some embodiments, the polypeptide P38561-W0 comprises an amino acid sequence having at least 60%, preferably one of >70%, >75%, >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99% or 100% amino acid sequence identity toSEQ ID NO:7.
Chimeric receptor polypeptides of the present disclosure may also comprise one or more cleavage sites. A cleavage site refers to a sequence of amino acids that acts as a substrate for an enzyme capable of cleaving peptide bonds.
Many such cleavage sites are known to, and can be employed by, the person skilled in the art of molecular biology. In some embodiments, the cleavage sequence comprises an autocleavage site. Autocleavage sites include the 2A cleavage sequence from Picomavirus ‘NPGP‘, which is cleaved at ’G/P’. Further autocleavage sites are described e.g. in Kim etal., PLoS ONE (2011) 6: 618556 (hereby incorporated by reference in its entirety), and include e.g. T2A, P2A, E2A and F2A cleavage sites. The amino acid sequences of T2A and E2A cleavage sites are shown in SEQ ID NOs: 6 and 9, respectively.
A cleavage site may be included in a polypeptide according to the present disclosure to provide for removal of a moiety or domain. It might be desirable to remove a given moiety or domain so that it is not comprised in the polypeptide complex formed by the polypeptide. For example, in embodiments of chimeric receptor polypeptides of the present disclosure, a cleavage site (specifically, a T2A cleavage site) is provided upstream of an eGFP moiety, to provide for its removal such that the eGFP moiety is not included in the final chimeric receptor polypeptide. Accordingly, in some embodiments, a chimeric receptor polypeptides according to the present disclosure comprises a cleavage site adjacent to (/.e. in the amino acid sequence of the polypeptide, e.g. immediately upstream or downstream of) a detectable moiety according to the present disclosure.
In some embodiments, a cleavage site according to the present disclosure is a 2A cleavage site, e.g. selected from a T2A, P2A, E2A and F2A cleavage site. In some embodiments, the cleavage site is a T2A cleavage site.
Particular exemplary chimeric receptor polypeptides In some embodiments, a chimeric receptor polypeptide according to the present disclosure comprises or consists of one of the following structures: Optional signal peptide - optional tag - optional linker - IL23-binding domain -transmembrane domain - intracellular portion comprising the intracellular domains of IL12Rb2 - optional linker - optional marker Schematic representation of some of the chimeric receptor polypeptides of the present invention are provided in Figures 1B,C,D,E.
P38561-W0 In some embodiments, a chimeric receptor polypeptide according to the present disclosure comprises an amino acid sequence having at least 60%, preferably one of >70%, >75%, >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99% or 100% amino acid sequence identity to SEQ ID NO:36, 37, 62, 63, 64, 65, 66, 38, 39, 40, 41,42, 43 or 44.
Nucleic acids and vectors The present disclosure provides a nucleic acid, or a plurality of nucleic acids, encoding a chimeric receptor polypeptide according to the present disclosure. In some embodiments, the nucleic acid(s) comprise or consist of DNA and/or RNA.
A chimeric receptor polypeptide according to the present disclosure may be produced within a cell by translation of RNA encoding chimeric receptor polypeptide. A chimeric receptor polypeptide according to the present disclosure may be produced within a cell by transcription from nucleic acid encoding the chimeric receptor polypeptide, and subsequent translation of the transcribed RNA.
In some embodiments, the nucleic acid(s) may be, or may be comprised/contained in, a vector, or a plurality of vectors. A ‘vector’ as used herein is a nucleic acid molecule used as a vehicle to transfer exogenous nucleic acid into a cell.
Accordingly, the present disclosure also provides a vector, or plurality of vectors, comprising the nucleic acid or plurality of nucleic acids according to the present disclosure. The vector may facilitate delivery of the nucleic acid(s) encoding a chimeric receptor polypeptide according to the present disclosure to a cell. The vector may be an expression vector comprising elements required for expressing a chimeric receptor polypeptide, optionally together with or linked with a CAR molecule. The vector may comprise elements facilitating integration of the nucleic acid(s) into the genomic DNA of cell into which the vector is introduced.
Nucleic acids and vectors according to the present disclosure may be provided in purified or isolated form, i.e. from other nucleic acid, or naturally-occurring biological material.
A vector may be a vector for expression of the nucleic acid in the cell (/.e. an expression vector). Such vectors may include a promoter sequence operably linked to a nucleotide sequence encoding a chimeric receptor polypeptide according to the present disclosure. A vector may also include a termination codon (/.e. 3’ in the nucleotide sequence of the vector to the nucleotide sequence encoding the chimeric receptor polypeptide and expression enhancers. Any suitable vectors, promoters, enhancers and termination codons known in the art may be used to express a peptide or polypeptide from a vector according to the present disclosure.
The term ‘operably linked’ may include the situation where nucleic acid encoding a chimeric receptor polypeptide according to the present disclosure and regulatory nucleic acid sequence(s) (e.g. a promoter and/or enhancers) are covalently linked in such a way as to place the expression of the nucleic acid encoding a chimeric receptor polypeptide under the influence or control of the regulatory nucleic acid P38561-W0 sequence(s) (thereby forming an expression cassette). Thus, a regulatory sequence is operably linked to the selected nucleic acid sequence if the regulatory sequence is capable of effecting transcription of the nucleic acid sequence. The resulting transcript(s) may then be translated into the desired polypeptide(s).
Vectors contemplated in connection with the present disclosure include DNA vectors, RNA vectors, plasmids (e.g. conjugative plasmids (e.g. F plasmids), non-conjugative plasmids, R plasmids, col plasmids, episomes), viral vectors (e.g. retroviral vectors, e.g. gammaretroviral vectors (e.g. murine Leukemia virus (MLV)-derived vectors, e.g. SFG vector), lentiviral vectors, adenovirus vectors, adeno-associated virus vectors, vaccinia virus vectors and herpesvirus vectors), transposon-based vectors, and artificial chromosomes (e.g. yeast artificial chromosomes), e.g. as described in Maus et al., Annu Rev Immunol (2014) 32:189-225 and Morgan and Boyerinas, Biomedicines (2016) 4:9, which are both hereby incorporated by reference in their entirety. In some embodiments, a vector according to the present disclosure is a lentiviral vector.
In some embodiments, the vector may be a eukaryotic vector, i.e. a vector comprising the elements necessary for expression of protein from the vector in a eukaryotic cell. In some embodiments, the vector may be a mammalian vector, e.g. comprising a cytomegalovirus (CMV) or SV40 promoter to drive protein expression.
In some embodiments, a nucleic acid/plurality or vector/plurality according to the present disclosure comprises an EF1a promoter.
In some embodiments, a nucleic acid/plurality or vector/plurality according to the present disclosure encodes a chimeric receptor polypeptide comprising or consisting of an amino acid sequence having at least 70%, preferably one of >80%, >85%, >90%, >91%, >92%, >93%, >94%, >95%, >96%, >97%, >98%, >99% or 100% amino acid sequence identity to one of SEQ ID NOs: 36, 37, 62, 63, 64, 65, 66, 38, 39, 40, 41,42,43 or 44.
Constituent polypeptides of a chimeric receptor polypeptide according to the present disclosure may be encoded by different nucleic acids of a plurality of nucleic acids according to the present disclosure, or by different vectors of a plurality of nucleic acids according to the present disclosure.
In aspects and embodiments of the present disclosure, a nucleic acid, or a plurality of nucleic acids, according to the present disclosure encodes two or more (e.g. 2, 3, 4 or more) chimeric receptor polypeptides according to the present disclosure.
In some embodiments, wherein a nucleic acid/plurality or vector/plurality encodes two or more (e.g. 2, 3, or more) chimeric receptor polypeptide according to the present disclosure, transcription of nucleic acid encoding the two or more chimeric receptor polypeptides is under the control of the same promoter.
P38561-W0 In some embodiments, transcription of nucleic acid encoding the two or more chimeric receptor polypeptides is under the control of different promoters.
In some embodiments, the nucleic acid/plurality or vector/plurality is multicistronic (e.g. bicistronic, tricistronic, etc.). That is, in some embodiments the nucleic acid/plurality or vector/plurality vector comprises multiple polypeptide-encoding nucleotide sequences. In some embodiments, nucleic acid encoding two or chimeric receptor polypeptides is provided in different cistrons.
Cells comprising/expressing the chimeric receptor polypeptides of the disclosure The present disclosure also provides a cell comprising a r chimeric receptor polypeptide according to the present disclosure, or a nucleic acid/plurality or vector/plurality according to the present disclosure.
It will be appreciated that where cells are referred to herein in the singular (/.e. ‘a/the cell’), pluralities/populations of such cells are also contemplated.
The cell may be a eukaryotic cell, e.g. a mammalian cell. The mammal may be a primate (rhesus, cynomolgous, non-human primate or human) or a non-human mammal (e.g. rabbit, guinea pig, rat, mouse or other rodent (including any animal in the order Rodentia), cat, dog, pig, sheep, goat, cattle (including cows, e.g. dairy cows, or any animal in the order Bos), horse (including any animal in the order Equidae), donkey, and non-human primate). In preferred embodiments, the cell is a human cell.
In some embodiments, the cell is an immune cell. An immune cell may be a cell of hematopoietic origin, e.g. a neutrophil, eosinophil, basophil, dendritic cell, lymphocyte, or monocyte. A lymphocyte may be e.g. a T cell, B cell, NK cell, NKT cell or innate lymphoid cell (ILC), or a precursor thereof. The immune cell may express CD27, CD28, CD4 and/or CDS. In some embodiments, the immune cell is a T cell, e.g. a CD3+ T cell. In some embodiments, the T cell is a CD3+, CD4+ T cell. In some embodiments, the T cell is a CD3+, CD8+ T cell. In some embodiments, the T cell is a T helper cell (Th cell). In some embodiments, the T cell is a cytotoxic T cell (e.g. a cytotoxic T lymphocyte (CTL)). In some embodiments, the immune cell is a tumor infiltrating lymphocyte (TIL), B cell, a monocyte, a natural killer (NK) cell, a basophil, an eosinophil, a neutrophil, a dendritic cell, a macrophage, a regulatory T cell (Treg), a helper T cell (Th), a cytotoxic T cell (Tctl), an effector T cell, a memory T cell, a Natural Killer T (NKT) cell, or other T cell.
Aspects and embodiments of the present disclosure relate particularly to T cells comprising/expressing chimeric receptor polypeptides according to the present disclosure.
In some aspects and embodiments, a cell according to the present disclosure expresses/presents a chimeric receptor polypeptide according to the present disclosure at the cell surface. That is, the chimeric receptor polypeptide may be present in or at the cell membrane. Cells can be evaluated for surface expression of chimeric receptor polypeptide, e.g. using antibody-based methods such as flow cytometry (e.g. as described in Examples of the present disclosure).
P38561-W0 In aspects and embodiments of the present disclosure, a cell according to the present disclosure comprises or expresses a chimeric receptor polypeptide according to the present disclosure. In some aspects and embodiments, a cell according to the present disclosure comprises nucleic acid encoding a chimeric receptor polypeptide according to the present disclosure. In some aspects and embodiments, a cell according to the present disclosure comprises a nucleic acid/plurality or vector/plurality according to the present disclosure.
In aspects and embodiments of the present disclosure, a cell according to the present disclosure comprises or expresses a polypeptide complex according to the present disclosure that binds to a variant Fc domain as described herein.
Dose-dependent IL12 signalling mediated by exposure of the cells of the invention to IL23 can be investigated as described in the Examples herein, e.g. by detecting, qualifying and analysing the downstream molecules in the pathway, such as STAT4 and their phosphorylation status or level.The level of chimeric receptor polypeptide -mediated signalling can also be analysed using reporter-based methods, e.g. methods quantifying the activity of a transcription factor or gene whose expression/activity is upregulated in response to signalling through IL12.
As used herein, ‘expression’ may be gene or protein expression. Gene expression encompasses transcription of DNA to RNA, and can be measured by various means known to those skilled in the art, for example by measuring levels of mRNA by quantitative real-time FOR (qRT-PCR), or using reporter-based methods. Similarly, protein expression can be measured by various methods well known in the art, e.g. antibody-based methods, for example by western blot, immunohistochemistry, immunocytochemistry, flow cytometry, ELISA, ELISPOT, or reporter-based methods.
An immune cell (e.g. a T cell) according to the present disclosure may display cytotoxicity to cells comprising/expressing a variant Fc domain according to the present disclosure. That is, an immune cell (e.g. a T cell) according to the present disclosure may posses the ability to kill cells comprising/expressing a variant Fc domain according to the present disclosure.
Cytotoxicity and cell killing can be investigated, for example, using any of the methods reviewed in Zaritskaya et al., Expert Rev Vaccines (2011), 9(6):601-616, hereby incorporated by reference in its entirety. Examples of in vitro assays of cytotoxicity/cell killing assays include release assays such as the 51Cr release assay, the lactate dehydrogenase (LDH) release assay, the 3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyl tetrazolium bromide (MTT) release assay, and the calcein-acetoxymethyl (calcein-AM) release assay. These assays measure cell killing based on the detection of factors released from lysed cells. Cell killing by a given test cell type (e.g. an immune cell (e.g. a T cell) according to the present disclosure) can be analysed e.g. by co-culturing the test cells with the given target cell type (e.g. a cell comprising a variant Fc domain according to the present disclosure), and measuring the number/proportion of viable (i.e. non- lysed) /dead (e.g. lysed) target cells after a suitable period of time. Other suitable assays include the xCELLigence real-time cytolytic in vitro potency assay described in Cerignoli etal., PLoS One. (2018) 13(3): P38561-W0 60193498 (hereby incorporated by reference in its entirety), and the Incucyte immune cell killing assay, which is employed in the experimental examples of the present disclosure.
The present disclosure also provides methods for producing a cell according to the present disclosure, and the cells obtained or obtainable by such methods.
Methods for producing cells comprising/expressing a polypeptide/polypeptide complex of interest are well known to the skilled person, and generally comprise introducing nucleic acid(s)/vector(s) encoding the polypeptide(s) of interest into the cells.
Such methods may comprise nucleic acid transfer for permanent (/.e. stable) or transient expression of the transferred nucleic acid. In some embodiments, following introduction into a cell nucleic acid(s) encoding the polypeptide(s) of interest may be integrated into or form part of the genomic DNA of the cell. In some embodiments, following introduction into a cell nucleic acid(s) encoding the polypeptide(s) of interest may be maintained extrachromosomally.
Any suitable genetic engineering platform may be used, and include gammaretroviral vectors, lentiviral vectors, adenovirus vectors, DNA transfection, transposon-based gene delivery and RNA transfection, for example as described in Maus et al., Annu Rev Immunol (2014) 32:189-225, hereby incorporated by reference in its entirety. Methods also include those described e.g. in Wang and Riviere Mol Ther Oncolytics. (2016) 3:16015, which is hereby incorporated by reference in its entirety. Suitable methods for introducing nucleic acid(s)/vector(s) into cells include transduction, transfection and electroporation.
Methods for generating/expanding populations of cells comprising/expressing polypeptide(s) of interest in vitro/ex vivo are well known to the skilled person. Suitable culture conditions (/.e. cell culture media, additives, stimulations, temperature, gaseous atmosphere), cell numbers, culture periods and methods for introducing nucleic acid(s)/vector(s) encoding polypeptide(s) of interest into cells, etc. can be determined by reference e.g. to WO 2018/177966 A1. In some embodiments, a cell/population of cells according to the present disclosure is prepared under GMP (good manufacturing practice; e.g. as described in the guidelines for good manufacturing practice published by the European Commission (Volume 4 of ‘The rules governing medicinal products in the European Union’ contains guidance for the interpretation of the principles and guidelines of good manufacturing practices for medicinal products for human and veterinary use laid down in Commission Directives 91/356/EEC, as amended by Directive 2003/94/EC, and 91/412/EEC respectively) conditions.
Conveniently, cultures of cells according to the present disclosure may be maintained at 37°C in a humidified atmosphere containing 5% CO2. The cells of cell cultures can be established and/or maintained at any suitable density, as can readily be determined by the skilled person. Cultures can be performed in any vessel suitable for the volume of the culture, e.g. in wells of a cell culture plate, cell culture flasks, a bioreactor, etc. In some embodiments cells are cultured in a bioreactor, e.g. a bioreactor described in Somerville and Dudley, Oncoimmunology (2012) 1(8):1435-1437, which is hereby incorporated by P38561-W0 reference in its entirety. Immune cells (e.g. T cells) may be activated prior to introduction of nucleic acid(s) encoding the polypeptide(s) of interest. For example, T cells within a population of PBMCs may be non- specifically activated by stimulation in vitro with agonist anti-CD3 and agonist anti-CD28 antibodies, in the presence of IL-2.
Introducing nucleic acid(s) into a cell may comprise transduction, e.g. lentiviral transduction. Transduction of immune cells with viral vectors is described e.g. in Simmons and Alberola-lla, Methods Mol Biol. (2016) 1323:99-108, which is hereby incorporated by reference in its entirety.
Agents may be employed to enhance the efficiency of transduction. Hexadimethrine bromide (polybrene) is a cationic polymer which is commonly used to improve transduction, through neutralising charge repulsion between virions and sialic acid residues expressed on the cell surface. Other agents commonly used to enhance transduction include e.g. the poloxamer-based agents such as LentiBOOST (Sirion Biotech), Retronectin (Takara), Vectofusin (Miltenyi Biotech) and also SureENTRY (Qiagen) and ViraDuctin (Cell Biolabs). In some embodiments the methods comprise centrifuging the cells into which it is desired to introduce nucleic acid encoding the polypeptide(s) of interest in the presence of cell culture medium comprising viral vector comprising the nucleic acid (referred to in the art as ‘spinfection‘).
The methods generally comprise introducing a nucleic acid encoding polypeptide(s) of interest into a cell, and culturing the cell under conditions suitable for expression of the polypeptide(s) of interest by the cell. In some embodiments, the methods comprise culturing immune cells into which nucleic acid encoding polypeptide(s) of interest has been introduced in order to expand their number.
In some embodiments, the methods comprise analysing the cells to confirm successful introduction of the nucleic acid into the cells. In some embodiments, the methods comprise analysing the cells to confirm expression of the polypeptide(s) of interest by the cells (e.g. via evaluation of a detectable entity).
In some embodiments the methods further comprise cells expressing the polypeptide(s) of interest, e.g. from other cells (e.g. cells which do not express the polypeptide(s) of interest). Methods for purifying/isolating immune cells from heterogeneous populations of cells are well known in the art, and may employ e.g. FACS- or MACS-based methods for sorting populations of cells based on the expression of markers of the immune cells. In some embodiments the methods purifying/isolating cells of a particular type, e.g. CD8+ T cells or CTLs expressing the polypeptide(s) of interest.
Modification of a given target nucleic acid can be achieved in a variety of ways known to the skilled person, including modification of the target nucleic acid by homologous recombination, and target nucleic acid editing using site-specific nucleases (SSNs).
Suitable methods may employ targeting by homologous recombination, which is reviewed, for example, in Mortensen Curr Protoc Neurosci. (2007) Chapter 4:Unit 4.29 and Vasquez etal., PNAS 2001,98(15): 8403- 8410 both of which are hereby incorporated by reference in their entirety. Targeting by homologous P38561-W0 recombination involves the exchange of nucleic acid sequence through crossover events guided by homologous sequences. Other suitable techniques include nucleic acid editing using SSNs. Gene editing using SSNs is reviewed e.g. in Eid and Mahfouz, Exp Mol Med. 2016 Oct; 48(10): 6265, which is hereby incorporated by reference in its entirety. Enzymes capable of creating site-specific double strand breaks (DSBs) can be engineered to introduce DSBs to target nucleic acid sequence(s) of interest. DSBs may be repaired by either error-prone non-homologous end-joining (NHEJ), in which the two ends of the break are rejoined, often with insertion or deletion of nucleotides. Alternatively, DSBs may be repaired by homology- directed repair (HDR), a high-fidelity mechanism in which a DNA template with ends homologous to the break site is supplied and introduced at the site of the DSB.
SSNs capable of being engineered to generate target nucleic acid sequence-specific DSBs include zinc- finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs) and clustered regularly interspaced palindromic repeats/CRISPR-associated-9 (CRISPR/Cas9) systems. ZFN systems are reviewed e.g. in Umov et al., Nat Rev Genet. (2010) 11(9):636-46, which is hereby incorporated by reference in its entirety. ZFNs comprise a programmable Zinc Finger DNA-binding domain and a DNA- cleaving domain (e.g. a Fok endonuclease domain). The DNA-binding domain may be identified by screening a Zinc Finger array capable of binding to the target nucleic acid sequence. TALEN systems are reviewed e.g. in Mahfouz et al., Plant Biotechnol J. (2014) 12(8):1006-14, which is hereby incorporated by reference in its entirety. TALENs comprise a programmable DNA-binding TALE domain and a DNA- cleaving domain (e.g. a Fok endonuclease domain). TALEs comprise repeat domains consisting of repeats of 33-39 amino acids, which are identical except for two residues at positions 12 and 13 of each repeat which are repeat variable di-residues (RVDs). Each RVD determines binding of the repeat to a nucleotide in the target DNA sequence according to the following relationship: ‘HD’ binds to C, ‘NT binds to A, ‘NG’ binds to T and ‘NN’ or NK‘ binds to G (Moscou and Bogdanove, Science (2009) 326(5959):1501.). CRISPR/Cas9 and related systems e.g. CRISPR/Cpf1, CRISPR/C2c1, CRISPR/C2c2 and CRISPR/C2care reviewed e.g. in Nakade etal., Bioengineered (2017) 8(3):265-273, which is hereby incorporated by reference in its entirety. These systems comprise an endonuclease (e.g. Cas9, Cpf1 etc.) and the single- guide RNA (sgRNA) molecule. The sgRNA can be engineered to target endonuclease activity to nucleic acid sequences of interest.
In some embodiments, modifying nucleic acid (e.g. endogenous nucleic acid) encoding the chimeric receptor polypeptide in accordance with the present disclosure employs a site-specific nuclease (SSN) system targeting nucleic acid encoding the chimeric receptor polypeptide. The SSN system may be a ZFN system, a TALEN system, CRISPR/Cas9 system, a CRISPR/Cpf1 system, a CRISPR/C2c1 system, a CRISPR/C2c2 system or a CRISPR/C2c3 system.
Compositions The present disclosure also provides compositions, e.g. pharmaceutical compositions, comprising the polypeptides, nucleic acids, expression vectors and cells described herein.
P38561-W0 The polypeptides, nucleic acids, expression vectors and cells described herein (and particularly the nucleic acids, expression vectors and cells described herein) may be formulated as pharmaceutical compositions or medicaments for clinical use and may comprise a pharmaceutically-acceptable carrier, diluent, excipient or adjuvant. In preferred aspects and embodiments, the present disclosure provides a pharmaceutical composition or medicament comprising a cell according to the present disclosure. Thus, the present disclosure also provides a pharmaceutical composition/medicament comprising a polypeptide, nucleic acid/plurality, expression vector/plurality or cell described herein. In preferred embodiments, a pharmaceutical composition/medicament according to the present disclosure comprises a nucleic acid/plurality, expression vector/plurality or cell described herein.
The pharmaceutical compositions/medicaments of the present disclosure may comprise one or more pharmaceutically-acceptable carriers (e.g. liposomes, micelles, microspheres, nanoparticles), diluents/excipients (e.g. starch, cellulose, a cellulose derivative, a polyol, dextrose, maltodextrin, magnesium stearate), adjuvants, fillers, buffers, preservatives (e.g. vitamin A, vitamin E, vitamin C, retinyl palmitate, selenium, cysteine, methionine, citric acid, sodium citrate, methyl paraben, propyl paraben), anti- oxidants (e.g. vitamin A, vitamin E, vitamin C, retinyl palmitate, selenium), lubricants (e.g. magnesium stearate, talc, silica, stearic acid, vegetable stearin), binders (e.g. sucrose, lactose, starch, cellulose, gelatin, polyethylene glycol (PEG), polyvinylpyrrolidone (PVP), xylitol, sorbitol, mannitol), stabilisers, solubilisers, surfactants (e.g., wetting agents), masking agents or colouring agents (e.g. titanium oxide).
The term ‘pharmaceutically-acceptable ’ as used herein pertains to compounds, ingredients, materials, compositions, dosage forms, etc., which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of the subject in question (e.g. a human subject) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio. Each carrier, diluent, excipient, adjuvant, filler, buffer, preservative, anti-oxidant, lubricant, binder, stabiliser, solubiliser, surfactant, masking agent, colouring agent, flavouring agent or sweetening agent of a composition according to the present disclosure must also be ‘acceptable’ in the sense of being compatible with the other ingredients of the formulation. Suitable carriers, diluents, excipients, adjuvants, fillers, buffers, preservatives, anti-oxidants, lubricants, binders, stabilisers, solubilisers, surfactants, masking agents, colouring agents, flavouring agents or sweetening agents can be found in standard pharmaceutical texts, for example, Remington’s ‘The Science and Practice of Pharmacy ’ (Ed. A. Adejare), 23rd Edition (2020), Academic Press.
Pharmaceutical compositions and medicaments of the present disclosure may be formulated for topical, parenteral, systemic, intracavitary, intravenous, intra-arterial, intramuscular, intrathecal, intraocular, intraconjunctival, intratumoral, subcutaneous, intradermal, intrathecal, oral or transdermal routes of administration. In some embodiments, a pharmaceutical composition/medicament may be formulated for administration by injection or infusion, or administration by ingestion.
Suitable formulations may comprise the cell provided in a sterile or isotonic medium. Medicaments and pharmaceutical compositions may be formulated in fluid, including gel, form. Fluid formulations may be P38561-W0 formulated for administration by injection or infusion (e.g. via catheter) to a selected region of the human or animal body.
In some embodiments, the pharmaceutical compositions/medicament is formulated for injection or infusion, e.g. into a blood vessel, tissue/organ of interest, or a tumour.
The present disclosure also provides methods for the production of pharmaceutically useful compositions, such methods of production may comprise one or more steps selected from:producing a cell described herein;isolating/purifying a cell described herein; and/or mixing a cell described herein with a pharmaceutically-acceptable carrier, adjuvant, excipient or diluent.
For example, a further aspect the present disclosure relates to a method of formulating or producing a medicament or pharmaceutical composition for use in the treatment of a disease/condition (e.g. a disease/condition described herein), the method comprising formulating a pharmaceutical composition or medicament by mixing a cell described herein with a pharmaceutically-acceptable carrier, adjuvant, excipient or diluent.
Therapeutic and prophylactic applications The articles of the present disclosure find use in therapeutic and prophylactic methods. In particular, a cell according to the present disclosure, e.g. a cell comprising/expressing a chimeric receptor polypeptide according to the present disclosure, finds use in therapeutic and prophylactic methods. Similarly, a composition according to the present disclosure, e.g. a pharmaceutical composition comprising a cell according to the present disclosure, e.g. a cell comprising/expressing a chimeric receptor polypeptide according to the present disclosure finds use in such methods.
Accordingly, the present disclosure provides a cell or composition described herein for use in a method of medical treatment or prophylaxis. Also provided is a cell or composition described herein for use in a method of treating or preventing a disease or condition described herein. Also provided is the use of a cell or composition described herein in the manufacture of a medicament for treating or preventing a disease or condition described herein. Also provided is a method of treating or preventing a disease or condition described herein, comprising administering to a subject a therapeutically- or prophylactically- effective amount of a cell or composition described herein.
The intervention described in the preceding paragraph may be effective to reduce the development or progression of a disease/condition, alleviate the symptoms of a disease/condition or reduce the pathology of a disease/condition. The intervention may be effective to prevent progression of the disease/condition, e.g. to prevent worsening of, or to slow the rate of development of, the disease/condition. In some embodiments, the intervention may lead to an improvement in the disease/condition, e.g. a reduction in the symptoms of the disease/condition or reduction in some other correlate of the severity/activity of the P38561-W0 disease/condition. In some embodiments, the intervention may prevent progression/development of the disease/condition a later stage (e.g. a chronic stage or metastasis).
Therapeutic or prophylactic intervention in accordance with the present disclosure generally comprises administering a cell or pharmaceutical composition according to the present disclosure to a subject to which an antigen-binding molecule comprising: (a) an antigen-binding domain that binds to the target antigen, and (b) a variant Fc domain according to the present disclosure, has been or is to be administered.
In particular, use of the cells and compositions according to the present disclosure in methods to treat/prevent diseases/conditions by adoptive cell transfer (ACT) is contemplated.
Adoptive cell transfer generally refers to a process by which cells (e.g. immune cells) are obtained from a subject, typically by drawing a blood sample from which the cells are isolated. The cells are then typically modified and/or expanded, and then administered either to the same subject (in the case of adoptive transfer of autologous/autogeneic cells) or to a different subject (in the case of adoptive transfer of allogeneic cells). The treatment is typically aimed at providing a population of cells with certain desired characteristics to a subject, or increasing the frequency of such cells with such characteristics in that subject. Adoptive transfer may be performed with the aim of introducing a cell or population of cells into a subject, and/or increasing the frequency of a cell or population of cells in a subject.
Adoptive transfer of immune cells is described, for example, in Kalos and June (2013), Immunity 39(1): 49- 60, and Davis et al. (2015), Cancer J. 21(6): 486-491, both of which are hereby incorporated by reference in their entirety. The skilled person is able to determine appropriate reagents and procedures for adoptive transfer of cells according to the present disclosure, for example by reference to Dai et al., 2016 J Nat Cancer Inst 108(7): djv439, which is incorporated by reference in its entirety.
The present disclosure provides methods comprising administering cells and compositions according to the present disclosure to a subject.
Administration of the articles of the present disclosure is preferably in a therapeutically-effective‘ or prophylactically-effective ‘ amount, this being sufficient to show therapeutic or prophylactic benefit to the subject. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of the disease/condition and the particular article administered. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disease/disorder to be treated, the condition of the individual subject, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington’s ‘The Science and Practice of Pharmacy ’ (ed. A. Adejare), 23rd Edition (2020), Academic Press.
Administration of the articles of the present disclosure may be parenteral, systemic, intravenous, intra- arterial, intramuscular, intracavitary, intrathecal, intraocular, intravitreal, intraconjunctival, subretinal, P38561-W0 suprachoroidal, subcutaneous, intradermal, intrathecal, oral, nasal, topical or transdermal. Administration may be by injection or infusion. Administration of the articles of the present disclosure may be intratumoral. In some cases, the articles of the present disclosure may be formulated for targeted delivery to specific cells, a tissue, an organ and/or a tumor.
Multiple doses of an article of the present disclosure may be provided. Multiple doses may be separated by a predetermined time interval, which may be selected to be one of 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,22, 23, 24, 25, 26, 27, 28, 29, 30, 0r31 days, or 1,2, 3, 4, 5, or 6 months.
Administration of a cell or composition according to the present disclosure with an antigen-binding molecule described herein to a subject in accordance with the therapeutic and prophylactic intervention described herein may be simultaneous or sequential.
Simultaneous administration refers to administration of (i) a cell or composition according to the present disclosure, and (ii) an antigen-binding molecule described herein together, for example as a pharmaceutical composition containing both agents (/.e. a combined preparation), or immediately after one another, and optionally via the same route of administration, e.g. to the same artery, vein or other blood vessel.
Sequential administration refers to administration of one of (i) a cell or composition according to the present disclosure, and (ii) an antigen-binding molecule described herein, followed after a given time interval by separate administration of the other agent. It is not required that the two agents are administered by the same route, although this is the case in some embodiments. The time interval may be any time interval.
Subjects A subject in accordance with the various aspects of the present disclosure may be any animal or human. Therapeutic and prophylactic applications may be in human or animals (veterinary use).
The subject to be administered with an article of the present disclosure (e.g. in accordance with therapeutic or prophylactic intervention) may be a subject in need of such intervention. The subject is preferably mammalian, more preferably human. The subject may be a non-human mammal, but is more preferably human. The subject may be male or female. The subject may be a patient.
A subject may have (e.g. may have been diagnosed with) a disease or condition described herein, may be suspected of having such a disease/condition, or may be at risk of developing/contracting such a disease/condition. In embodiments according to the present disclosure, a subject may be selected for treatment according to the methods based on characterisation for one or more markers of such a disease/condition.
In some embodiments, a subject may be selected for therapeutic or prophylactic intervention as described herein based on the detection of cells/tissue expressing a target antigen (/.e. the target antigen of an P38561-W0 antigen-binding molecule to be employed in conjunction with a cell or composition according to the present disclosure), or of cells/tissue overexpressing the target antigen, e.g. in a sample obtained from the subject.
A subject may be an allogeneic or non-autologous subject with respect to an intervention in accordance with the present disclosure. As used herein, where a subject is referred to herein as being ‘allogeneic’ or ‘non-autologous’ with respect to an intervention, the subject is a subject other than the subject from which the cell of the intervention (/.e. the cell to be administered, or the cell of the pharmaceutical composition/medicament to be administered) is derived. A subject to be treated/prevented in accordance with the present disclosure may be genetically non-identical to the subject from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject is derived. A subject to be treated/prevented in accordance with the present disclosure may comprise MHC/HLA genes encoding MHC/HLA molecules (e.g. MHC class I a and/or MHC class II molecules) that are non-identical to the MHC/HLA molecules (e.g. MHC class I a and/or MHC class II molecules) encoded by the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject. A subject to be treated/prevented in accordance with the present disclosure may be HLA-mismatched with respect to the subject from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject is derived.
The subject to which cells are administered in accordance with the present disclosure may be allogeneic/non-autologous with respect to the source from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject is derived. The subject to which cells are administered may be a different subject to the subject from which cells are/were obtained for the production of the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject. The subject to which the cell is administered may be genetically non-identical to the subject from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject cells are/were obtained for the production of the cells.
A subject may be an autogeneic/autologous subject with respect to an intervention in accordance with the present disclosure. As used herein, where a subject is referred to herein as being ‘autogeneic’ or ‘autologous’ with respect to an intervention, the subject is the same subject from which the cell of the intervention (/.e. the cell to be administered, or the cell of the pharmaceutical composition/medicament to be administered) is derived. A subject to be treated/prevented in accordance with the present disclosure may be genetically identical to the subject from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject is derived. A subject to be treated/prevented in accordance with the present disclosure may comprise MHC/HLA genes encoding MHC/HLA molecules (e.g. MHC class I a and/or MHC class II molecules) that are identical to the MHC/HLA molecules (e.g. MHC class I a and/or MHC class II molecules) encoded by the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject. A subject to be treated/prevented in accordance with the present disclosure may be HLA-matched with respect to the subject from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject is derived.
P38561-W0 The subject to which cells are administered in accordance with the present disclosure may be autogeneic/autologous with respect to the source from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject is derived. The subject to which cells are administered may be the same subject as the subject from which cells are/were obtained for the production of the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject. The subject to which the cell is administered may be genetically identical to the subject from which the cell (e.g. the cell of the pharmaceutical composition/medicament) to be administered to the subject cells are/were obtained for the production of the cells.
It must be noted that, as used in the specification and the appended claims, the singular forms ‘a,’ ‘an,’ and ‘the ’ include plural referents unless the context clearly dictates otherwise. Ranges may be expressed herein as from ‘about’ one particular value, and/or to ‘about’ another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by the use of the antecedent ‘about,’ it will be understood that the particular value forms another embodiment.
Where a nucleic acid sequence is disclosed herein, the reverse complement thereof is also expressly contemplated.
Methods described herein may preferably be performed in vitro. The term in vitro’ is intended to encompass procedures performed with cells in culture whereas the term ‘in vivo’ is intended to encompass procedures with/on intact multi-cellular organisms.
Examples The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1: Materials and Methods 1.1 Recombinant DNA / RNA TechniquesStandard methods were used to manipulate DNA as described in Sambrook et al., Molecular cloning: A laboratory manual; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989. The molecular biological reagents were used according to the manufacturers’ instructions. General information regarding the nucleotide sequences of human immunoglobulins light and heavy chains is given in: Kabat, E.A. et al., (1991) Sequences of Proteins of Immunological Interest, 5th ed., NIH Publication No. 91-3242. 1.2 DNA SequencingDNA sequences were determined by double-strand Sanger sequencing.
P38561-W0 1.3 Gene SynthesisDesired gene segments were either generated by PCR using appropriate templates or were synthesized by GeneArt AG (Regensburg, Germany) from synthetic oligonucleotides and PCR products by automated gene synthesis. The gene segments flanked by singular restriction endonuclease cleavage sites were cloned into second generation lenti viral vector vectors. The plasmid DNA was purified from transformed bacteria and concentration determined by UV spectroscopy. The DNA sequences of the subcloned gene fragments were confirmed by DNA sequencing. Gene segments were designed with suitable restriction sites to allow sub-cloning into the respective expression vectors. All constructs were designed with a 5’- end DNA sequence coding for a leader peptide which targets proteins for secretion in eukaryotic cells. When more than one protein chain was expressed, the coding sequences were separated by DNA encoding P2A / T2A / E2A self-splicing peptides. E2A is derived from equine rhinitis A virus; P2A is derived from porcine teschovirus-1 2A; T2A is derived from thosea asigna virus 2A. 1.4 T cell isolation from fresh healthy donor human bloodBio-One LeucoSEP™ Polypropylene Tubes (Greiner, #10349081) were prepared with 15mL Histopaque®- 1077 density gradient medium (Merck, #10771-500ML) by centrifugation at 400g for 5 minutes until the liquid is under the filter-unit. Fresh blood from anonymized healthy donors was mixed in a 1:1 ratio with Dulbecco’s phosphate buffered saline (DPBS, Merck #D8537-500ML) and transferred to the LeuSEP™ tubes without disturbing the prepared solution. After centrifugation at 1200g for 20 minutes (Acceleration: 1; Break: 0), the buffy coat visible as a white layer was separated into a new 50 mi falcon tube using a ml serological pipette. After washing three times with 40 mL DPBS and centrifugation at 780 >450 > 2g, the enriched cell population was further purified manually, according to the human Pan T cell isolation kit (Miltenyi, #130-094-535). In brief, cell pellets were labeled with Pan T cell Biotin-Antibody, incubated for minutes at 4 °C and further labeled with Pan T cell magnetic MicroBead Cocktail. Following negative selection on a MACS® Manual Separator, the purified Pan T cell population was either cultured, or frozen as 5x106 cells mL1־ aliquots in advanced RPMI 1640 (Fisher Scientific, #12633012) + 20% FBS (Sigma- Aldrich) + 1x GlutaMAX™ (Fisher Scientific, #35050061) + 20% DMSO (Sigma-Aldrich, #D2650-100ML) in dedicated freezing containers at -80 °C for at least 24 hours, then transferred to liquid nitrogen. 1.5 Production of IqG-like proteins in Expi293F cellsAntibodies and antibody-like proteins were generated by transient transfection of Expi293F cells. Cells were seeded in Expi293 media (Gibco, #1435101) at a density of 2.5 x 106 mL1־. Expression vectors and ExpiFectamine (Gibco, ExpiFectamine transfection kit, #13385544) were separately mixed in OptiMEM (Gibco, #11520386). After 5 minutes, both solutions were combined, mixed by pipetting and incubated for minutes at room temperature. Cells were added to the vector/ExpiFectamine solution and incubated for hours at 37 °C in a shaking incubator with a 5% CO2 atmosphere. One day post transfection, supplements (Enhancer 1+2, ExpiFectamine transfection kit) were added. Cell supernatants were harvested after 4-5 days by centrifugation and subsequent filtration (0.2 pm filter), and proteins were purified from the harvested supernatant by standard methods as indicated below.
P38561-W0 1.6 Purification of IgG-like proteinsProteins were purified from filtered cell culture supernatants referring to standard protocols. In brief, Fc containing proteins were purified from cell culture supernatants by Protein A-affinity chromatography (equilibration buffer: 20 mM sodium citrate, 20 mM sodium phosphate, pH 7.5; elution buffer: 20 mM sodium citrate, pH 3.0). Elution was achieved at pH 3.0 followed by immediate pH neutralization of the sample. The protein was concentrated by centrifugation (Millipore Amicon® ULTRA-15, #UFC903096), and aggregated protein was separated from monomeric protein by size exclusion chromatography in 20 mM histidine, 1mM sodium chloride, pH 6.0. 1.7 Production of IgG-like proteins in CHO K1 cellsAlternatively, the antibodies and antibody-like proteins described herein were prepared by Evitria using their proprietary vector system with conventional (non-PCR based) cloning techniques and using suspension-adapted CHO K1 cells (originally received from ATCC and adapted to serum-free growth in suspension culture at Evitria). For the production, Evitria used its proprietary, animal-component free and serum-free media (eviGrow and eviMake2) and its proprietary transfection reagent (eviFect). Supernatant was harvested by centrifugation and subsequent filtration (0.2 pm filter) and afterwards purified from the harvested supernatant by standard methods. 1.8 Analytics of IgG-like proteinsThe concentrations of purified proteins were determined by measuring the absorption at 280 nm using the mass extinction coefficient calculated on the basis of the amino acid sequence according to Pace, et al., Protein Science, 1995, 4, 2411-1423. Purity and molecular weight of the proteins were analyzed by CE- SDS in the presence and absence of a reducing agent using a LabChipGXIl or LabChip GX Touch (Perkin Elmer). Determination of the aggregate content was performed by HPLC chromatography at 25 °C using analytical size-exclusion column (TSKgel G3000 SW XL or UP-SW3000) equilibrated in running buffer (2mM KH2PO4, 250 mM KCI pH 6.2, 0.02 % NaN3). 1.9 Preparation of virus-like particlesLipofectamine LTX™-based transfection of-70% confluent Lenti-X™ 293T cells (Takara, #632180) was performed with CAR/CCR encoding transfer vectors as well as packaging vectors pCAG-VSVG and psPAX2 at a 2:1:2 molar ratio (Giry-Laferriere M, et al Methods Mol Biol. 2011 ;737:183-209, Myburgh R, et al Mol Ther Nucleic Acids. 2014). As control for every experiment, mock virus-like particles (VLPs) using only the packaging vectors, but no transfer vector, were produced. After 48 hours, the supernatant was collected and centrifuged for 10 minutes at 500g to remove remaining cells and concentrated 10-fold (Lenti- x-Concentrator, Takara, #631231) by centrifugation and resuspension according to the manufacturer’s protocol. 1.10 Transduction of healthy donor T cellsT cells were quickly thawed in a 37 °C water bath and washed with 10x (V:V) advanced RPMI 1640 (Fisher Scientific, #12633012) + 10% FBS (Sigma-Aldrich) + 1x GlutaMAX™ (Fisher Scientific, #35050061) + lUxmL1־ lnterleukin-2 (Miltenyi, #130-097-748) + 25ngxmL1 lnterleukin-7 (Miltenyi, #130-095-364) + P38561-W0 ngxmL1 Interleukin-15 (Miltenyi, #130-095-766). Cells were then seeded at 106xmL1 cells in a 12-well plate (Sigma Aldrich, # Z707791-126EA) and activated using Immunocult CD3/CD28/CD2 T cell Activator cocktail (Stemcell Technologies, #10990) for 24 hours.After brief incubation with 8 pgxmL1 Polybrene (Sigma Aldrich) and Lentiboost P (1:100) (Sirion Biotech, #SB-P-LV-101-12), previously purified virus-like particles were added to the activated T cells. Following incubation for at least 72 hours, the transduction efficiency was assessed by flow cytometry using fluorescently labeled anti-CAR antigens or commercial fluorescently labeled anti-tag antibodies. 1.11 Cultivation of T cellsEngineered or wild type T cells are cultured in G-Rex® 24 multi-well cell culture plates (Wilson Wolf, #80192M) at densities of 0.2x106 mL1 to 4x106 ML1 in advanced RPM11640 (Fisher Scientific, #12633012) + 10% FBS (Sigma-Aldrich) + 1X GlutaMAX™ (Fisher Scientific, #35050061) + 50 lUxmL1־ lnterleukin-(Miltenyi, #130-097-748) + 25 ngxmL1 lnterleukin-7 (Miltenyi, #130-095-364) + SOngxmL1 Interleukin-(Miltenyi, #130-095-766). 1.12 Flow cytometry surface stainingTransduction efficiency or cellular signaling events were assessed by flow cytometry. To control transduction efficiency, either GFP was co-expressed via 2A self-cleaving peptide, constructs were tagged with FLAG epitope tags, or fluorescently-labeled antigens were used. Signaling events were assessed via alternate regulation of surface markers. 100,000 cells were prepared in a 96-well plate and stimulated with dilutions of cytokines IL12 (Recombinant Human IL12 (linked heterodimer) Protein, R&D Systems #10018- IL-050), or IL23 (Human IL23 Recombinant Protein, Fisher Scientific #PHC9321). After incubation for hours at 37°C in a 5% CO2 atmosphere incubator, cells were washed with DPBS by subsequent centrifugation at 300g and stained with 50 pL of pre-diluted antibody solution at 4 °C for 30 minutes. Cells were washed two more times before being fixated with 4% PFA solution (Fixation Buffer, BD Biosciences, #554655). Cells were washed once more before final resuspension in FACS-buffer (PBS containing 2% FBS, 10% 0.5 M EDTA, pH 8 and 0.5 gxL1״ NaN3) and analysed on a BD LSRFortessa™ Cell Analyzer. 1.13 Phospho-STAT stainingIn preparation of the assay, 200,000 cells were washed with advanced RPMI 1640 (Fisher Scientific, #12633012) + 10% FBS (Sigma-Aldrich) + 1x GlutaMAX™ (Fisher Scientific, #35050061) without added cytokines and starved for 4-12 hours in the same medium in a 96 well plate. The cells were stimulated with serial dilutions of cytokines and incubated for 40 minutes at 37 °C in a 5% CO2 atmosphere incubator. Immediately after, cells were fixated and permeabilized (BD Phosflow™ Fix Buffer I, BD Biosciences, #557870) for 15 minutes at 37 °C. Following centrifugation at 300g for 2 minutes, the cells were resuspended in Phosflow Perm Buffer III (BD Biosciences, 558050) and incubated at 4 °C for 30 minutes. The cells were washed 2 more times in DPBS before being stained with pre-diluted antibody solution using a murine anti-pSTAT4 antibody conjugated with Alexa Fluor™ 647 (BD, #558137) and murine anti-pSTATantibody conjugated with PE (BD, #562072) for 60 minutes at 4 °C. After washing the cells once more in FACS-buffer (PBS containing 2% FBS, 10% 0.5 M EDTA, pH 8 and 0.5 gxL1־ NaN3), the acquisition was done on a BD LSRFortessa™ Cell Analyzer.33 P38561-W0 1.14 Homogeneous Time Resolved FluorescenceHomogeneous Time Resolved Fluorescence assay was used as an alternative to ELISA in assessing secreted cytokine concentrations. Human IFN gamma kit (Perkin Elmer CisBio, #62HIIFNGPET) was used according to the manufacturer's protocol to determine secreted Interferon gamma concentration in cell culture supernatants. In brief, 100,000 cells were washed with advanced RPMI 1640 (Fisher Scientific, #12633012) + 10% FBS (Sigma-Aldrich) + 1x GlutaMAX™ (Fisher Scientific, #35050061) + 50 IU mL'lnterleukin-2 (Miltenyi, #130-097-748) + 25 ngxmL-1 lnterleukin-7 (Miltenyi, #130-095-364) + 50 ngxmL-Interleukin-15 (Miltenyi, #130-095-766). The cells were stimulated with serial dilutions of IL12 and IL23 and incubated for 24 hours at 37 °C in a 5% CO2 atmosphere incubator. IFNy EU Cryptate - and IFNy XL antibodies were diluted 20-fold in 20x in detection buffer. Next, supernatants were combined 4:1 with a pre- mixed 1:1 dilution of donor and acceptor antibodies and incubated for 4 to 12 hours at room temperature. A standard was acquired as serial 1:3 dilutions from 4000 pgxmL1 to 0 pgxmL1־. FRET-Fluorescence emission was determined at 665 nm (acceptor) and 620 nm (donor). The data was normalized to the donor signal, background subtracted and fitted to the IFNy standard curve obtained in the same assay. 1.15 Incucyte Killing AssayTarget cells (MKN-45-NLR or HPAF-II-NLR) were seeded in RPMI 1640 (Fisher Scientific, # 11875093) + 2% FBS (Sigma-Aldrich) + 1x GlutaMAX™ (Fisher Scientific, #35050061) in a 96-well plate with edge reservoir (Fisher Scientific, # 167425) and incubated for at least 2 hours. Engineered cells were washed two times in Dulbecco’s phosphate buffered saline (DPBS, Merck #D8537-500ML), resuspended in RPMI 1640 (Fisher Scientific, # 11875093) + 2% FBS (Sigma-Aldrich) + 1x GlutaMAX™ (Fisher Scientific, #35050061). Cell densities were normalized to equal percentage of CAR-positive cells before being added to the target cells. Engineered T cells were either used at different effector to target cells ratios (E:T) for direct CARs, or at fixed E:T with dilutions of the targeting IgG for adaptor-based CARs. Target cell killing was monitored for 7 days in an Incucyte® Live-Cell Analysis System. Analysis was cut off, when the growth of target cells-only reached a plateau. Data was normalized to the initial cell concentration and to the growth of target cells without effector cells.
In case of a repetitive assay setting (e.g. as in Example 9), target cell killing was monitored for 2 days in an Incucyte® Live-Cell Analysis System per round, indicated by dotted lines. RPMI1640 (Fisher Scientific, # 11875093) supplemented with 1x GlutaMAX™ (Fisher Scientific, #35050061) and 10% FBS (Sigma- Aldrich) was chosen as a culture medium. Engineered T cells were washed two times in PBS and normalized to the amount of CAR positive cells by addition of wild-type cells before being added to the target cells at an E:T ratio of 1:1. Finally, IL12 or IL23 were added as indicated. After 2 days, corresponding to one round, new target cells were seeded in a new plate. Also, engineered T cells were separated from cancer cells by lightly resuspending and aspirating. Supernatant was removed and fresh medium was added before combining the engineered T cells with the new target cells. Finally, IL12 or IL23 were added again, as indicated. Analysis was continued in the same Incucyte® Live-Cell Analysis System. This process was repeated 4 times for a total of five repetitive killing rounds. Data was normalized to the initial cell concentration within each round.
P38561-W0 Example 2:Detection of IL23 - IL12 chimeric cytokine receptors in human immune cellsT cells isolated from 50 mL of healthy donor blood were transduced with VLPs containing transgenes encoding different IL23 - IL12 chimeric cytokine receptors (IL23-IL12sR). First, peripheral blood mononuclear cells (PBMCs) were isolated from donated fresh human blood by density gradient centrifugation. The cell population was further enriched for untouched human Pan T cells by negative selection using a human Pan T cell isolation Kit (Miltenyi, #130-096-535). Cells were then cultured for hours in advanced RPMI 1640 + 10% FBS + 1x GlutaMAX + 50 IUxmL1 lnterleukin-2 + 25 ngxmL- lnterleukin-7 + 50 ngxmL1־ Interleukin-15, before being stimulated with Immunocult CD3/CD28/CD2 T cell Activator cocktail (StemCELL technologies, #10990) to induce clonal expansion. Previously prepared, 10x concentrated VLPs encoding desired constructs were added together with polybrene (Sigma, #TR-1003- G) and LentiBoostP (Sirion Biotech, #SB-A-LF-901-01) to the cells for subsequent incubation for at least hours. Expression of the full length construct was assessed by eGFP reporter fluorescence, fluorescently labeled anti-CAR antigen (e.g. Biot-Avi-tag_Fc_huCEACAM5(A3B3) or Fc_(PGLALA)_AF647). The surface expression of IL23-IL12sR was assessed, where applicable, by flow cytometry directly by an N- terminal FLAG-tag (DYKDDDDK) and commercially available fluorescently labeled anti-FLAG-tag antibody (Biolegend, #637322). More specifically, 100,000 cells per condition were harvested, washed with PBS and seeded in a 96 well V-bottom plate. After staining for 30 minutes in the dark at 4 °C using a 20nM Fc_(PGLALA)_AF647 and 1:200 dilution of BV421 anti-FLAG-tag Antibody in PBS, samples were washed two more times before being fixated with 4% PFA solution (Fixation Buffer, BD Biosciences, #554655). Cells were washed once more before resuspension in FACS-buffer (PBS containing 2% FBS, 10% 0.5 M EDTA, pH 8 and 0.5 gxL1־ NaN3) and analysis on a BD LSRFortessa™ Cell Analyzer.
All tested constructs were expressed after transduction of human healthy donor primary T cells, as is indirectly detected by the fluorescent signal of the eGFP reporter protein (Figure 2A). Furthermore, all recombinant receptors can be directly detected by staining of the N-terminal FLAG-tag (Figure 2B). Chimeric antigen receptors encoded on the same construct are expressed at comparable ratios, represented by detection via the compatible fluorescently labeled CAR-antigen (Figure 2B).
Example 3: Analysis of signal transduction and activation of transcription factor phosphorylation in human immune cells engineered with an IL23-IL12sR Analysis of phosphorylation of signal transduction and activators of transcription factors (STATs) by IL23- IL12sR signalling was done by flow cytometric analysis.
T cells transduced with an IL23-L12sR were stimulated with serial dilutions of recombinant human interleukin-23 (hulL23) (Thermo Fisher Scientific, #PHC9321) for 40 minutes, followed by immediate fixation (BD, #557870), permeabilization (BD, #558050) and intracellular staining for flow cytometric analysis using a murine anti-pSTAT4 antibody conjugated with Alexa Fluor™ 647 (BD, #558137) and murine anti-pSTAT3 antibody conjugated with PE (BD, #562072). Cells were gated on lymphocytes, single cells (FSC-A vs FSC-H), single cells (SSC-A vs SSC-H) and, where applicable, GFP positive cells. IL23- IL12sR modified cells showed dose-dependent phosphorylation of STAT4 (Jacobson et Al. 1995, Kaplan et Al. 1998) but not STAT3 (Chen et Al. 2003) when stimulated with IL23, similar to the endogenous IL P38561-W0 receptor complex stimulated with IL12 (Figure 3A, 3B). Notably, the EC50 of pSTAT4 upregulation via IL23- IL12sRs is higher and maximum signal appears increased. Combined phosphorylation of STAT4 and STAT3 is only evident in cells where the IL23R is overexpressed (Figure 3C,D).
Example 4: Functional Analysis of IL23-IL12sR-mediated upregulation of characteristic cell surface markers in engineered human immune cells Functional analysis of IL23-IL12sRs was done by flow cytometric analysis of cell surface markers which are known to be expressed upon IL12 signaling. These include most notably IL18Ra (Yoshimoto et AL, 1998), IL12Rb2 via a STAT4 mediated feed-forward loop (Valenzuela et AL, 2002), but also PD-1 (Gerner et AL, 2013) and CD25 (Valenzuela et AL, 2002), although PD-1 and CD25 being not reproducible and donor-dependent, respectively. T cells transduced with an IL23-IL12sR with eGFP reporter were stimulated with serial dilutions of hulL23 (Thermo Fisher Scientific, #PHC9321) for 24 hours. Following incubation, the cells were stained (Const.Nr 1,2: panel 1, Const.Nr 3,4,5,6,7: panel 2, Const.Nr. 8,9: panel 3) and fixated for flow cytometric analysis. The panels are described in Tables 1-3 below. Cells were gated on lymphocytes, singlets (FSC-A vs FSC-H) and living cells expressing CD3 and, where applicable, the GFP reporter or anti-CAR-antigen. The IL23-L12sR shows dose-dependent upregulation, most prominently of the IL18Ra (Figure 4A). Here, the EC50 of IL23-IL12sR_(IL12Rb2-TMD) is lowered by approximately 100- fold, and the EC50 of the IL23IL12sR_(IL23R-TMD) by 1000-fold, compared to the signal of IL12 and the endogenous IL12 receptor complex. Similarly, the IL12Rb2 is upregulated by stimulation of the IL23 - ILchimeric cytokine receptor with IL23 (Figure 4B), consistent with a previously reported feed-forward mechanisms, triggered by STAT4 signaling (e.g., Valenzuela et AL 2002). In this example, IL23-IL12sR (IL12Rb2-TMD) T cells show a lower IL12Rb2-baseline, more similar to the wild type cells, when compared to IL23-IL12sR (IL23R-TMD). Specifically, in wild type cells, this feed-forward mechanism cannot be visualized in this manner because the selected anti-IL12Rb2 antibody (Biolegend, #394205) stands in competition with IL12 and is therefore either out-competed or high concentrations of IL12 lead to increased internalization of IL12Rb2. In T cells engineered with a 41BB based P329G CAR in addition to IL23-IL12sR, the upregulation of IL18Ra (Figure 5A) shows similar dose-response behaviour with a higher EC50 and higher maximum signal. Feed-forward upregulation of IL12Rb2 can also be observed (Figure 5B).
Table 1. Panel 1. target molecule origin Cat.Nr.
GFP n.A. n.A. n.A.
IL18Ra APC Biolegend 313814 IL12Rb2 PE BD Biosciences 550723PD1 BV421 Biolegend 329920 CD25 BV605 Biolegend 302631 CDS BV711 Biolegend 301043 CD3 BUV395 BD Biosciences 74028336 P38561-W0 target molecule origin Cat.Nr.
Live/DEAD ™Aqua Aqua405 Thermo Fisher ScientificL34957 Table 2. Panel 2. target molecule origin Cat.Nr.
PG-CAR Fc_(PGLALA)_AF647 in-house IL18Ra FITC Biolegend 313810 IL12Rb2 PE BD Biosciences 550723 PD1 BV421 Biolegend 329920CD25 BV605 Biolegend 302631 CDS BV711 Biolegend 301043 CD3 BUV395 BD Biosciences 740283Live/DEAD ™Aqua Aqua405 Thermo Fisher ScientificL34957 Table 3. Panel 3. target molecule / fluorophore origin Cat.Nr.
PG-CAR Biot-Avi-tag_Fc_huCEACAM5(A3B3)in-house Avi-tag Streptavidin-AF647 Biolegend 405237 IL18Ra FITC Biolegend 313810 IL12Rb2 PE BD Biosciences 550723 PD1 BV421 Biolegend 329920CD25 BV605 Biolegend 302631 CDS BV711 Biolegend 301043 CDS BUV395 BD Biosciences 740283 Live/DEAD ™Aqua Aqua405 Thermo Fisher ScientificL34957 P38561-W0 Example 5: Interferon-qamma secretion in response to stimulation of IL23-IL12sRs in engineered human immune cells Upregulation of Interfereon-gamma (IFNy) (Yoshimoto et AL, 1998) in human healthy donor primary T cells transduced with IL23-IL12sRs was assessed by stimulation with serial dilutions of hulL23 (Thermo Fisher Scientific, #PHC9321) for 24 hours. Following incubation cell supernatant was homogenized and transferred to a new vessel. Presence of IFNy was detected using a HTRF kit (Cis-Bio, #62HIFNGPEG). In brief, supernatants were mixed with IFNy EU Cryptate - and IFNy XL antibodies, sealed and incubated for > 4 hours at room temperature. The readout was performed by determining the FRET-induced fluorescence emission at 665 nm (acceptor) and fluorescence at 620 nm (donor). Background was subtracted and relative signal was fitted to a standard curve of recombinant IFNy. The IL23-IL12sR shows dose-dependent upregulation of IFNy when stimulated with hulL23 (Figure 5C). Notably, IFNy release from stimulation of the IL23-IL12sR only occurs, when also a co-stimulating CAR is present (Figure 5D).
Example 6: Killing assay using human immune cells engineered with IL23-IL12sR Killing of target cells mediated by IL23-IL12sRs was assessed in the context of adaptor-CAR. Initially, healthy donor human T cells were purified, activated and transduced with VIPs carrying the respective CAR and IL23-IL12sR formats. Cells were expanded for >5 days at 37 °C in a 5% CO2 atmosphere. Prior to the preparation of the killing assay, transduction efficiency of the immune cells was assessed by flow cytometry, as described in example 1. Target cells MKN-45-NLR or HPAF-II-NLR were seeded in a 96-well plate with edge reservoir and incubated for at least 2 hours to adhere to the plate. Engineered cells were washed two times in PBS and normalized to the amount of CAR positive cells by addition of wild-type cells before being added to the target cells. Engineered T cells were seeded at fixed E:T with dilutions of the targeting IgG for adaptor-based CAR-T cells. Target cell killing was observed for 5-7 days in an Incucyte® live-cell analysis system. Data was normalized to the initial cell concentration and to the growth of target cells without effector cells. In suboptimal killing conditions (e.g., non-saturating concentrations of targeting IgG), the addition of 20 nM of hulL23 to human immune cells engineered with a CAR and IL23-IL12sR, leads to a 20-40% increase in target cell killing (Figure 6A, 6B).
Example 7: Functionality of IL23-IL12sRs in human immune cells engineered with a direct CAR Detection of chimeric constructs, analysis of signal transduction, functional analysis and killing capacity of engineered human immune cells was assessed similar to Examples 2-6. Direct CEA-CAR was detected in flow cytometry using Biot-Avi-tag_Fc_hu_CEACAM5(A3B3) and Streptavidin-AF647 (Figure 7A). To show that the FLAG-epitope used in other examples does not influence the function of the chimeric receptors, it was omitted from the design in this example. Therefore, the IL23-IL12sRs were only functionally detected via upregulation of IL18Ra, IL12Rb2, CD25 and IFNy, in accordance with previous assays (Figure 7B). In suboptimal killing conditions (e.g., low effector to target (E:T) ratios), the addition of 20 nM of hulL23 to human immune cells engineered with a CEA-CAR and IL23-IL12sR, leads to a 10-50% increase in target cell killing (Figure 8A, 8B).
P38561-W0 Example 8: IL23-IL125R designs with chimeric ECD having similar or improved sensitivity and efficacy when transduced in human immune cells Detection of chimeric constructs, analysis of signal transduction and / or functional analysis was assessed similar to Examples 2-7.
The constructs are expressed after transduction of human healthy donor primary T cells, as is indirectly detected by the expression of the P329G CAR stained with Fc_(PGLALA)_AF647 and directly detected by staining of the FLAG-tag with a fluorescently labeled anti-FLAG-antibody (Figure 9A). This suggests that IL23-IL12sR designs with a full IL23R-ECD and IL12Rb2-TMD or IL23R-TMD are superior in how they influence the expression of the upstream CAR as well as the expression of the receptor itself, compared to designs with a chimeric ECD. Functionally, stimulation of variants of IL23-IL12sRs with a chimeric ECDonly, and intact ECD2-3 interface show improved sensitivity and maximum signal across readouts (IL18Ra, IL12Rb2, IFNy), when stimulated with serial dilutions of IL23 in a dose dependent manner (Figure 9B). In a target cell killing experiment with MKN-45 cells, all T cells engineered with a P329G CAR-28z and IL23- IL12sR variants except those with IL23-TMD show increased killing capacity of CAR-T cells, especially at low E:T ratios and when stimulated with IL23 (Figure 10).
Example 9: Repetitive killing assay using human immune cells engineered with IL23-IL12sR In preparation of the assay, engineered human immune cells were generated and cultured as previously outlined (e.g. under Example 1). Target cells HPAF-II-NLR were seeded in a 96-well plate. In 2-day intervals, engineered T cells (transfected with construct #12 [SEQ ID NO: 66 and 67] or construct #13 [SEQ ID NO: 68 and 6]) were co-cultured with target cells at an E:T ratio of 1:1 with or without addition of cytokines and afterwards transferred to new target cells for five repetitive killing rounds. Without the addition of ILor IL23, CAR-T cells can control cancer cell growth for 2 rounds (Figure 11). The killing capacity of both CAR-T cell populations is similar, irrespective of co-engineering with an IL23-IL12sR. By consecutive addition of high-dose IL23 to CAR-T cells, the killing capacity of CAR-T cells is extended. However, only the addition of IL12, or the supplementation of IL23 to CAR IL23-IL12sR T cells confers potent cancer cell killing across five rounds (Figure 11).
P38561-W0 SEQUENCE LISTING SEQ ID NO: 1 (hulL23R_SP)MNQVTIQWDAVIALYILFSWCHG SEQ ID NO: 2 (hulL23R_ECD)GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLET EEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWS SLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIG SEQ ID NO: 3 (hulL12Rb2_TMD)WMAFVAPSICIAIIMVGIFST SEQ ID NO: 4 (hulL23R_TMD) LLLGMIVFAVMLSILSLIGIF SEQ ID NO: 5 (hulL12Rb2_ICD)HYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQV TPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENP ACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQL KMRCDSLML SEQ ID NO: 6 (T2A)GSGEGRGSLLTCGDVEENPGP SEQ ID NO: 7 (EGFP)VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQC FSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHK LEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKD PNEKRDHMVLLEFVTAAGITLGMDELYK SEQ ID NO: 8 (FLAG-tag)DYKDDDDK SEQ ID NO: 9 (E2A)GSGQCTNYALLKLAGDVESNPGP SEQ ID NO: 10 (hulL23R_ECD1) P38561-W0 GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGY SEQ ID NO: 11 (hulL23R_ECD2)PPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLV WVQAANALGMEESKQLQIHLDDIVIP SEQ ID NO: 12 (hulL23R_ECD3)SAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVF QVRCQETGKRYWQPWSSLFFHKTP SEQ ID NO: 13 (hulL12Rb2_ECD2)APEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPES PESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRP SEQ ID NO: 14 (hulL12Rb2_ECD3)LPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQI SSKLHLYKGSWSDWSESLRAQTP SEQ ID NO: 15 (hulL12RB2_ECD4-6)EEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVI PRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVV EWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHI NAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWM TALTAAGESSHGNEREFCLQGKAN SEQ ID NO: 16 (SP)MGWSCIILFLVATATGVHS SEQ ID NO: 17 (huP329G_VH)EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEWVGEITPDSSTINYAPSLKGRF TISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVSS SEQ ID NO: 18 ((G4S)4)GGGGSGGGGSGGGGSGGGGS SEQ ID NO: 19 (huP329G_VL)QAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWQEKPDHLFTGLIGGTNKRAPGTPARFSGSLL G G KAALTLSG AQ P ED EAE YYC ALWYS N H WVFGG GTKLTVL SEQ ID NO: 20 (G4S) P38561-W0 GGGGS SEQ ID NO: 21 (huCD8_stalk)AKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD SEQ ID NO: 22 (huCD8_TMD)IYIWAPLAGTCGVLLLSLVIT SEQ ID NO: 23 (hu4-1BB ICD)KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL SEQ ID NO: 24 (huCD3z_ICD)RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKM AEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR SEQ ID NO: 25 (hulL23R_ICD)NRSFRTGIKRRILLLIPKWLYEDIPNMKNSNWKMLQENSELMNNNSSEQVLYVDPMITEIKEIFIPEHKPTD YKKENTGPLETRDYPQNSLFDNTTVVYIPDLNTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGN NPRLQKHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPD EFVSCLGIVNEELPSINTYFPQNILESHFNRISLLEK SEQ ID NO: 26 (anti-huCEACAM5_T84.66_VH)EVQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNSKYVPKFQGKA TITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVSS SEQ ID NO: 27 (anti-huCEACAM5_T84.66_VL)DIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLIYRASNLESGIPVRFSGTG SRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIK SEQ ID NO: 28 (Anti CEACAM5 IgG light chain)DIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLIYRASNLESGIPVRFSGTG SRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNN FYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTK SFNRGEC SEQ ID NO: 29 (Anti CEACAM5 IgG heavy chain)EVQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNSKYVPKFQGKA TITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNH KPSNTKVDKKVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQP P38561-W0 REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 30 (Fc_(P329G L9A L10A)CPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALGAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK SEQ ID NO: 31 (Biot-Avi-tag_Fc_huCEACAM5(A3B3) heavy chain)DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELT KNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPG SEQ ID NO: 32 (Biot-Avi-tag_Fc_huCEACAM5(A3B3) light chain)GLNDIFEAQKIEWHEDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRWVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGGSGGGGGGSQLTTESMPFNVAEGKEVLLLVH NLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIK SDLVNEEATGQFHVYPELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWNGQSLPVSPRLQLSN GNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPS PQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSAS SEQ ID NO: 33 (huCD28_TMD)F WVLVWGG VLAC YS LLVTVAF11FWV SEQ ID NO: 34 (huCD28_ICD)RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS SEQ ID NO: 35 (IL23R ECD1+2)GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLET EEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIP SEQ ID NO: 36 (construct #1)MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIK ERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMT CTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIH LDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEP P38561-W0 NIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIG WMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLID WPTPEDPEPLVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQL VDLYKVLESRGSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFP SSSLHPLTFSCGDKLTLDQLKMRCDSLML SEQ ID NO: 37 (construct #2)MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIK ERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMT CTWNAGKLTYIDTKYVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIH LDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEP NIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIG LLLGMIVFAVMLSILSLIGIFHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLID WPTPEDPEPLVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQL VDLYKVLESRGSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFP SSSLHPLTFSCGDKLTLDQLKMRCDSLMLGSGEGRGSLLTCGDVEENPGPVSKGEELFTGWPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAM PEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKN GIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGIT LGMDELYK SEQ ID NO: 38 (construct #3)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEW GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWVFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCH GDYKDDDDKGGSGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINK TTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYAPEQPQNLSCIQKGEQGTVACTWERGRD THLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIV RPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYE FQISSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHY QVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSAN SEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVY ALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQL CEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFS THYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPEN P38561-W0 PACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQ LKMRCDSLML SEQ ID NO: 39 (construct #4)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEW GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWVFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCH GDYKDDDDKGGSGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINK TTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLT YIDTKYWHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPLPPW DIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKL HLYKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQEL TGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNI LVTWQPPRKDPSAVQEYWEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALSGDQ GGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYR VSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQ QKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVF RHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACP WTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMR CDSLML SEQ ID NO: 40 (construct #5)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEWV GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWVFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCH GDYKDDDDKGGSGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINK TTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLT YIDTKYVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAV ISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRC QETGKRYWQPWSSLFFHKTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQ ELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGM P38561-W0 DNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALSG DQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIP YRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYF QQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPV FRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPAC PWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKM RCDSLML SEQ ID NO: 41 (construct #6)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEW GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITKR GRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGR REEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST ATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCHGDYKDDD DKGGSGGITNINCSGHIWEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWY KNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYW HVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETIN ATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKR YWQPWSSPFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGWMAFVAPSICIAIIMVGI FSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLH QVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPE NPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLD QLKMRCDSLML SEQ ID NO: 42 (construct #8)MGWSCIILFLVATATGVHSEVQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRI DPANGNSKYVPKFQGKATITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVS SGGGGSGGGGSGGGGSDIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLI YRASNLESGIPVRFSGTGSRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIKGGGGSAKPTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITKRGRKKLLYI FKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVL DKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYD ALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVE PATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHF QETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYINI STDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQTTIEKVSC EMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSPFFHKTPETVPQ VTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ P38561-W0 WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRHPPCSNWPQRE KGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACPWTVLPAGDLPTHD GYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML SEQ ID NO: 43 (construct #10)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEW GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCH GDYKDDDDKGGSGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINK TTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLT YIDTKYVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAV ISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRC QETGKRYWQPWSSPFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGWMAFVAPSI CIAIIMVGIFSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEP LVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESR GSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSC GDKLTLDQLKMRCDSLML SEQ ID NO: 44 (construct #11)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEW GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWVFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVA FIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCH GDYKDDDDKGGSGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINK TTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLT YIDTKYVHVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAV ISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRC QETGKRYWQPWSSPFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGMIVFAV MLSILSLIGIFHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPL VISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESR GSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSC GDKLTLDQLKMRCDSLML P38561-W0 SEQ ID NO: 45 (construct #7)MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEW GEITPDSSTINYAPSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVS SGGGGSGGGGSGGGGSGGGGSQAWTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHL FTGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWFGGGTKLTVLGGGG SAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITKR GRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGR REEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST ATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCHGDYKDDD DKGGSGGITNINCSGHIWEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWY KNFLEPHASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYW HVKSLETEEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETIN ATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKR YWQPWSSPFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGMIVFAVMLSILSLI GIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMNNNSSEQVLYVDPMITEIKEIFIPEHK PTDYKKENTGPLETRDYPQNSLFDNTTWYIPDLNTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLD SGNNPRLQKHPNFAFSVSSVNSLSNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTL LPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLEK SEQ ID NO: 46 (construct #9)MGWSCIILFLVATATGVHSEVQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWKQRPEQGLEWIGRI DPANGNSKYVPKFQGKATITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVS SGGGGSGGGGSGGGGSDIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLI YRASNLESGIPVRFSGTGSRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIKGGGGSAKPTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITKRGRKKLLYI FKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVL DKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYD ALHMQALPPRGSGQCTNYALLKLAGDVESNPGPVSKGEELFTGWPILVELDGDVNGHKFSVSGEGEGD ATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNY KTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQL ADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK SEQ ID NO: 47 (IL12Rb2 ECD2-6)APEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPES PESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPS NSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVWYM KRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAA NSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQV PLNWLRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWN P38561-W0 SIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGN EREFCLQGKAN SEQ ID NO: 48 (IL12Rb2 ECD3-6)LPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQI SSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVT LQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEG MDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALS GDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEI PYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKAN SEQ ID NO: 49 (VH3 CDR H1)RYWMN SEQ ID NO: 50 (VH3 CDR H2)EITPDSSTINYAPSLKG SEQ ID NO: 51 (HCDR2)EITPDSSTINYTPSLKG SEQ ID NO: 52 (VH3 CDR H3)PYDYGAWFAS SEQ ID NO: 53 (VL1 CDR L1)RSSTGAVTTSNYAN SEQ ID NO: 54 (VL1 CDR L2)GTNKRAP SEQ ID NO: 55 (VL1 CDR L3)ALWYSNHWV SEQ ID NO: 56 (VH3 VH)EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKGLEWVGEITPDSSTINYAPSLKGRF TISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVSS SEQ ID NO: 57 (VH)EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMNWVRQAPGKGLEWVGEITPDSSTINYTPSLKGRF TISRDNAKNSLYLQMNSLRAEDTAVYYCVRPYDYGAWFASWGQGTLVTVSS SEQ ID NO: 58 (VH) P38561-W0 EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMNWVRQAPGKGLEWVGEITPDSSTINYAPSLKGRF TISRDNAKNSLYLQMNSLRAEDTAVYYCVRPYDYGAWFASWGQGTLVTVSS SEQ ID NO: 59 (VH3VL1 (ds) scFv)EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMNWVRQAPGKCLEWVGEITPDSSTINYAPSLKGRF TISRDNAKNSLYLQMNSLRAEDTAVYYCARPYDYGAWFASWGQGTLVTVSSGGGGSGGGGSGGGGS GGGGSQAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNKRAPGTPAR FSGSLLGGKAALTLSGAQPEDEAEYYCALWYSNHWVFGCGTKLTVL SEQ ID NO: 60 (VL)QAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWQEKPDHLFTGLIGGTNKRAPGTPARFSGSLL GGKAALTLSGAQPEDEAEYYCALWYSNHWVFGGGTKLTVL SEQ ID NO: 61 (VL1 (ds) VL)QAVVTQEPSLTVSPGGTVTLTCRSSTGAVTTSNYANWQEKPDHLFTGLIGGTNKRAPGTPARFSGSLL GGKAALTLSGAQPEDEAEYYCALWYSNHWVFGCGTKLTVL SEQ ID NO: 62 (exemplary chimeric receptor polypeptide)GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLET EEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWS SPFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGWMAFVAPSICIAIIMVGIFSTHYFQ QKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVF RHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACP WTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMR CDSLML SEQ ID NO: 63 (exemplary chimeric receptor polypeptide)GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLET EEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWS SLFFHKTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITG HTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDP SAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKH KAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQP RVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQ WCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRHPPCSNWPQRE KGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACPWTVLPAGDLPTHD GYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML P38561-W0 SEQ ID NO: 64 (exemplary chimeric receptor polypeptide)GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLET EEEQQYLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPLPPWDIRIKFQKASVSRCT LYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESL RAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHT SWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSA VQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILGNSKHKA PLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRV TYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAALRPQWC SREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRHPPCSNWPQREKGI QGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACPWTVLPAGDLPTHDGYL PSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML SEQ ID NO: 65 (exemplary chimeric receptor polypeptide)GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPH ASMYCTAECPKHFQETLICGKDISSGYAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGP KNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQK ASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSW SDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMT QNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPP RKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIKSYICYEIRVYALSGDQGGCSSILG NSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPI NSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPSICIAIIMVGIFSTHYFQQKVFVLLAA LRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRHPPCSNWP QREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACPWTVLPAGDLP THDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML SEQ ID NO: 66 (construct #12 [CEA-CAR-28z_IL23-IL12sR (IL12Rb2_TMD)] - protein sequence)MGWSCIILFLVATATGVHSEVQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRI DPANGNSKYVPKFQGKATITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVS SGGGGSGGGGSGGGGSDIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLI YRASNLESGIPVRFSGTGSRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIKGGGGSAKPTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLWVGGVLACYSLLVTVAFIIFWVRS KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGR REEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLS TATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPMNQVTIQWDAVIALYILFSWCHGGITNIN CSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYC TAECPKHFQETLICGKDISSGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQ YLTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTIIYWDSQ P38561-W0 TTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHK TPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGWMAFVAPSICIAIIMVGIFSTHYFQQKVFVL LAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPEDPEPLVISEVLHQVTPVFRHPPCS NWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACPWTVLPA GDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML SEQ ID NO: 67 (construct #12 [CEA-CAR-28z_IL23-IL12sR (IL12Rb2_TMD)] - DNA sequence) ATGGGCTGGAGCTGCATCATTCTGTTTCTGGTGGCCACAGCCACAGGCGTGCATTCTGAAGTTCAG CTGCAGCAGTCTGGCGCCGAACTTGTTGAACCTGGCGCCTCTGTGAAGCTGTCTTGTACCGCCAGC GGCTTCAACATCAAGGACACCTACATGCACTGGGTCAAGCAGAGGCCTGAGCAGGGACTCGAATGG ATCGGAAGAATCGACCCCGCCAACGGCAACAGCAAATACGTGCCCAAGTTCCAGGGCAAAGCCACC ATCACAGCCGACACAAGCAGCAACACAGCCTACCTGCAGCTCACCAGCCTGACATCTGAGGACACC GCCGTGTACTACTGCGCCCCTTTTGGCTACTACGTGTCCGACTACGCCATGGCCTATTGGGGCCAG GGCACATCTGTGACAGTTTCTAGCGGAGGCGGAGGAAGTGGTGGCGGAGGTTCTGGCGGCGGAGG ATCTGATATTGTG CTG ACACAG AGCCCTG CCAG CCTGG CTGTTTCTCTTG G ACAG AGG GCC ACC ATG TCTTGTAGAGCCGGCGAGTCCGTGGATATCTTCGGCGTGGGATTCCTGCACTGGTATCAGCAGAAA CCCGGCCAGCCTCCTAAGCTGCTGATCTACAGAGCCAGCAACCTGGAATCTGGCATCCCTGTGCGG TTTAGCGGCACCGGCAGCAGAACCGATTTCACCCTGATCATCGACCCTGTGGAAGCCGATGACGTG GCCACCTACTACTGCCAGCAGACCAATGAGGACCCCTACACCTTTGGCGGAGGCACCAAGCTGGAA ATCAAAGGCGGCGGAGGATCCGCCAAGCCTACAACAACACCAGCTCCTAGACCTCCAACTCCTGCT CCTACAATCGCCAGCCAGCCTCTGTCTCTGAGGCCTGAAGCTTGTAGACCAGCAGCTGGCGGAGCC GTGCATACCAGAGGACTGGATTTCGCCTGCGACTTCTGGGTGCTCGTGGTTGTTGGCGGAGTGCTG GCCTGTTACTCTCTGCTGGTCACCGTGGCCTTCATCATCTTTTGGGTCAGAAGCAAGCGGAGCAGAC TG CTGCACAG CG ACTACATG AACATG ACCCCTAG ACGG CCCG G ACCTACCAG AAAG CACTACCAG C CTTACGCTCCTCCTAGAGACTTCGCCGCCTACAGGAGCAGAGTGAAGTTTAGCAGATCAGCCGACG CTCCTGCCTACCAGCAGGGCCAGAATCAGCTGTACAACGAGCTGAACCTGGGGCGCAGAGAAGAGT ACGACGTGCTGGATAAGAGAAGAGGCAGAGATCCCGAGATGGGCGGCAAGCCCCAGAGAAGAAAG AATCCCCAAGAGGGCCTCTACAACGAGCTGCAAAAGGACAAGATGGCCGAGGCCTACAGCGAGATC GGAATGAAGGGCGAACGCAGAAGAGGAAAGGGCCACGACGGACTGTATCAGGGCCTGTCTACAGC CACCAAGGACACCTATGATGCCCTGCACATGCAGGCCCTGCCTCCAAGAGGATCTGGCCAGTGTAC CAACTATGCCCTGCTGAAGCTAGCCGGCGACGTTGAATCTAATCCCGGGCCTATGAATCAAGTGACC ATCCAGTGGGATGCCGTGATCGCCCTGTATATCCTGTTCAGCTGGTGCCACGGCGGCATCACCAAC ATCAATTGCTCTGGCCACATCTGGGTCGAGCCCGCCACAATCTTCAAGATGGGCATGAACATCAGCA TCTACTGCCAGGCCGCCATCAAGAACTGCCAGCCTAGAAAGCTGCACTTCTACAAGAACGGCATCAA AGAGCGGTTCCAGATCACCCGGATCAACAAGACCACCGCCAGACTGTGGTACAAGAACTTCCTGGA ACCTCACGCCAGCATGTACTGCACCGCCGAGTGTCCCAAGCACTTCCAAGAGACACTGATCTGCGG CAAGGACATCAGCAGCGGCTACCCTCCAGACATCCCTGATGAAGTGACCTGCGTGATCTACGAGTA CAGCGGCAACATGACCTGCACCTGGAATGCCGGCAAGCTGACCTACATCGACACCAAATACGTGGT GCACGTGAAGTCCCTGGAAACCGAGGAAGAACAGCAGTACCTGACCAGCAGCTACATCAACATCTCCACCGATAGCCTGCAAGGCGGCAAGAAATACCTCGTGTGGGTGCAAGCCGCCAACGCTCTCGGAAT G G AAG AG AG CAAG CAG CTG CAG ATCCACCTGG ACG ACATCGTG ATTCCATCTGCCG CCGTG ATCAG P38561-W0 CAGAGCCGAGACAATCAATGCCACCGTGCCTAAGACCATCATCTACTGGGACAGCCAGACCACCAT CGAGAAGGTGTCCTGCGAGATGAGATACAAGGCCACCACCAACCAGACCTGGAACGTGAAAGAGTT CGATACCAACTTCACCTACGTGCAGCAGAGCGAGTTCTACCTCGAACCGAACATCAAATATGTGTTC CAAGTGCGGTGCCAAGAAACCGGCAAGAGATACTGGCAGCCTTGGAGCAGCCTCTTCTTCCACAAG ACCCCTGAGACAGTGCCCCAAGTGACAAGCAAGGCCTTCCAGCACGATACCTGGAATAGCGGCCTG ACAGTGGCCAGCATTAGCACCGGTCACCTGACCTCCGACAACAGAGGCGATATCGGATGGATGGCC TTCGTGGCCCCTAGCATCTGTATCGCCATCATCATGGTCGGAATCTTCAGCACCCACTACTTCCAGC AGAAAGTGTTCGTGCTGTTGGCTGCTCTGCGGCCGCAGTGGTGTAGCAGAGAAATCCCCGATCCTG CCAACTCTACCTGCGCCAAGAAGTACCCTATCGCCGAGGAAAAGACCCAGCTGCCTCTGGACAGAC TGCTGATCGATTGGCCTACACCTGAGGACCCTGAGCCTCTGGTTATCAGCGAAGTGCTGCACCAAG TGACCCCTGTGTTCAGACACCCTCCTTGCAGCAACTGGCCTCAGAGAGAGAAGGGAATCCAGGGAC ACCAGGCCAGCGAGAAGGATATGATGCACTCTGCCAGCTCTCCACCTCCTCCAAGAGCACTTCAGG CCGAAAGCAGACAGCTGGTGGACCTGTATAAGGTGCTGGAAAGCAGGGGCAGCGACCCCAAGCCT GAAAATCCAGCTTGTCCTTGGACTGTGCTGCCTGCCGGCGATCTGCCTACACACGATGGCTACCTG CCTAGCAACATCGACGATCTGCCATCTCATGAGGCCCCTCTGGCCGACTCTCTGGAAGAACTGGAA CCACAGCACATCAGCCTGAGCGTGTTCCCCAGTAGCTCTCTGCACCCTCTGACCTTCAGCTGCGGCG ATAAG CTGACCCTG G ATCAG CTGAAGATGAGATGCGACAG CCTGATGCTGTGA SEQ ID NO: 68 (construct #13 [CEA-CAR-28z_GFP] - protein sequence)MGWSCIILFLVATATGVHSEVQLQQSGAELVEPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRI DPANGNSKYVPKFQGKATITADTSSNTAYLQLTSLTSEDTAVYYCAPFGYYVSDYAMAYWGQGTSVTVS SGGGGSGGGGSGGGGSDIVLTQSPASLAVSLGQRATMSCRAGESVDIFGVGFLHWYQQKPGQPPKLLI YRASNLESGIPVRFSGTGSRTDFTLIIDPVEADDVATYYCQQTNEDPYTFGGGTKLEIKGGGGSAKPTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLWVGGVLACYSLLVTVAFIIFWVRS KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGR REEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLS TATKDTYDALHMQALPPRGSGQCTNYALLKLAGDVESNPGPVSKGEELFTGVVPILVELDGDVNGHKFS VSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERT IFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRH NIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK SEQ ID NO: 69 (construct #13 [CEA-CAR-28z_GFP] - DNA sequence) ATGGGCTGGAGCTGCATCATTCTGTTTCTGGTGGCCACAGCCACAGGCGTGCATTCTGAAGTTCAG CTGCAGCAGTCTGGCGCCGAACTTGTTGAACCTGGCGCCTCTGTGAAGCTGTCTTGTACCGCCAGC GGCTTCAACATCAAGGACACCTACATGCACTGGGTCAAGCAGAGGCCTGAGCAGGGACTCGAATGG ATCGGAAGAATCGACCCCGCCAACGGCAACAGCAAATACGTGCCCAAGTTCCAGGGCAAAGCCACC ATCACAGCCGACACAAGCAGCAACACAGCCTACCTGCAGCTCACCAGCCTGACATCTGAGGACACC GCCGTGTACTACTGCGCCCCTTTTGGCTACTACGTGTCCGACTACGCCATGGCCTATTGGGGCCAG GGCACATCTGTGACAGTTTCTAGCGGAGGCGGAGGAAGTGGTGGCGGAGGTTCTGGCGGCGGAGG ATCTG ATATTGTG CTG ACACAG AGCCCTG CCAG CCTGG CTGTTTCTCTTG G ACAG AGG GCC ACC ATG TCTTGTAGAGCCGGCGAGTCCGTGGATATCTTCGGCGTGGGATTCCTGCACTGGTATCAGCAGAAA P38561-W0 CCCGGCCAGCCTCCTAAGCTGCTGATCTACAGAGCCAGCAACCTGGAATCTGGCATCCCTGTGCGG TTTAGCGGCACCGGCAGCAGAACCGATTTCACCCTGATCATCGACCCTGTGGAAGCCGATGACGTG GCCACCTACTACTGCCAGCAGACCAATGAGGACCCCTACACCTTTGGCGGAGGCACCAAGCTGGAA ATCAAAGGCGGCGGAGGATCCGCCAAGCCTACAACAACACCAGCTCCTAGACCTCCAACTCCTGCT CCTACAATCGCCAGCCAGCCTCTGTCTCTGAGGCCTGAAGCTTGTAGACCAGCAGCTGGCGGAGCC GTGCATACCAGAGGACTGGATTTCGCCTGCGACTTCTGGGTGCTCGTGGTTGTTGGCGGAGTGCTG GCCTGTTACTCTCTGCTGGTCACCGTGGCCTTCATCATCTTTTGGGTCAGAAGCAAGCGGAGCAGAC TGCTGCACAGCGACTACATGAACATGACCCCTAGACGGCCCGGACCTACCAGAAAGCACTACCAGC CTTACGCTCCTCCTAGAGACTTCGCCGCCTACAGGAGCAGAGTGAAGTTTAGCAGATCAGCCGACG CTCCTGCCTACCAGCAGGGCCAGAATCAGCTGTACAACGAGCTGAACCTGGGGCGCAGAGAAGAGT ACGACGTGCTGGATAAGAGAAGAGGCAGAGATCCCGAGATGGGCGGCAAGCCCCAGAGAAGAAAG AATCCCCAAGAGGGCCTCTACAACGAGCTGCAAAAGGACAAGATGGCCGAGGCCTACAGCGAGATC GGAATGAAGGGCGAACGCAGAAGAGGAAAGGGCCACGACGGACTGTATCAGGGCCTGTCTACAGC CACCAAGGACACCTATGATGCCCTGCACATGCAGGCCCTGCCTCCAAGAGGATCTGGCCAGTGTAC CAACTATGCCCTGCTGAAGCTAGCCGGAGATGTGGAGTCTAATCCCGGGCCTGTGTCTAAAGGCGA GGAGCTGTTTACCGGAGTGGTGCCCATTCTGGTGGAGCTGGATGGAGATGTGAACGGCCACAAGTT CAGCGTGTCTGGCGAAGGCGAGGGAGATGCCACATATGGCAAGCTGACCCTGAAGTTTATCTGCAC CACCGGCAAGCTGCCCGTGCCTTGGCCAACACTGGTCACAACACTGACCTACGGCGTGCAGTGCTT TAGCAGATACCCCGATCACATGAAGCAGCACGATTTCTTCAAGAGCGCCATGCCTGAGGGCTACGT GCAGGAGAGAACCATCTTCTTCAAGGACGACGGCAACTACAAGACCAGAGCTGAGGTGAAGTTCGA GGGCGACACCCTGGTGAACAGAATCGAGCTGAAGGGAATCGACTTCAAGGAGGATGGAAACATCCT GGGCCACAAGCTGGAGTACAACTACAACAGCCACAACGTGTACATCATGGCCGACAAGCAGAAAAA CGGCATCAAGGTGAACTTCAAGATCCGGCACAACATCGAGGACGGCAGCGTTCAGCTGGCCGACCA TTACCAGCAGAATACACCCATCGGAGATGGCCCCGTGCTGCTGCCTGATAATCACTACCTGAGCACA CAGAGCGCCCTGAGCAAGGACCCCAATGAGAAGAGGGATCACATGGTCCTGCTGGAGTTTGTGACA GCCGCCGGAATCACACTCGGCATGGACGAGCTGTATAAGTGA

Claims (56)

    P38561-W0
  1. Claims 1. A chimeric receptor polypeptide comprising:(i) an extracellular portion comprising an IL23-binding domain;(ii) an intracellular portion comprising the intracellular domains of IL12Rb2 (Interleukin-12 receptor beta 2); and(iii) a transmembrane domain that joins the extracellular portion and the intracellular portion.
  2. 2. The chimeric receptor polypeptide of claim 1, wherein the IL23-binding domain binds the p19 subunit of IL23.
  3. 3. The chimeric receptor polypeptide of claim 1 or 2, wherein the intracellular portion comprises the amino acid sequence of SEQ ID NO: 5 or an amino acid sequence having at least 80% sequence identity thereto.
  4. 4. The chimeric receptor polypeptide of any of claims 1-3, wherein the transmembrane domain is selected from the transmembrane domain of IL12Rb2, IL23Ra, CDS, and CD28.
  5. 5. The chimeric receptor polypeptide of any of claims 1-4, wherein the transmembrane domain comprises an amino acid sequence selected from SEQ ID Nos: 3, 4, 22, 33, or an amino acid sequence having at least 80% sequence identity thereto.
  6. 6. The chimeric receptor polypeptide of any of claims 1-5, further comprising a signal sequence.
  7. 7. The chimeric receptor polypeptide of claim 6, wherein the signal sequence comprises the amino acid sequence of SEQ ID NO: 1 or 16.
  8. 8. The chimeric receptor polypeptide of any of claims 1-7, further comprising one or more linkers.
  9. 9. The chimeric receptor polypeptide of claim 8, wherein the linker is a GS linker, a 2A linker, an a-helical linker, a glycine-alanine polymer linker, an alanine-serine polymer linker, or an lgG4-Fc linker.
  10. 10. The chimeric receptor polypeptide of any of claims 1 -9, further comprising a tag polypeptide, e.g. a Flag tag.
  11. 11. The chimeric receptor polypeptide of any of claims 1 -10, further comprising a marker, e.g. a fluorescent polypeptide, e.g. GFP or eGFP.
  12. 12. The chimeric receptor polypeptide of any of claims 1-11, comprising from the N-terminus to the C- terminus:Optional signal peptide - optional tag - optional linker - IL23-binding domain -transmembrane domain - intracellular portion comprising the intracellular domains of IL12Rb2 - optional linker - optional marker P38561-W0
  13. 13. The chimeric receptor polypeptide of any of claims 1-12, wherein the IL23-binding domain comprises an extracellular domain of IL23Ra.
  14. 14. The chimeric receptor polypeptide of any of claims 1-13, wherein the IL23-binding domain comprises the amino acid sequence of SEQ ID NO: 10 or an amino acid sequence having at least 80% sequence identity thereto.
  15. 15. The chimeric receptor polypeptide of any of claims 1-14, wherein the IL23-binding domain comprises the amino acid sequence of SEQ ID NO: 35 or an amino acid sequence having at least 80% sequence identity thereto.
  16. 16. The chimeric receptor polypeptide of any of claims 1-15, wherein the IL23-binding domain comprises the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence having at least 80% sequence identity thereto.
  17. 17. The chimeric receptor polypeptide of claim 14, further comprising between said IL23-binding domain and the transmembrane domain, an amino acid sequence of SEQ ID NO: 47 or an amino acid sequence having at least 80% sequence identity thereto.
  18. 18. The chimeric receptor polypeptide of claim 15, further comprising between said IL23-binding domain and the transmembrane domain, an amino acid sequence of SEQ ID NO: 48 or an amino acid sequence having at least 80% sequence identity thereto.
  19. 19. The chimeric receptor polypeptide of claim 16, further comprising between said IL23-binding domain and the transmembrane domain, an amino acid sequence of SEQ ID NO: 15 or an amino acid sequence having at least 80% sequence identity thereto.
  20. 20. The chimeric receptor polypeptide of any of claims 1-12, wherein the IL23-binding domain comprises a Fv, scFv, Fab, Fab‘, Fab‘-SH, F(ab’)2, crossFab, scFab, a single domain antibody (sdAb), or a designed ankyrin repeat protein (DARPin).
  21. 21. The chimeric receptor polypeptide of any of claims 1-19, wherein the chimeric receptor polypeptide comprises an amino acid sequence having at least 80% sequence identity to an amino acid sequence selected from SEQ ID Nos: 36-44 and 62-66.
  22. 22. A nucleic acid, or a plurality of nucleic acids, encoding a chimeric receptor polypeptide according to any one of claims 1-21, and optionally further comprising a nucleic acid sequence encoding a chimeric antigen receptor. P38561-W0
  23. 23. An expression vector, or a plurality of expression vectors, comprising a nucleic acid or a plurality of nucleic acids according to claim 22.
  24. 24. A cell comprising a chimeric receptor polypeptide according to any of claims 1-21, a nucleic acid or a plurality of nucleic acids according to claim 22, or an expression vector or a plurality of expression vectors according to claim 23.
  25. 25. The cell of claim 24, wherein the cell expresses IL12Rb1.
  26. 26. The cell of claim 25, wherein the cell is a eukaryotic cell.
  27. 27. The cell of claim 26, wherein the eukaryotic cell is an animal cell.
  28. 28. The cell of claim 27, wherein the animal cell is a mammalian cell.
  29. 29. The cell of claim 28, wherein the mammalian cell is a human cell.
  30. 30. The cell of claim 28 or 29, wherein the cell is an immune cell, a neuron, an epithelial cell, an endothelial cell, or a stem cell.
  31. 31. The cell of claim 30, wherein the cell is an immune cell.
  32. 32. The immune cell of claim 31, wherein the immune cell is a tumor infiltrating lymphocyte (TIL), B cell, a monocyte, a natural killer (NK) cell, a basophil, an eosinophil, a neutrophil, a dendritic cell, a macrophage, a regulatory T cell (Treg), a helper T cell (Th), a cytotoxic T cell (Tctl), an effector T cell, a memory T cell, a Natural Killer T (NKT) cell, or other T cell.
  33. 33. The cell of claim 31 or 32, further comprising a chimeric antigen receptor (CAR).
  34. 34. The cell of any of claims 31-33, further comprising an engineered TCR.
  35. 35. The cell of any of claims 24-34, wherein the cell shows a dose-dependent phosphorylation of STATbut not STAT3 when treated with IL23.
  36. 36. The cell of any of claims 24-35, wherein the cell is a transduced T cell capable of expressing the chimeric receptor polypeptide according to any one of claims 1-21.
  37. 37. The cell of any of claims 24-36, wherein the cell expresses an antigen binding receptor comprising an anchoring transmembrane domain and an extracellular domain, wherein the extracellular domain comprises an antigen binding moiety comprising P38561-W0 (i) a heavy chain variable domain (VH) comprising a heavy chain complementary determining region (HCDR) 1 of SEQ ID NO:49, a HCDR 2 of SEQ ID NO:50 or SEQ ID NO:51, and a HCDR 3 of SEQ ID NO:52, and(ii) a light chain variable domain (VL) comprising a light chain complementarity determining region (LCDR) of SEQ ID NO:53, a LCDR 2 of SEQ ID NO:54 and a LCDR 3 of SEQ ID NO:55.
  38. 38. The cell of claim 37, wherein the VH domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58 and SEQ ID NO 59.
  39. 39. The cell of claim 37 or 38, wherein the VL domain comprises an amino acid sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO:60 or SEQ ID NO:61.
  40. 40. The cell of any of claims 37-39, wherein the anchoring transmembrane domain is a transmembrane domain selected from the group consisting of the CDS, the CD4, the CD3z, the FCGR3A, the NKG2D, the CD27, the CD28, the CD137, the OX40, the ICOS, the DAP10 or the DAP12 transmembrane domain or a fragment thereof, in particular wherein the anchoring transmembrane domain is the CDS transmembrane domain or a fragment thereof.
  41. 41. The cell of any of claims 37-40, wherein the antigen binding receptor further comprises at least one stimulatory signaling domain and/or at least one co-stimulatory signaling domain.
  42. 42. The cell of any of claims 37-41, wherein in the antigen binding receptor at least one stimulatory signaling domain is individually selected from the group consisting of the intracellular domain of CD3z, of FCGR3A and of NKG2D, or fragments thereof that retains stimulatory signaling activity, in particular wherein the at least one stimulatory signaling domain is the CD3z intracellular domain or a fragment thereof that retains CD3z stimulatory signaling activity.
  43. 43. The cell of any of claims 37-42, wherein in the antigen binding receptor the at least one co-stimulatory signaling domain is individually selected from the group consisting of the intracellular domain of CD27, of CD28, of CD137, of OX40, of ICOS, of DAP10 and of DAP12, or fragments thereof that retain co-stimulatory signaling activity.
  44. 44. The cell of any of claims 37-43, wherein the antigen binding receptor comprises at least one CDcostimulatory domain or a fragment thereof that retains CD28 co-stimulatory activity, and/or at least one CD137 costimulatory domain or a fragment thereof that retains CD137 co-stimulatory activity.
  45. 45. The cell of any of claims 37-44, wherein the antigen binding receptor comprises a stimulatory signaling domain comprising the intracellular domain of CD3z, or a fragment thereof that retains CD3z stimulatory signaling activity, and wherein the antigen binding receptor comprises a co-stimulatory signaling domain P38561-W0 comprising the intracellular domain of CD28, or a fragment thereof that retains CD28 co-stimulatory signaling activity.
  46. 46. The cell of any of claims 37-45, wherein the antigen binding receptor comprises one stimulatory signaling domain comprising the intracellular domain of CD3z, or a fragment thereof that retains CD3z stimulatory signaling activity, and wherein the antigen binding receptor comprises one co-stimulatory signaling domain comprising the intracellular domain of CD137, or a fragment thereof that retains CD1co-stimulatory signaling activity.
  47. 47. The cell of any of claims 37-46, wherein the antigen binding moiety is connected at the C-terminus to the N-terminus of the anchoring transmembrane domain, optionally through a peptide linker.
  48. 48. The cell of any of claims 37-47, wherein in the antigen binding receptor the light chain variable domain (VL) of the antigen binding moiety is connected at the C-terminus to the N-terminus of the anchoring transmembrane domain, optionally through a peptide linker, and/or wherein the heavy chain variable domain (VH) is connected at the C-terminus to the N-terminus of the light chain variable domain (VL), optionally through a peptide linker.
  49. 49. A pharmaceutical composition comprising the cell of any one of claims 24-36, and optionally a pharmaceutically acceptable excipient.
  50. 50. A chimeric receptor polypeptide according to claims 1-21, or a nucleic acid according to claim 22, or a vector according to claim 22, or a cell according to any of claims 34-36, or a pharmaceutical composition according to claim 49, for use in a method of medical treatment of a disease or prophylaxis of a disease.
  51. 51. The chimeric receptor polypeptide, nucleic acid, vector, cell, or pharmaceutical composition for use according to claim 50, wherein the method is a cell therapy, e.g. an adoptive cell therapy.
  52. 52. The chimeric receptor polypeptide, nucleic acid, vector, cell, or pharmaceutical composition for use according to claim 50 or 51, wherein the chimeric receptor polypeptide, nucleic acid, vector, cell, or pharmaceutical composition is administered intravenously, intratumorally, or subcutaneously.
  53. 53. The chimeric receptor polypeptide, nucleic acid, vector, cell, or pharmaceutical composition for use according to any of claims 50-52, wherein the disease is a cancer, an autoimmune disease, or an infection.
  54. 54. The chimeric receptor polypeptide, nucleic acid, vector, cell, or pharmaceutical composition for use according to claim 53, wherein the cancer is selected from the group consisting of acute leukemias (including but not limited to acute myeloid leukemia (AML), B-cell acute lymphoid leukemia (BALL), T-cell acute lymphoid leukemia (TALL), and acute lymphoid leukemia (ALL)), chronic leukemias (including but not limited to chronic myelogenous leukemia (CML) and chronic lymphocytic leukemia (CLL)), multiple P38561-W0myeloma (MM), myelodysplastic syndrome (MDS), myeloproliferative neoplasms (MPNs), chronic myeloid leukemia (CML), and blastic plasmacytoid dendritic cell neoplasm (BPDCN).
  55. 55. A method for modulating the activity of an immune cell, said method comprising: administering, to an immune cell, the nucleic acid or plurality of nucleic acids of claims 22, or the expression vector or plurality of expression vectors of claim 23.
  56. 56. The method of claim 55, wherein the immune cell is a tumor infiltrating lymphocyte (TIL), B cell, a monocyte, a natural killer (NK) cell, a basophil, an eosinophil, a neutrophil, a dendritic cell, a macrophage, a regulatory T cell (Treg), a helper T cell (Th), a cytotoxic T cell (Tctl), an effector T cell, a memory T cell, a Natural Killer T (NKT) cell, or other T cell.
IL324488A 2023-06-06 2024-05-27 Switch receptors IL324488A (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP23177793 2023-06-06
PCT/EP2024/064471 WO2024251547A1 (en) 2023-06-06 2024-05-27 Switch receptors

Publications (1)

Publication Number Publication Date
IL324488A true IL324488A (en) 2026-01-01

Family

ID=86731992

Family Applications (1)

Application Number Title Priority Date Filing Date
IL324488A IL324488A (en) 2023-06-06 2024-05-27 Switch receptors

Country Status (10)

Country Link
KR (1) KR20260020404A (en)
CN (1) CN121240874A (en)
AR (1) AR132786A1 (en)
AU (1) AU2024286646A1 (en)
CL (1) CL2025003759A1 (en)
CO (1) CO2025016585A2 (en)
IL (1) IL324488A (en)
MX (1) MX2025014670A (en)
TW (1) TW202506711A (en)
WO (1) WO2024251547A1 (en)

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2019011526A (en) 2017-03-27 2019-12-05 Hoffmann La Roche Improved antigen binding receptors.
EP4021582A1 (en) * 2019-08-30 2022-07-06 Allogene Therapeutics, Inc. Chimeric cytokine receptors comprising tgf beta binding domains
PE20230998A1 (en) 2020-08-03 2023-06-26 Hoffmann La Roche ENHANCED ANTIGEN BINDING RECEPTORS
WO2022032042A1 (en) * 2020-08-05 2022-02-10 Synthekine, Inc. Il12 receptor synthetic cytokines and methods of use
WO2023081813A1 (en) * 2021-11-05 2023-05-11 St. Jude Children's Research Hospital, Inc. Zip cytokine receptors

Also Published As

Publication number Publication date
AU2024286646A9 (en) 2025-12-11
TW202506711A (en) 2025-02-16
AU2024286646A1 (en) 2025-11-27
CO2025016585A2 (en) 2025-12-09
CN121240874A (en) 2025-12-30
AR132786A1 (en) 2025-07-30
MX2025014670A (en) 2026-01-07
WO2024251547A1 (en) 2024-12-12
CL2025003759A1 (en) 2026-01-09
KR20260020404A (en) 2026-02-11

Similar Documents

Publication Publication Date Title
US20250034217A1 (en) Nucleic acid constructs for co-expression of chimeric antigen receptor and transcription factor, cells containing and therapeutic use thereof
TWI788781B (en) Novel engineered t cell receptors and immune therapy using the same
KR102235202B1 (en) Chimeric antigen receptor(car) with antigen binding domains to the t cell receptor beta constant region
US11793894B2 (en) Modulation of immunity and CEACAM1 activity
JP2021516996A (en) Biologically related orthogonal cytokine / receptor pair
TW202023580A (en) Compositions and methods for tcr reprogramming using target specific fusion proteins
US20190263928A1 (en) Adaptive chimeric antigen receptor t-cell design
TW201831505A (en) Chimeric antigen receptor for AXL or ROR2 and method of use thereof
JP2019528061A (en) Novel T cell receptor and immunotherapy using the same
US20230149460A1 (en) Methods for generating engineered memory-like nk cells and compositions thereof
CN110709416A (en) TGF-beta decoy receptor
JP2020527036A (en) MR1 restricted T cell receptor for cancer immunotherapy
US20240181056A1 (en) Chimeric antigen receptor (car)-t cells
CN111542547B (en) Chimeric antigen receptor specific for BDCA2 antigen
JP2021519063A (en) Lymphocytes expressing heterologous targeting constructs
CN112041432A (en) FOXP3 targeting agent compositions and methods of use for adoptive cell therapy
US20230159645A1 (en) Multispecific binding moieties comprising pd-1 and tgf-brii binding domains
US20240207312A1 (en) Chimeric antigen receptor (car)-t cells
IL324488A (en) Switch receptors
HK40129273A (en) Switch receptors
US20250302879A1 (en) Recombinant t cell receptors
US20240207313A1 (en) Chimeric antigen receptor (car)-t cells