IL297852A - E protein channel blockers and orf3 inhibitors as anti-covid-19 agents - Google Patents
E protein channel blockers and orf3 inhibitors as anti-covid-19 agentsInfo
- Publication number
- IL297852A IL297852A IL297852A IL29785222A IL297852A IL 297852 A IL297852 A IL 297852A IL 297852 A IL297852 A IL 297852A IL 29785222 A IL29785222 A IL 29785222A IL 297852 A IL297852 A IL 297852A
- Authority
- IL
- Israel
- Prior art keywords
- cov
- sars
- protein
- day
- blocker
- Prior art date
Links
- 239000003795 chemical substances by application Substances 0.000 title description 13
- 101710204837 Envelope small membrane protein Proteins 0.000 title description 12
- 101710145006 Lysis protein Proteins 0.000 title description 12
- 208000025721 COVID-19 Diseases 0.000 title description 9
- 239000003112 inhibitor Substances 0.000 title description 2
- 101100437895 Alternaria brassicicola bsc3 gene Proteins 0.000 title 1
- 101150073872 ORF3 gene Proteins 0.000 title 1
- 101100226891 Phomopsis amygdali PaP450-1 gene Proteins 0.000 title 1
- 150000003839 salts Chemical class 0.000 claims description 79
- 101000667982 Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein Proteins 0.000 claims description 74
- 101100323333 Severe acute respiratory syndrome coronavirus 2 3a gene Proteins 0.000 claims description 64
- 229940121649 protein inhibitor Drugs 0.000 claims description 48
- 239000012268 protein inhibitor Substances 0.000 claims description 48
- 241001678559 COVID-19 virus Species 0.000 claims description 46
- 238000000034 method Methods 0.000 claims description 42
- 239000008194 pharmaceutical composition Substances 0.000 claims description 36
- YIQPUIGJQJDJOS-UHFFFAOYSA-N plerixafor Chemical compound C=1C=C(CN2CCNCCCNCCNCCC2)C=CC=1CN1CCCNCCNCCCNCC1 YIQPUIGJQJDJOS-UHFFFAOYSA-N 0.000 claims description 24
- PVTHJAPFENJVNC-MHRBZPPQSA-N kasugamycin Chemical compound N[C@H]1C[C@H](NC(=N)C(O)=O)[C@@H](C)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H]1O PVTHJAPFENJVNC-MHRBZPPQSA-N 0.000 claims description 23
- 229960002169 plerixafor Drugs 0.000 claims description 21
- 230000001018 virulence Effects 0.000 claims description 19
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 claims description 15
- WVLHHLRVNDMIAR-IBGZPJMESA-N AMD 070 Chemical compound C1CCC2=CC=CN=C2[C@H]1N(CCCCN)CC1=NC2=CC=CC=C2N1 WVLHHLRVNDMIAR-IBGZPJMESA-N 0.000 claims description 15
- 229960002756 azacitidine Drugs 0.000 claims description 15
- MHPZZZZLAQGTHT-UHFFFAOYSA-N mebrofenin Chemical compound CC1=CC(C)=C(NC(=O)CN(CC(O)=O)CC(O)=O)C(C)=C1Br MHPZZZZLAQGTHT-UHFFFAOYSA-N 0.000 claims description 15
- BUGYDGFZZOZRHP-UHFFFAOYSA-N memantine Chemical compound C1C(C2)CC3(C)CC1(C)CC2(N)C3 BUGYDGFZZOZRHP-UHFFFAOYSA-N 0.000 claims description 15
- BJCJYEYYYGBROF-UHFFFAOYSA-N 4-[(4-methylpiperazin-1-yl)methyl]-n-[6-methyl-5-[(4-pyridin-3-ylpyrimidin-2-yl)amino]pyridin-3-yl]-3-(trifluoromethyl)benzamide Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=NC=2)C=C1C(F)(F)F BJCJYEYYYGBROF-UHFFFAOYSA-N 0.000 claims description 13
- 108010065839 Capreomycin Proteins 0.000 claims description 13
- 229940121302 mavorixafor Drugs 0.000 claims description 13
- 229960004950 mebrofenin Drugs 0.000 claims description 13
- 229960004640 memantine Drugs 0.000 claims description 13
- YVAFBXLHPINSIK-QHCPKHFHSA-N n-[(5r)-4-(2,2-dimethylpropanoyl)-5-[[2-(ethylamino)ethylsulfonylamino]methyl]-5-phenyl-1,3,4-thiadiazol-2-yl]-2,2-dimethylpropanamide Chemical compound C=1C=CC=CC=1[C@]1(CNS(=O)(=O)CCNCC)SC(NC(=O)C(C)(C)C)=NN1C(=O)C(C)(C)C YVAFBXLHPINSIK-QHCPKHFHSA-N 0.000 claims description 13
- WDPFJWLDPVQCAJ-UHFFFAOYSA-N n-[2-(diethylamino)ethyl]-2-[2-[(4-fluorophenyl)methylsulfanyl]-4-oxo-6,7-dihydro-5h-cyclopenta[d]pyrimidin-1-yl]-n-[[4-[4-(trifluoromethyl)phenyl]phenyl]methyl]acetamide Chemical compound C1=2CCCC=2C(=O)N=C(SCC=2C=CC(F)=CC=2)N1CC(=O)N(CCN(CC)CC)CC(C=C1)=CC=C1C1=CC=C(C(F)(F)F)C=C1 WDPFJWLDPVQCAJ-UHFFFAOYSA-N 0.000 claims description 13
- 229950006544 saroglitazar Drugs 0.000 claims description 13
- VCOPTHOUUNAYKQ-WBTCAYNUSA-N (3s)-3,6-diamino-n-[[(2s,5s,8e,11s,15s)-15-amino-11-[(6r)-2-amino-1,4,5,6-tetrahydropyrimidin-6-yl]-8-[(carbamoylamino)methylidene]-2-(hydroxymethyl)-3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide;(3s)-3,6-diamino-n-[[(2s,5s,8 Chemical compound N1C(=O)\C(=C/NC(N)=O)NC(=O)[C@H](CNC(=O)C[C@@H](N)CCCN)NC(=O)[C@H](C)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1.N1C(=O)\C(=C/NC(N)=O)NC(=O)[C@H](CNC(=O)C[C@@H](N)CCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1 VCOPTHOUUNAYKQ-WBTCAYNUSA-N 0.000 claims description 12
- 229960004602 capreomycin Drugs 0.000 claims description 12
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 claims description 12
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 claims description 12
- 238000011282 treatment Methods 0.000 claims description 12
- QBPPRVHXOZRESW-UHFFFAOYSA-N 1,4,7,10-tetraazacyclododecane Chemical compound C1CNCCNCCNCCN1 QBPPRVHXOZRESW-UHFFFAOYSA-N 0.000 claims description 11
- 229950004456 darapladib Drugs 0.000 claims description 11
- 229960000961 floxuridine Drugs 0.000 claims description 11
- 229960000390 fludarabine Drugs 0.000 claims description 11
- 229950008887 litronesib Drugs 0.000 claims description 11
- XDRYMKDFEDOLFX-UHFFFAOYSA-N pentamidine Chemical compound C1=CC(C(=N)N)=CC=C1OCCCCCOC1=CC=C(C(N)=N)C=C1 XDRYMKDFEDOLFX-UHFFFAOYSA-N 0.000 claims description 11
- 230000002265 prevention Effects 0.000 claims description 11
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 claims description 11
- BOVGTQGAOIONJV-BETUJISGSA-N 1-[(3ar,6as)-3,3a,4,5,6,6a-hexahydro-1h-cyclopenta[c]pyrrol-2-yl]-3-(4-methylphenyl)sulfonylurea Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1C[C@H]2CCC[C@H]2C1 BOVGTQGAOIONJV-BETUJISGSA-N 0.000 claims description 10
- 229960000346 gliclazide Drugs 0.000 claims description 10
- 229960000268 spectinomycin Drugs 0.000 claims description 10
- 229960004448 pentamidine Drugs 0.000 claims description 9
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 claims description 8
- UJYFZCVPOSZDMK-YPPDDXJESA-L magnesium (2S)-2-ethoxy-3-[4-[2-[2-methyl-5-(4-methylsulfanylphenyl)pyrrol-1-yl]ethoxy]phenyl]propanoate Chemical compound [Mg++].CCO[C@@H](Cc1ccc(OCCn2c(C)ccc2-c2ccc(SC)cc2)cc1)C([O-])=O.CCO[C@@H](Cc1ccc(OCCn2c(C)ccc2-c2ccc(SC)cc2)cc1)C([O-])=O UJYFZCVPOSZDMK-YPPDDXJESA-L 0.000 claims description 7
- 229940089161 ginsenoside Drugs 0.000 claims description 4
- 229930182494 ginsenoside Natural products 0.000 claims description 4
- 241000494545 Cordyline virus 2 Species 0.000 claims description 3
- 241000894006 Bacteria Species 0.000 description 68
- 230000003612 virological effect Effects 0.000 description 56
- 238000003556 assay Methods 0.000 description 46
- 210000004027 cell Anatomy 0.000 description 37
- 239000000203 mixture Substances 0.000 description 37
- 230000007423 decrease Effects 0.000 description 35
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 24
- 208000036142 Viral infection Diseases 0.000 description 23
- 230000009385 viral infection Effects 0.000 description 23
- 238000012216 screening Methods 0.000 description 21
- 150000004677 hydrates Chemical class 0.000 description 19
- 239000012453 solvate Substances 0.000 description 19
- 230000008859 change Effects 0.000 description 18
- 238000003271 compound fluorescence assay Methods 0.000 description 17
- 108090000623 proteins and genes Proteins 0.000 description 16
- 201000010099 disease Diseases 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 14
- 235000018102 proteins Nutrition 0.000 description 13
- 241000711573 Coronaviridae Species 0.000 description 12
- 239000003814 drug Substances 0.000 description 10
- 229940079593 drug Drugs 0.000 description 9
- MRWFZSLZNUJVQW-DEOSSOPVSA-N saroglitazar Chemical compound C1=CC(C[C@H](OCC)C(O)=O)=CC=C1OCCN1C(C=2C=CC(SC)=CC=2)=CC=C1C MRWFZSLZNUJVQW-DEOSSOPVSA-N 0.000 description 7
- 241000700605 Viruses Species 0.000 description 6
- 230000001580 bacterial effect Effects 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 208000001528 Coronaviridae Infections Diseases 0.000 description 5
- 102000004310 Ion Channels Human genes 0.000 description 5
- 241000315672 SARS coronavirus Species 0.000 description 5
- 239000003937 drug carrier Substances 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000002502 liposome Substances 0.000 description 5
- 239000013543 active substance Substances 0.000 description 4
- 230000002950 deficient Effects 0.000 description 4
- 231100000252 nontoxic Toxicity 0.000 description 4
- 230000003000 nontoxic effect Effects 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- UEUPDYPUTTUXLJ-UHFFFAOYSA-N 1-[[4-(1,4,8,11-tetrazacyclotetradec-1-ylmethyl)phenyl]methyl]-1,4,8,11-tetrazacyclotetradecane;octahydrochloride Chemical compound Cl.Cl.Cl.Cl.Cl.Cl.Cl.Cl.C=1C=C(CN2CCNCCCNCCNCCC2)C=CC=1CN1CCCNCCNCCCNCC1 UEUPDYPUTTUXLJ-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 206010053759 Growth retardation Diseases 0.000 description 3
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 231100000001 growth retardation Toxicity 0.000 description 3
- 239000000411 inducer Substances 0.000 description 3
- 238000007914 intraventricular administration Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 239000011591 potassium Substances 0.000 description 3
- 229910052700 potassium Inorganic materials 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 230000001629 suppression Effects 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- PVTHJAPFENJVNC-UQTMRZPGSA-N 2-amino-2-[(2r,3s,5s,6r)-5-amino-2-methyl-6-[(2s,3s,5s,6r)-2,3,4,5,6-pentahydroxycyclohexyl]oxyoxan-3-yl]iminoacetic acid Chemical compound N[C@H]1C[C@H](N=C(N)C(O)=O)[C@@H](C)O[C@@H]1OC1[C@H](O)[C@@H](O)C(O)[C@H](O)[C@@H]1O PVTHJAPFENJVNC-UQTMRZPGSA-N 0.000 description 2
- PVTHJAPFENJVNC-UHFFFAOYSA-N 2-amino-2-[5-amino-2-methyl-6-(2,3,4,5,6-pentahydroxycyclohexyl)oxyoxan-3-yl]iminoacetic acid Chemical group NC1CC(N=C(N)C(O)=O)C(C)OC1OC1C(O)C(O)C(O)C(O)C1O PVTHJAPFENJVNC-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- 108700039655 Viroporin Proteins Proteins 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 239000000783 alginic acid Substances 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 229960001126 alginic acid Drugs 0.000 description 2
- 150000004781 alginic acids Chemical class 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 229940110456 cocoa butter Drugs 0.000 description 2
- 235000019868 cocoa butter Nutrition 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- MMXKVMNBHPAILY-UHFFFAOYSA-N ethyl laurate Chemical compound CCCCCCCCCCCC(=O)OCC MMXKVMNBHPAILY-UHFFFAOYSA-N 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- BOVGTQGAOIONJV-UHFFFAOYSA-N gliclazide Chemical compound C1=CC(C)=CC=C1S(=O)(=O)NC(=O)NN1CC2CCCC2C1 BOVGTQGAOIONJV-UHFFFAOYSA-N 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 206010022000 influenza Diseases 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- YBVNFKZSMZGRAD-UHFFFAOYSA-N pentamidine isethionate Chemical compound OCCS(O)(=O)=O.OCCS(O)(=O)=O.C1=CC(C(=N)N)=CC=C1OCCCCCOC1=CC=C(C(N)=N)C=C1 YBVNFKZSMZGRAD-UHFFFAOYSA-N 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 239000000196 tragacanth Substances 0.000 description 2
- 235000010487 tragacanth Nutrition 0.000 description 2
- 229940116362 tragacanth Drugs 0.000 description 2
- ZDRBJJNXJOSCLR-YZKQBBCCSA-N 2-amino-2-[(2r,3s,5s,6r)-5-amino-2-methyl-6-[(2r,3s,5s,6s)-2,3,4,5,6-pentahydroxycyclohexyl]oxyoxan-3-yl]iminoacetic acid;hydron;chloride Chemical compound Cl.N[C@H]1C[C@H](N=C(N)C(O)=O)[C@@H](C)O[C@@H]1OC1[C@H](O)[C@@H](O)C(O)[C@H](O)[C@@H]1O ZDRBJJNXJOSCLR-YZKQBBCCSA-N 0.000 description 1
- TUATYNXRYJTQTQ-BVRBKCERSA-N 3,6-diamino-n-[[(2s,5s,8z,11s,15s)-15-amino-11-(2-amino-1,4,5,6-tetrahydropyrimidin-6-yl)-8-[(carbamoylamino)methylidene]-2-(hydroxymethyl)-3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide;3,6-diamino-n-[[(2s,5s,8z,11s,15s)-15-a Chemical group OS(O)(=O)=O.OS(O)(=O)=O.N1C(=O)\C(=C\NC(N)=O)NC(=O)[C@H](CNC(=O)CC(N)CCCN)NC(=O)[C@H](C)NC(=O)[C@@H](N)CNC(=O)[C@@H]1C1NC(=N)NCC1.N1C(=O)\C(=C\NC(N)=O)NC(=O)[C@H](CNC(=O)CC(N)CCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CNC(=O)[C@@H]1C1NC(=N)NCC1 TUATYNXRYJTQTQ-BVRBKCERSA-N 0.000 description 1
- JNIIDKODPGHQSS-UHFFFAOYSA-N 3,6-diamino-n-[[15-amino-11-(2-amino-1,4,5,6-tetrahydropyrimidin-6-yl)-8-[(carbamoylamino)methylidene]-2-(hydroxymethyl)-3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide Chemical compound N1C(=O)C(=CNC(N)=O)NC(=O)C(CNC(=O)CC(N)CCCN)NC(=O)C(CO)NC(=O)C(N)CNC(=O)C1C1NC(N)=NCC1 JNIIDKODPGHQSS-UHFFFAOYSA-N 0.000 description 1
- ODKNJVUHOIMIIZ-UHFFFAOYSA-N 5-fluoro-1-[4-hydroxy-5-(hydroxymethyl)-2-oxolanyl]pyrimidine-2,4-dione Chemical compound C1C(O)C(CO)OC1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-UHFFFAOYSA-N 0.000 description 1
- 101000768957 Acholeplasma phage L2 Uncharacterized 37.2 kDa protein Proteins 0.000 description 1
- 101000823746 Acidianus ambivalens Uncharacterized 17.7 kDa protein in bps2 3'region Proteins 0.000 description 1
- 101000916369 Acidianus ambivalens Uncharacterized protein in sor 5'region Proteins 0.000 description 1
- 101000769342 Acinetobacter guillouiae Uncharacterized protein in rpoN-murA intergenic region Proteins 0.000 description 1
- 101000823696 Actinobacillus pleuropneumoniae Uncharacterized glycosyltransferase in aroQ 3'region Proteins 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 101000786513 Agrobacterium tumefaciens (strain 15955) Uncharacterized protein outside the virF region Proteins 0.000 description 1
- 101000618005 Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) Uncharacterized protein BpOF4_00885 Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100020724 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Human genes 0.000 description 1
- 101000967489 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) Uncharacterized protein AZC_3924 Proteins 0.000 description 1
- 101000823761 Bacillus licheniformis Uncharacterized 9.4 kDa protein in flaL 3'region Proteins 0.000 description 1
- 101000819719 Bacillus methanolicus Uncharacterized N-acetyltransferase in lysA 3'region Proteins 0.000 description 1
- 101000789586 Bacillus subtilis (strain 168) UPF0702 transmembrane protein YkjA Proteins 0.000 description 1
- 101000792624 Bacillus subtilis (strain 168) Uncharacterized protein YbxH Proteins 0.000 description 1
- 101000790792 Bacillus subtilis (strain 168) Uncharacterized protein YckC Proteins 0.000 description 1
- 101000819705 Bacillus subtilis (strain 168) Uncharacterized protein YlxR Proteins 0.000 description 1
- 101000948218 Bacillus subtilis (strain 168) Uncharacterized protein YtxJ Proteins 0.000 description 1
- 101000718627 Bacillus thuringiensis subsp. kurstaki Putative RNA polymerase sigma-G factor Proteins 0.000 description 1
- 241000008904 Betacoronavirus Species 0.000 description 1
- 101000641200 Bombyx mori densovirus Putative non-structural protein Proteins 0.000 description 1
- 101000947633 Claviceps purpurea Uncharacterized 13.8 kDa protein Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 101000948901 Enterobacteria phage T4 Uncharacterized 16.0 kDa protein in segB-ipI intergenic region Proteins 0.000 description 1
- 101000805958 Equine herpesvirus 4 (strain 1942) Virion protein US10 homolog Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 101000790442 Escherichia coli Insertion element IS2 uncharacterized 11.1 kDa protein Proteins 0.000 description 1
- 101000788354 Escherichia phage P2 Uncharacterized 8.2 kDa protein in gpA 5'region Proteins 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 101000770304 Frankia alni UPF0460 protein in nifX-nifW intergenic region Proteins 0.000 description 1
- 101000797344 Geobacillus stearothermophilus Putative tRNA (cytidine(34)-2'-O)-methyltransferase Proteins 0.000 description 1
- 101000748410 Geobacillus stearothermophilus Uncharacterized protein in fumA 3'region Proteins 0.000 description 1
- 101000772675 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) UPF0438 protein HI_0847 Proteins 0.000 description 1
- 101000631019 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uncharacterized protein HI_0350 Proteins 0.000 description 1
- 101000768938 Haemophilus phage HP1 (strain HP1c1) Uncharacterized 8.9 kDa protein in int-C1 intergenic region Proteins 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101000785414 Homo sapiens Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Proteins 0.000 description 1
- 101000782488 Junonia coenia densovirus (isolate pBRJ/1990) Putative non-structural protein NS2 Proteins 0.000 description 1
- 101000811523 Klebsiella pneumoniae Uncharacterized 55.8 kDa protein in cps region Proteins 0.000 description 1
- 101000818409 Lactococcus lactis subsp. lactis Uncharacterized HTH-type transcriptional regulator in lacX 3'region Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101000878851 Leptolyngbya boryana Putative Fe(2+) transport protein A Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 101000758828 Methanosarcina barkeri (strain Fusaro / DSM 804) Uncharacterized protein Mbar_A1602 Proteins 0.000 description 1
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 1
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 1
- 101001122401 Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) Non-structural protein ORF3 Proteins 0.000 description 1
- 101001055788 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) Pentapeptide repeat protein MfpA Proteins 0.000 description 1
- 101710193592 ORF3a protein Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 101000740670 Orgyia pseudotsugata multicapsid polyhedrosis virus Protein C42 Proteins 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 101000769182 Photorhabdus luminescens Uncharacterized protein in pnp 3'region Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 101000961392 Pseudescherichia vulneris Uncharacterized 29.9 kDa protein in crtE 3'region Proteins 0.000 description 1
- 101000731030 Pseudomonas oleovorans Poly(3-hydroxyalkanoate) polymerase 2 Proteins 0.000 description 1
- 101001065485 Pseudomonas putida Probable fatty acid methyltransferase Proteins 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- 101000711023 Rhizobium leguminosarum bv. trifolii Uncharacterized protein in tfuA 3'region Proteins 0.000 description 1
- 101000948156 Rhodococcus erythropolis Uncharacterized 47.3 kDa protein in thcA 5'region Proteins 0.000 description 1
- 101000917565 Rhodococcus fascians Uncharacterized 33.6 kDa protein in fasciation locus Proteins 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 101000790284 Saimiriine herpesvirus 2 (strain 488) Uncharacterized 9.5 kDa protein in DHFR 3'region Proteins 0.000 description 1
- 101000667983 Severe acute respiratory syndrome coronavirus Envelope small membrane protein Proteins 0.000 description 1
- 101000779243 Severe acute respiratory syndrome coronavirus ORF3a protein Proteins 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 101000936719 Streptococcus gordonii Accessory Sec system protein Asp3 Proteins 0.000 description 1
- 101000788499 Streptomyces coelicolor Uncharacterized oxidoreductase in mprA 5'region Proteins 0.000 description 1
- 101001102841 Streptomyces griseus Purine nucleoside phosphorylase ORF3 Proteins 0.000 description 1
- 101000708557 Streptomyces lincolnensis Uncharacterized 17.2 kDa protein in melC2-rnhH intergenic region Proteins 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 101000649826 Thermotoga neapolitana Putative anti-sigma factor antagonist TM1081 homolog Proteins 0.000 description 1
- 101000827562 Vibrio alginolyticus Uncharacterized protein in proC 3'region Proteins 0.000 description 1
- 101000778915 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Uncharacterized membrane protein VP2115 Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- 229960002968 capreomycin sulfate Drugs 0.000 description 1
- 125000001951 carbamoylamino group Chemical group C(N)(=O)N* 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 239000008406 cosmetic ingredient Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 235000019441 ethanol Nutrition 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- ALBYIUDWACNRRB-UHFFFAOYSA-N hexanamide Chemical compound CCCCCC(N)=O ALBYIUDWACNRRB-UHFFFAOYSA-N 0.000 description 1
- 235000014304 histidine Nutrition 0.000 description 1
- 150000002411 histidines Chemical class 0.000 description 1
- DKAGJZJALZXOOV-UHFFFAOYSA-N hydrate;hydrochloride Chemical compound O.Cl DKAGJZJALZXOOV-UHFFFAOYSA-N 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 239000013546 insoluble monolayer Substances 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000004973 liquid crystal related substance Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- VTHJTEIRLNZDEV-UHFFFAOYSA-L magnesium dihydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 1
- 239000000347 magnesium hydroxide Substances 0.000 description 1
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- LDDHMLJTFXJGPI-UHFFFAOYSA-N memantine hydrochloride Chemical group Cl.C1C(C2)CC3(C)CC1(C)CC2(N)C3 LDDHMLJTFXJGPI-UHFFFAOYSA-N 0.000 description 1
- 229960000967 memantine hydrochloride Drugs 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 230000002906 microbiologic effect Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 229960001624 pentamidine isethionate Drugs 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000012514 protein characterization Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 208000020029 respiratory tract infectious disease Diseases 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- FOGDPGQSHLLYIK-XYQGXRRISA-N spectinomycin dihydrochloride Chemical compound Cl.Cl.O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O FOGDPGQSHLLYIK-XYQGXRRISA-N 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000009447 viral pathogenesis Effects 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/155—Amidines (), e.g. guanidine (H2N—C(=NH)—NH2), isourea (N=C(OH)—NH2), isothiourea (—N=C(SH)—NH2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/357—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having two or more oxygen atoms in the same ring, e.g. crown ethers, guanadrel
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/365—Lactones
- A61K31/375—Ascorbic acid, i.e. vitamin C; Salts thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/433—Thidiazoles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/506—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/517—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/64—Sulfonylureas, e.g. glibenclamide, tolbutamide, chlorpropamide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7068—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
- A61K31/7072—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid having two oxo groups directly attached to the pyrimidine ring, e.g. uridine, uridylic acid, thymidine, zidovudine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7076—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7076—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid
- A61K31/708—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines containing purines, e.g. adenosine, adenylic acid having oxo groups directly attached to the purine ring system, e.g. guanosine, guanylic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Description
19 AGENTS CROSS REFERENCE TO RELATED APPLICATIONS id="p-1" id="p-1" id="p-1" id="p-1" id="p-1"
id="p-1"
[001] The present application claims the benefit of priority of U.S. Provisional Patent Application No. 63/018,598, titled "E PROTEIN CHANNEL BLOCKERS AS ANTI- COVID-19 AGENTS", filed May 1, 2020, and of U.S. Provisional Patent Application No. 63/117,619, titled "E PROTEIN CHANNEL BLOCKERS AND ORF3 INHIBITORS AS ANTI-COVID-19 AGENTS", filed November 24, 2020, the contents of both are incorporated herein by reference in their entirety.
FIELD OF INVENTION id="p-2" id="p-2" id="p-2" id="p-2" id="p-2"
id="p-2"
[002] The present invention is in the field of anti-viral therapy.
BACKGROUND id="p-3" id="p-3" id="p-3" id="p-3" id="p-3"
id="p-3"
[003] Coronaviruses are positive-sense, single-stranded RNA viruses that are often associated with mild respiratory tract infections in humans. However, three members of the family have received notoriety due to their abnormal virulence: SARS-CoV-1 was the etiological agent of the SARS epidemic in the winter of 2002/3 that caused 774 deaths amongst 8,098 cases; MERS-CoV was responsible for the MERS epidemic that started from 2012 with 862 deaths from 2506 infections; Finally, SARS-CoV-2 is responsible for the ongoing COVID-2019 pandemic resulting in 1.31 million deaths out of 54,068,330 cases (as of Sun Nov 15, 2020. id="p-4" id="p-4" id="p-4" id="p-4" id="p-4"
id="p-4"
[004] Genomic analyses have indicated that SARS-CoV-1 and SARS-CoV-2 are very similar to one another (ca. 80%) but are distinct from most other Coronaviridae members that infect humans. Both viruses have been placed in subgroup B in the Betacoronavirus genus within the Orthocoronavirinae subfamily of the Coronaviridae. id="p-5" id="p-5" id="p-5" id="p-5" id="p-5"
id="p-5"
[005] Of all coronavirus’ structural proteins, E is the least understood in terms of mechanism of action and structure. Functionally, the E protein has been implicated in viral assembly, release, and pathogenesis. Yet crucially, coronavirus E proteins are important for viral pathogenesis, and attenuated viruses lacking the protein have even been suggested to serve as vaccine candidates. 1 implicated in assembly of homotetrameric potassium sensitive ion channels (viroporin) and may modulate virus release. Additionally, it is implicated in pathogenesis, including up- regulation of expression of fibrinogen subunits FGA, FGB and FGG in host lung epithelial cells, inducement of apoptosis in cell culture.
SUMMARY id="p-7" id="p-7" id="p-7" id="p-7" id="p-7"
id="p-7"
[007] According to a first aspect, there is provided a method for treating or preventing SARS-CoV-2 virulence in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of any one of: SARS-CoV-2 E protein channel blocker and a SARS-CoV-2 3a protein inhibitor, thereby treating or preventing SARS-CoV-2 virulence in the subject. id="p-8" id="p-8" id="p-8" id="p-8" id="p-8"
id="p-8"
[008] According to another aspect, there is provided a pharmaceutical composition comprising a SARS-CoV-2 E protein channel blocker and/or SARS-CoV-2 3a protein inhibitor for use in the treatment or prevention of SARS-CoV-2 virulence in a subject in need thereof. id="p-9" id="p-9" id="p-9" id="p-9" id="p-9"
id="p-9"
[009] In some embodiments, preventing comprises preventing any one of: SARS-CoV-2 entry to a cell of the subject, uncoating of the SARS-CoV-2 in a cell of the subject, release of the SARS-CoV-2 from a cell of the subject, and any combination thereof. id="p-10" id="p-10" id="p-10" id="p-10" id="p-10"
id="p-10"
[010] In some embodiments, the subject is infected or suspected of being infected by SARS-CoV-2. id="p-11" id="p-11" id="p-11" id="p-11" id="p-11"
id="p-11"
[011] In some embodiments, the SARS-CoV-2 E protein channel blocker is at least one molecule selected from the group consisting of: 5-Azacytidine, Memantine, Gliclazide, Mavorixafor, Saroglitazar Magnesium, Mebrofenin, Cyclen, Kasugamycin, Plerixafor, and any salt thereof. id="p-12" id="p-12" id="p-12" id="p-12" id="p-12"
id="p-12"
[012] In some embodiments, the SARS-CoV-2 E protein channel blocker is for use at a daily dose of 0.01 to 500 mg/kg. id="p-13" id="p-13" id="p-13" id="p-13" id="p-13"
id="p-13"
[013] In some embodiments, the SARS-CoV-2 E protein channel blocker is Ginsenoside. id="p-14" id="p-14" id="p-14" id="p-14" id="p-14"
id="p-14"
[014] In some embodiments, the SARS-CoV-2 E protein channel blocker is Memantine. id="p-15" id="p-15" id="p-15" id="p-15" id="p-15"
id="p-15"
[015] In some embodiments, the SARS-CoV-2 3a protein inhibitor is at least one molecule selected from the group consisting of: Capreomycin, Pentamidine, Spectinomycin, Kasugamycin, Plerixafor, Flumatinib, Litronesib, Darapladib, Floxuridine, and Fludarabine. id="p-16" id="p-16" id="p-16" id="p-16" id="p-16"
id="p-16"
[016] In some embodiments, the SARS-CoV-2 3a protein inhibitor is Capreomycin. 2 CoV-2 entry to a cell of the subject, uncoating of the SARS-CoV-2, release of the SARS- CoV-2 from a cell of the subject, and any combination thereof. id="p-18" id="p-18" id="p-18" id="p-18" id="p-18"
id="p-18"
[018] Further embodiments and the full scope of applicability of the present invention will become apparent from the detailed description given hereinafter. However, it should be understood that the detailed description and specific examples, while indicating preferred embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
BRIEF DESCRIPTION OF THE AURES id="p-19" id="p-19" id="p-19" id="p-19" id="p-19"
id="p-19"
[019] Figures 1A-1B include graphs showing membrane permeabilization assay. Growth curves (n=2) of bacteria as a function of SARS-CoV-2 E protein expression (1A, right) or as a function of SARS-CoV-2 3a protein expression (1B). Bacteria that express the maltose binding protein without a conjugated viral ion channel are shown in the left panel as a negative control. Bacteria that express the influenza M2 viroporin, as a positive control, are shown at the centre. Induction at different IPTG concentrations (as noted), takes place when the bacteria density reaches an O.D.600 nm of 0.2. Growth O.D.600 nm values were collected every 15 min. Fig. 1B shows growth curves of bacteria as a function of SARS- CoV-3a protein expression. Negative control (no channel; NC); no drug (ND). + id="p-20" id="p-20" id="p-20" id="p-20" id="p-20"
id="p-20"
[020] Figures 2A-2B include graphs showing K conductivity assay. Impact of viral + protein SARS-CoV-2 E protein on the growth of K -uptake deficient bacteria (left panel, 2A). Different protein expression levels are achieved by varying the concentration of the + IPTG inducer, as noted. Bacterial growth rate as a function of [K ] is plotted in the right + panel (2A). (2B) depicts the impact of SARS CoV-2 3a protein on the growth of K -uptake deficient bacteria, using varying concentration of the IPTG inducer. + id="p-21" id="p-21" id="p-21" id="p-21" id="p-21"
id="p-21"
[021] Figures 3A-3B include graphs showing fluorescence-based H conductivity assay.
The fluorescence of bacteria that harbor pHluorin, a pH-sensitive GFP22, was examined as a function of SARS CoV-2 E protein expression (3A) or SARS CoV-2 3a protein expression (3B). Protein levels were governed by the level of the inducer (IPTG) as indicated. The results are an average of two independent experiments, with standard deviations depicted as error bars. id="p-22" id="p-22" id="p-22" id="p-22" id="p-22"
id="p-22"
[022] Figures 4A-4B include graphs showing compound screening results using the positive and negative genetic tests. Impact of different drugs, as noted, and E protein 3 2 E protein is expressed at an elevated level (40 M [IPTG]) and is therefore deleterious to bacteria. In this instance inhibitory drugs enhance bacterial growth. (4B) Positive genetic + test in which SARS-CoV-2 E protein is expressed at low level (10 M [IPTG]) in K -uptake deficient bacteria. In this instance inhibitory drugs reduce bacterial growth. In both panels the impact on growth in comparison to growth without any drug is listed. id="p-23" id="p-23" id="p-23" id="p-23" id="p-23"
id="p-23"
[023] Figures 5A-5C include graphs showing Mavorixafor screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (5A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (5B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (5C) of SARS-CoV-2 E protein expressing bacteria. id="p-24" id="p-24" id="p-24" id="p-24" id="p-24"
id="p-24"
[024] Figures 6A-6C include graphs showing Saroglitazar magnesium screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (6A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (6B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (6C) of SARS-CoV-2 E protein expressing bacteria. id="p-25" id="p-25" id="p-25" id="p-25" id="p-25"
id="p-25"
[025] Figures 7A-7C include graphs showing Mebrofenin screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (7A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (7B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (7C) of SARS-CoV-2 E protein expressing bacteria. id="p-26" id="p-26" id="p-26" id="p-26" id="p-26"
id="p-26"
[026] Figures 8A-8C include graphs showing Cyclen screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (8A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (8B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (8C) of SARS-CoV-2 E protein expressing bacteria. id="p-27" id="p-27" id="p-27" id="p-27" id="p-27"
id="p-27"
[027] Figures 9A-9C include graphs showing Kasugamycin screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (9A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (9B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (9C) of SARS-CoV-2 E protein expressing bacteria. id="p-28" id="p-28" id="p-28" id="p-28" id="p-28"
id="p-28"
[028] Figures 10A-10C include graphs showing 5-Azacytidine screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (10A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (10B), 4 fluorescence change (10C) of SARS-CoV-2 E protein expressing bacteria. id="p-29" id="p-29" id="p-29" id="p-29" id="p-29"
id="p-29"
[029] Figures 11A-11C include graphs showing Plerixafor (octahydrochloride) screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (11A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (11B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (11C) of SARS-CoV-2 E protein expressing bacteria. id="p-30" id="p-30" id="p-30" id="p-30" id="p-30"
id="p-30"
[030] Figures 12A-12C include graphs showing Plerixafor screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (12A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (12B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (12C) of SARS-CoV-2 E protein expressing bacteria. id="p-31" id="p-31" id="p-31" id="p-31" id="p-31"
id="p-31"
[031] Figures 13A-13C include graphs showing Capreomycin (sulfate) screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (13A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (13B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (13C) of SARS-CoV-2 E protein expressing bacteria. id="p-32" id="p-32" id="p-32" id="p-32" id="p-32"
id="p-32"
[032] Figures 14A-14C include graphs showing Pentamidine (isethionate) screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (14A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (14B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (14C) of SARS-CoV-2 3a protein expressing bacteria. id="p-33" id="p-33" id="p-33" id="p-33" id="p-33"
id="p-33"
[033] Figures 15A-15C include graphs showing Spectinomycin (dihydrochloride) screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (15A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (15B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (15C) of SARS-CoV-2 3a protein expressing bacteria. id="p-34" id="p-34" id="p-34" id="p-34" id="p-34"
id="p-34"
[034] Figures 16A-16C include graphs showing Kasugamycin (hydrochloride hydrate) screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (16A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (16B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (16C) of SARS-CoV-2 3a protein expressing bacteria. negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (17A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (17B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (17C) of SARS-CoV-2 3a protein expressing bacteria. id="p-36" id="p-36" id="p-36" id="p-36" id="p-36"
id="p-36"
[036] Figures 18A-18C include graphs showing Flumatinib screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (18A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (18B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (18C) of SARS-CoV-2 3a protein expressing bacteria. id="p-37" id="p-37" id="p-37" id="p-37" id="p-37"
id="p-37"
[037] Figures 19A-19C include graphs showing Litronesib screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (19A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (19B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (19C) of SARS-CoV-2 3a protein expressing bacteria. id="p-38" id="p-38" id="p-38" id="p-38" id="p-38"
id="p-38"
[038] Figures 20A-20C include graphs showing Darapladib screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (20A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (20B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (20C) of SARS-CoV-2 3a protein expressing bacteria. id="p-39" id="p-39" id="p-39" id="p-39" id="p-39"
id="p-39"
[039] Figures 21A-21C include graphs showing Floxuridine screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (21A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (21B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (21C) of SARS-CoV-2 3a protein expressing bacteria. id="p-40" id="p-40" id="p-40" id="p-40" id="p-40"
id="p-40"
[040] Figures 22A-22C include graphs showing Fludarabine screening results using the negative assay: Viral channel harmful to bacteria, wherein blocker increases growth (22A), positive assay: Viral channel essential to bacteria, wherein blocker decreases growth (22B), and fluorescence assay: Viral channel alters Fluorescence, wherein blocker decreases fluorescence change (22C) of SARS-CoV-2 3a protein expressing bacteria. id="p-41" id="p-41" id="p-41" id="p-41" id="p-41"
id="p-41"
[041] Figure 23 includes a vertical bar graph showing the effect of various tested drugs on the viability of Vero-E6 cells which were infected with SARS-CoV-2 at a multiplicity of infection (MOI) of 0.01. 6 id="p-42" id="p-42" id="p-42" id="p-42" id="p-42"
id="p-42"
[042] The present invention, in some embodiments, provides compositions comprising a SARS-CoV-2 E protein channel blocker and/or a SARS-CoV-2 3a protein inhibitor for treating or preventing SARS-CoV-2 virulence in a subject. The present invention, in some embodiments, provides compositions comprising a SARS-CoV-2 E protein channel blocker and/or a SARS-CoV-2 3a protein inhibitor, for preventing SARS-CoV-2 2 cell entry, uncoating and/or release from a cell.
SARS-CoV-2 E protein channel blockers id="p-43" id="p-43" id="p-43" id="p-43" id="p-43"
id="p-43"
[043] The invention is based, at least in part, on the finding using three bacteria-based assays, that SARS-CoV-2 E protein is an ion channel. The invention is further based, at least in part, on a finding that Gliclazide, Memantine, Mavorixafor, Saroglitazar Magnesium, Mebrofenin, Cyclen, Kasugamycin, Azacytidine, and Plerixafor, inhibit SARS-CoV-2 E protein and therefore can be used to treat and prevent SARS-CoV-2 virulence. id="p-44" id="p-44" id="p-44" id="p-44" id="p-44"
id="p-44"
[044] SARS-CoV-2 E protein is known to one skilled in the art and has a GenBank Accession no: QIH45055.1. According to some embodiments, the SARS-CoV-2 E protein comprises the amino acid sequence as set forth in SEQ ID NO 1: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFY VYSRVKNLNSSRVPDLLV. According to some embodiments, the SARS-CoV-2 E protein comprises an analog of SEQ ID NO: 1, such as an analog having at least 85%, at least 90%, at least 95% identity to SEQ ID NO: 1. id="p-45" id="p-45" id="p-45" id="p-45" id="p-45"
id="p-45"
[045] According to some embodiments, the invention provides a method of treating or preventing SARS-CoV-2 virulence in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a SARS-CoV-2 E protein channel blocker, thereby treating or preventing SARS-CoV-2 virulence in the subject. id="p-46" id="p-46" id="p-46" id="p-46" id="p-46"
id="p-46"
[046] In some embodiments, the invention provides a method of treating or preventing Coronavirus disease 2019 (COVID-19) in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a SARS-CoV-2 E protein channel blocker, thereby treating or preventing COVID-19. id="p-47" id="p-47" id="p-47" id="p-47" id="p-47"
id="p-47"
[047] According to some embodiments, the invention provides a method of preventing SARS-CoV-2 release from a cell. In some embodiments, the method comprises contacting a cell with a SARS-CoV-2 E protein channel blocker, thereby preventing SARS-CoV-2 release from the cell. 7 SARS-CoV-2 cell entry. In some embodiments, the method comprises contacting a cell with a SARS-CoV-2 E protein channel blocker, thereby preventing SARS-CoV-2 cell entry. id="p-49" id="p-49" id="p-49" id="p-49" id="p-49"
id="p-49"
[049] According to some embodiments, the invention provides a method of preventing SARS-CoV-2 uncoating. In some embodiments, the method comprises contacting a cell with a SARS-CoV-2 E protein channel blocker, thereby preventing SARS-CoV-2 uncoating. id="p-50" id="p-50" id="p-50" id="p-50" id="p-50"
id="p-50"
[050] According to some embodiments, a cell is a cell of a subject. According to some embodiments, contacting comprises administering to the subject. According to some embodiments, the subject is a subject infected or suspected as being infected by SARS-CoV- 2. id="p-51" id="p-51" id="p-51" id="p-51" id="p-51"
id="p-51"
[051] According to some embodiments, there is provided a method for treating or preventing SARS-CoV-2 virulence in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of 5-Azacytidine, thereby treating or preventing SARS-CoV-2 virulence in said subject. id="p-52" id="p-52" id="p-52" id="p-52" id="p-52"
id="p-52"
[052] According to some embodiments, there is provided a pharmaceutical composition comprising 5-Azacytidine, for use in the treatment and/or prevention of SARS-CoV-2 virulence in a subject in need thereof. id="p-53" id="p-53" id="p-53" id="p-53" id="p-53"
id="p-53"
[053] According to some embodiments, the SARS-CoV-2 E protein channel blocker is at least one molecule selected from: Memantine, Gliclazide, Mavorixafor, Saroglitazar Magnesium, Mebrofenin, Cyclen, Kasugamycin, Azacytidine, Plerixafor, or any salt thereof. id="p-54" id="p-54" id="p-54" id="p-54" id="p-54"
id="p-54"
[054] According to some embodiments, the invention provides a SARS-CoV-2 E protein channel blocker for use in treating or preventing SARS-CoV-2 virulence in a subject in need thereof. id="p-55" id="p-55" id="p-55" id="p-55" id="p-55"
id="p-55"
[055] According to some embodiments, the invention provides a SARS-CoV-2 E protein channel blocker for use in preventing SARS-CoV-2 release from a cell. id="p-56" id="p-56" id="p-56" id="p-56" id="p-56"
id="p-56"
[056] According to some embodiments, the SARS-CoV-2 E protein channel blocker is within a pharmaceutical composition. In some embodiments, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier. id="p-57" id="p-57" id="p-57" id="p-57" id="p-57"
id="p-57"
[057] According to some embodiments, the invention provides a pharmaceutical composition comprising Azacytidine, an analog or a salt thereof, for treating a viral infection. id="p-58" id="p-58" id="p-58" id="p-58" id="p-58"
id="p-58"
[058] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Azacytidine, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 E protein channel blocker is 5-Azacytidine. 8 ribofuranosyl-s-triazin-2(1H)-one), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. Azacytidine is described, for example in WO2012135405A1.
The terms "5-Azacytidine" and "Azacytidine" are used herein interchangeably. id="p-60" id="p-60" id="p-60" id="p-60" id="p-60"
id="p-60"
[060] According to some embodiments, the invention provides a pharmaceutical composition comprising Memantine, an analog or a salt thereof, for use in the treatment of a viral infection. In some embodiments, the viral infection comprises a coronaviruses infection. In some embodiments, the viral infection comprises an infection by virus having an E protein being an ion channel. In some embodiments, the viral infection is a coronaviruses infection. id="p-61" id="p-61" id="p-61" id="p-61" id="p-61"
id="p-61"
[061] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Memantine, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 E protein channel blocker is memantine hydrochloride. id="p-62" id="p-62" id="p-62" id="p-62" id="p-62"
id="p-62"
[062] Memantine, as used herein, includes memantine (CAS: 19982-08-2; 1-amino-3,5- dimethyladamantane), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. Memantine is described, for example, in U.S. Patents 3,391,142, ,891,885, 5,919,826, and 6,187,338. id="p-63" id="p-63" id="p-63" id="p-63" id="p-63"
id="p-63"
[063] According to some embodiments, the invention provides a pharmaceutical composition comprising Gliclazide, an analog or a salt thereof, for treating a viral infection.
In some embodiments, the viral infection is an infection by virus having an E protein being an ion channel. id="p-64" id="p-64" id="p-64" id="p-64" id="p-64"
id="p-64"
[064] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Gliclazide an analog or a salt thereof. id="p-65" id="p-65" id="p-65" id="p-65" id="p-65"
id="p-65"
[065] Gliclazide, as used herein, includes gliclazide (CAS: 21187-98-4; 1-(3- azabicyclo(3.3.0)oct-3-yl)-3-(p-tolylsulfonyl)urea) as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-66" id="p-66" id="p-66" id="p-66" id="p-66"
id="p-66"
[066] According to some embodiments, the SARS-CoV-2 E protein channel blocker is selected from a group including Ginsenoside. id="p-67" id="p-67" id="p-67" id="p-67" id="p-67"
id="p-67"
[067] According to some embodiments, the invention provides a pharmaceutical composition comprising Mavorixafor, an analog or a salt thereof, for treating a viral infection. 9 Mavorixafor, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 E protein channel blocker is Mavorixafor. id="p-69" id="p-69" id="p-69" id="p-69" id="p-69"
id="p-69"
[069] Mavorixafor, as used herein, includes Mavorixafor (CAS: 558447-26-0; N-(1H- benzimidazol-2-ylmethyl)-N-[(8S)-5,6,7,8-tetrahydroquinolin-8-yl]butane-1,4-diamine), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof.
Mavorixafor is described, for example, in U.S. Patent US7332605, and as compound 89 from a series of 169 analogues in WO2003055876. id="p-70" id="p-70" id="p-70" id="p-70" id="p-70"
id="p-70"
[070] According to some embodiments, the invention provides a pharmaceutical composition comprising Saroglitazar, an analog or a salt thereof, for treating a viral infection. id="p-71" id="p-71" id="p-71" id="p-71" id="p-71"
id="p-71"
[071] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Saroglitazar, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 E protein channel blocker is Saroglitazar Magnesium. id="p-72" id="p-72" id="p-72" id="p-72" id="p-72"
id="p-72"
[072] Saroglitazar, as used herein, includes Saroglitazar (CAS: 495399-09-2; (αS)-α- Ethoxy-4-[2-[2-methyl-5-[4-(methylthio)phenyl]-1H-pyrrol-1-yl]ethoxy]benzenepropanoic Acid), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof.
Saroglitazar is described, for example, in WO2016181409. id="p-73" id="p-73" id="p-73" id="p-73" id="p-73"
id="p-73"
[073] According to some embodiments, the invention provides a pharmaceutical composition comprising Mebrofenin, an analog or a salt thereof, for treating a viral infection. id="p-74" id="p-74" id="p-74" id="p-74" id="p-74"
id="p-74"
[074] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Mebrofenin, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 E protein channel blocker is Mebrofenin. id="p-75" id="p-75" id="p-75" id="p-75" id="p-75"
id="p-75"
[075] Mebrofenin, as used herein, includes Mebrofenin (CAS: 78266-06-5; 2-[[2-(3- bromo-2,4,6-trimethylanilino)-2-oxoethyl]-(carboxymethyl)amino]acetic acid), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. Mebrofenin is described, for example, in US9,878,984. id="p-76" id="p-76" id="p-76" id="p-76" id="p-76"
id="p-76"
[076] According to some embodiments, the invention provides a pharmaceutical composition comprising Cyclen, an analog or a salt thereof, for treating a viral infection. id="p-77" id="p-77" id="p-77" id="p-77" id="p-77"
id="p-77"
[077] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Cyclen, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 E protein channel blocker is Cyclen.
Tetraazacyclododecane), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. Cyclen is described, for example in US9421223B2. id="p-79" id="p-79" id="p-79" id="p-79" id="p-79"
id="p-79"
[079] According to some embodiments, the invention provides a pharmaceutical composition comprising Kasugamycin, an analog or a salt thereof, for treating a viral infection. id="p-80" id="p-80" id="p-80" id="p-80" id="p-80"
id="p-80"
[080] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Kasugamycin, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 E protein channel blocker is Kasugamycin hydrochloride hydrate (CAS: 19408-46-9). id="p-81" id="p-81" id="p-81" id="p-81" id="p-81"
id="p-81"
[081] Kasugamycin, as used herein, includes Kasugamycin (CAS: 6980-18-3; 2-amino-2- [(2R,3S,5S,6R)-5-amino-2-methyl-6-[(2R,3S,5S,6S)-2,3,4,5,6- pentahydroxycyclohexyl]oxyoxan-3-yl]iminoacetic acid), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. Kasugamycin is described, for example in US3358001A. id="p-82" id="p-82" id="p-82" id="p-82" id="p-82"
id="p-82"
[082] According to some embodiments, the invention provides a pharmaceutical composition comprising Plerixafor, an analog or a salt thereof, for treating a viral infection. id="p-83" id="p-83" id="p-83" id="p-83" id="p-83"
id="p-83"
[083] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Plerixafor, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 E protein channel blocker is Plerixafor octahydrochloride. id="p-84" id="p-84" id="p-84" id="p-84" id="p-84"
id="p-84"
[084] Plerixafor, as used herein, includes Plerixafor (CAS: 155148-31-5; 1-[[4-(1,4,8,11- tetrazacyclotetradec-1-ylmethyl)phenyl]methyl]-1,4,8,11-tetrazacyclotetradecane), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. Plerixafor is described, for example in WO2014125499A1.
SARS-CoV-2 3a protein inhibitor id="p-85" id="p-85" id="p-85" id="p-85" id="p-85"
id="p-85"
[085] The invention is based, at least in part, on the finding using three bacteria-based assays, that SARS-CoV-2 3a protein inhibitors can serve as effective agents for treating and preventing SARS-CoV-2 virulence. id="p-86" id="p-86" id="p-86" id="p-86" id="p-86"
id="p-86"
[086] SARS-CoV-2 3a protein, also known as open reading frame 3a (ORF3a), is known to one skilled in the art and has a UniProt Accession no: P0DTC3. id="p-87" id="p-87" id="p-87" id="p-87" id="p-87"
id="p-87"
[087] The terms "3a protein" and "ORF3a" are used herein interchangeably. id="p-88" id="p-88" id="p-88" id="p-88" id="p-88"
id="p-88"
[088] According to some embodiments, the SARS-CoV-2 3a protein comprises the amino acid sequence as set forth in SEQ ID NO 2: MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQ 11 FLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVIT SGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVE HVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL According to some embodiments, the SARS-CoV-2 3a protein comprises an analog of SEQ ID NO: 2, such as an analog having at least 85%, at least 90%, at least 95% identity to SEQ ID NO: 2. id="p-89" id="p-89" id="p-89" id="p-89" id="p-89"
id="p-89"
[089] According to some embodiments, the invention provides a method of treating or preventing SARS-CoV-2 virulence in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a SARS-CoV-2 3a protein inhibitor, thereby treating or preventing SARS-CoV-2 virulence in the subject. id="p-90" id="p-90" id="p-90" id="p-90" id="p-90"
id="p-90"
[090] In some embodiments, the invention provides a method of treating or preventing Coronavirus disease 2019 (COVID-19) in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a SARS-CoV-2 3a protein inhibitor, thereby treating or preventing COVID-19. id="p-91" id="p-91" id="p-91" id="p-91" id="p-91"
id="p-91"
[091] According to some embodiments, the invention provides a method of preventing SARS-CoV-2 release from a cell, the method comprising contacting the cell with a SARS- CoV-2 3a protein inhibitor, thereby preventing SARS-CoV-2 release from the cell. id="p-92" id="p-92" id="p-92" id="p-92" id="p-92"
id="p-92"
[092] According to some embodiments, the method comprising contacting the cell with a SARS-CoV-2 3a protein inhibitor, thereby preventing SARS-CoV-2 cell entry. id="p-93" id="p-93" id="p-93" id="p-93" id="p-93"
id="p-93"
[093] In some embodiments, the method comprising contacting the cell with a SARS-CoV- 2 3a protein inhibitor, thereby preventing SARS-CoV-2 uncoating. id="p-94" id="p-94" id="p-94" id="p-94" id="p-94"
id="p-94"
[094] According to some embodiments, the subject is a subject infected or suspected as being infected by SARS-CoV-2. id="p-95" id="p-95" id="p-95" id="p-95" id="p-95"
id="p-95"
[095] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is at least one molecule selected from: Capreomycin, Pentamidine, Spectinomycin, Kasugamycin, Plerixafor, Flumatinib, Litronesib, Darapladib, Floxuridine, Fludarabine, or salts thereof. id="p-96" id="p-96" id="p-96" id="p-96" id="p-96"
id="p-96"
[096] According to some embodiments, the invention provides a SARS-CoV-2 3a protein inhibitor for use in the treatment or prevention of SARS-CoV-2 virulence, in a subject in need thereof. id="p-97" id="p-97" id="p-97" id="p-97" id="p-97"
id="p-97"
[097] According to some embodiments, the invention provides a SARS-CoV-2 3a protein inhibitor for use in the prevention of SARS-CoV-2 release from a cell. id="p-98" id="p-98" id="p-98" id="p-98" id="p-98"
id="p-98"
[098] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is within a pharmaceutical composition. 12 id="p-100" id="p-100" id="p-100" id="p-100" id="p-100"
id="p-100"
[0100] According to some embodiments, the invention provides a pharmaceutical composition comprising Capreomycin, an analog or a salt thereof, for treating a viral infection. id="p-101" id="p-101" id="p-101" id="p-101" id="p-101"
id="p-101"
[0101] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Capreomycin, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 3a protein inhibitor is Capreomycin sulfate. id="p-102" id="p-102" id="p-102" id="p-102" id="p-102"
id="p-102"
[0102] Capreomycin, as used herein, includes Capreomycin (CAS: 11003-38-6; IUPAC: (3S)-3,6-diamino-N-[[(2S,5S,8E,11S,15S)-15-amino-11-[(4R)-2-amino-3,4,5,6- tetrahydropyrimidin-4-yl]-8-[(carbamoylamino)methylidene]-2-(hydroxymethyl)- 3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide; (3S)-3,6- diamino-N-[[(2S,5S,8E,11S,15S)-15-amino-11-[(4R)-2-amino-3,4,5,6- tetrahydropyrimidin-4-yl]-8-[(carbamoylamino)methylidene]-2-methyl-3,6,9,12,16- pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-103" id="p-103" id="p-103" id="p-103" id="p-103"
id="p-103"
[0103] According to some embodiments, the invention provides a pharmaceutical composition comprising Pentamidine, an analog or a salt thereof, for treating a viral infection. id="p-104" id="p-104" id="p-104" id="p-104" id="p-104"
id="p-104"
[0104] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Pentamidine, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 3a protein inhibitor is Pentamidine isethionate. id="p-105" id="p-105" id="p-105" id="p-105" id="p-105"
id="p-105"
[0105] Pentamidine, as used herein, includes Pentamidine (CAS: 100-33-4; IUPAC: 4,4'- [pentane-1,5-diylbis(oxy)]dibenzenecarboximidamide), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-106" id="p-106" id="p-106" id="p-106" id="p-106"
id="p-106"
[0106] According to some embodiments, the invention provides a pharmaceutical composition comprising Spectinomycin, an analog or a salt thereof, for treating a viral infection. id="p-107" id="p-107" id="p-107" id="p-107" id="p-107"
id="p-107"
[0107] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Spectinomycin, an analog or a salt thereof. According to some embodiments, the SARS- CoV-2 3a protein inhibitor is Spectinomycin dihydrochloride. id="p-108" id="p-108" id="p-108" id="p-108" id="p-108"
id="p-108"
[0108] Spectinomycin, as used herein, includes Spectinomycin (CAS: 1695-77-8; IUPAC: 1R,3S,5R,8R,10S,11S,12S,13R,14S)-8,12,14-trihydroxy-5-methyl-11,13- 13 pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-109" id="p-109" id="p-109" id="p-109" id="p-109"
id="p-109"
[0109] According to some embodiments, the invention provides a pharmaceutical composition comprising Kasugamycin, an analog or a salt thereof, for treating a viral infection. id="p-110" id="p-110" id="p-110" id="p-110" id="p-110"
id="p-110"
[0110] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Kasugamycin, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 3a protein inhibitor is Kasugamycin hydrochloride hydrate. id="p-111" id="p-111" id="p-111" id="p-111" id="p-111"
id="p-111"
[0111] Kasugamycin, as used herein, includes Kasugamycin (CAS:6980-18-3; IUPAC: 2- amino-2-[(2R,3S,5S,6R)-5-amino-2-methyl-6-[(2R,3S,5S,6S)-2,3,4,5,6- pentahydroxycyclohexyl]oxyoxan-3-yl]iminoacetic acid), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-112" id="p-112" id="p-112" id="p-112" id="p-112"
id="p-112"
[0112] According to some embodiments, the invention provides a pharmaceutical composition comprising Plerixafor, an analog or a salt thereof, for treating a viral infection. id="p-113" id="p-113" id="p-113" id="p-113" id="p-113"
id="p-113"
[0113] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Plerixafor, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Plerixafor. id="p-114" id="p-114" id="p-114" id="p-114" id="p-114"
id="p-114"
[0114] Plerixafor, as used herein, includes Plerixafor (CAS: 155148-31-5; IUPAC: 1,1’- (1,4-phenylenebismethylene)bis(1,4,8,11- tetraazacyclotetradecane)), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-115" id="p-115" id="p-115" id="p-115" id="p-115"
id="p-115"
[0115] According to some embodiments, the invention provides a pharmaceutical composition comprising Flumatinib, an analog or a salt thereof, for treating a viral infection. id="p-116" id="p-116" id="p-116" id="p-116" id="p-116"
id="p-116"
[0116] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Flumatinib, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Flumatinib. id="p-117" id="p-117" id="p-117" id="p-117" id="p-117"
id="p-117"
[0117] Flumatinib, as used herein, includes Flumatinib (CAS: 895519-90-1; IUPAC: 4-[(4- methylpiperazin-1-yl)methyl]-N-[6-methyl-5-[(4-pyridin-3-ylpyrimidin-2- yl)amino]pyridin-3-yl]-3-(trifluoromethyl)benzamide), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-118" id="p-118" id="p-118" id="p-118" id="p-118"
id="p-118"
[0118] According to some embodiments, the invention provides a pharmaceutical composition comprising Litronesib, an analog or a salt thereof, for treating a viral infection. 14 Litronesib, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Litronesib. id="p-120" id="p-120" id="p-120" id="p-120" id="p-120"
id="p-120"
[0120] Litronesib, as used herein, includes Litronesib (CAS: 910634-41-2; IUPAC: N- [(5R)-4-(2,2-dimethylpropanoyl)-5-[[2-(ethylamino)ethylsulfonylamino]methyl]-5-phenyl- 1,3,4-thiadiazol-2-yl]-2,2-dimethylpropanamide), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-121" id="p-121" id="p-121" id="p-121" id="p-121"
id="p-121"
[0121] According to some embodiments, the invention provides a pharmaceutical composition comprising Darapladib, an analog or a salt thereof, for treating a viral infection. id="p-122" id="p-122" id="p-122" id="p-122" id="p-122"
id="p-122"
[0122] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Darapladib, an analog or a salt thereof. According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Darapladib. id="p-123" id="p-123" id="p-123" id="p-123" id="p-123"
id="p-123"
[0123] Darapladib, as used herein, includes Darapladib (CAS: 356057-34-6; IUPAC: N-(2- Diethylaminoethyl)-2-[2-[(4-fluorophenyl)methylsulfanyl]-4-oxo-6,7-dihydro-5H- cyclopenta[d]pyrimidin-1-yl]-N-[[4-[4-(trifluoromethyl)phenyl]phenyl]methyl]acetamide), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-124" id="p-124" id="p-124" id="p-124" id="p-124"
id="p-124"
[0124] According to some embodiments, the invention provides a pharmaceutical composition comprising Floxuridine, an analog or a salt thereof, for treating a viral infection. id="p-125" id="p-125" id="p-125" id="p-125" id="p-125"
id="p-125"
[0125] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Floxuridine, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 3a protein inhibitor is Floxuridine. id="p-126" id="p-126" id="p-126" id="p-126" id="p-126"
id="p-126"
[0126] Floxuridine, as used herein, includes Floxuridine (CAS: 50-91-9; IUPAC: 5-Fluoro- 1-[4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl]-1H-pyrimidine-2,4-dione), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-127" id="p-127" id="p-127" id="p-127" id="p-127"
id="p-127"
[0127] According to some embodiments, the invention provides a pharmaceutical composition comprising Fludarabine, an analog or a salt thereof, for treating a viral infection. id="p-128" id="p-128" id="p-128" id="p-128" id="p-128"
id="p-128"
[0128] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Fludarabine, an analog or a salt thereof. According to some embodiments, the SARS-CoV- 2 3a protein inhibitor is Fludarabine. id="p-129" id="p-129" id="p-129" id="p-129" id="p-129"
id="p-129"
[0129] Fludarabine, as used herein, includes Fludarabine (CAS: 21679-14-1; IUPAC: [(2R,3S,4S,5R)-5-(6-amino-2-fluoro-purin-9-yl)- 3,4-dihydroxy-oxolan-2- yl]methoxyphosphonic acid), as well as pharmaceutically acceptable salts, solvates, hydrates, or mixtures thereof. id="p-130" id="p-130" id="p-130" id="p-130" id="p-130"
id="p-130"
[0130] As used herein, the terms "treatment" or "treating" of a disease, disorder, or condition encompasses alleviation of at least one symptom thereof, a reduction in the severity thereof, or inhibition of the progression thereof. Treatment need not mean that the disease, disorder, or condition is totally cured. To be an effective treatment, a useful composition herein needs only to reduce the severity of a disease, disorder, or condition, reduce the severity of symptoms associated therewith, or provide improvement to a patient or subject’s quality of life. id="p-131" id="p-131" id="p-131" id="p-131" id="p-131"
id="p-131"
[0131] As used herein, the term "prevention" of a disease, disorder, or condition encompasses the delay, prevention, suppression, or inhibition of the onset of a disease, disorder, or condition. As used in accordance with the presently described subject matter, the term "prevention" relates to a process of prophylaxis in which a subject is exposed to the presently described compositions or formulations prior to the induction or onset of the disease/disorder process. The term "suppression" is used to describe a condition wherein the disease/disorder process has already begun but obvious symptoms of the condition have yet to be realized. Thus, the cells of an individual may have the disease/disorder, but no outside signs of the disease/disorder have yet been clinically recognized. In either case, the term prophylaxis can be applied to encompass both prevention and suppression. Conversely, the term "treatment" refers to the clinical application of active agents to combat an already existing condition whose clinical presentation has already been realized in a patient. id="p-132" id="p-132" id="p-132" id="p-132" id="p-132"
id="p-132"
[0132] In some embodiments, preventing comprises reducing the disease severity, delaying the disease onset, reducing the disease cumulative incidence, or any combination thereof. id="p-133" id="p-133" id="p-133" id="p-133" id="p-133"
id="p-133"
[0133] As used herein, the terms "administering," "administration," and like terms refer to any method which, in sound medical practice, delivers a composition containing an active agent to a subject in such a manner as to provide a therapeutic effect. id="p-134" id="p-134" id="p-134" id="p-134" id="p-134"
id="p-134"
[0134] As used herein, the terms "subject" or "individual" or "animal" or "patient" or "mammal," refers to any subject, particularly a mammalian subject, for whom therapy is desired, for example, a human. id="p-135" id="p-135" id="p-135" id="p-135" id="p-135"
id="p-135"
[0135] In some embodiments, a therapeutically effective dose of the composition of the invention is administered. The term "therapeutically effective amount" refers to an amount of a drug effective to treat a disease or disorder in a mammal. The term "a therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. The exact dosage form and regimen would be determined by the physician according to the patient's condition. 16 recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired. The route of administration of the pharmaceutical compositions will depend on the disease or condition to be treated. Suitable routes of administration include, but are not limited to, parenteral injections, e.g., intradermal, intravenous, intramuscular, intralesional, subcutaneous, intrathecal, and any other mode of injection as known in the art.
Although the bioavailability of peptides administered by other routes can be lower than when administered via parenteral injection, by using appropriate compositions it is envisaged that it will be possible to administer the compositions of the invention via transdermal, oral, rectal, vaginal, topical, nasal, inhalation and ocular modes of treatment. In addition, it may be desirable to introduce the pharmaceutical compositions of the invention by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir. id="p-137" id="p-137" id="p-137" id="p-137" id="p-137"
id="p-137"
[0137] In some embodiments, the composition of the invention is delivered orally. In some embodiments, the composition of the invention is an oral composition. In some embodiments, the composition of the invention further comprises orally acceptable carrier, excipient, or a diluent. id="p-138" id="p-138" id="p-138" id="p-138" id="p-138"
id="p-138"
[0138] According to some embodiments, the active agents of the invention (e.g., SARS- CoV-2 E protein channel blocker or protein 3a inhibiter) is for use at a daily dose of 0.01 to 500 mg/kg. id="p-139" id="p-139" id="p-139" id="p-139" id="p-139"
id="p-139"
[0139] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Memantine or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 50 mg/day, about 1 mg/day and 45 mg/day, and 5 mg/day and 3 5mg/day. id="p-140" id="p-140" id="p-140" id="p-140" id="p-140"
id="p-140"
[0140] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Gliclazide or a salt thereof and is for use at a daily dose of between about 1 mg/day and 350 mg/day, 10 mg/day and 350 mg/day, 50 mg/day and 350 mg/day, 1 mg/day and 300 mg/day, mg/day and 300 mg/day, and 50 mg/day and 250 mg/day. id="p-141" id="p-141" id="p-141" id="p-141" id="p-141"
id="p-141"
[0141] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Mavorixafor or a salt thereof and is for use at a daily dose of between about 50 mg/day and about 100 mg/day, about 50 mg/day and 200 mg/day, and 50 mg/day and 400 mg/day. id="p-142" id="p-142" id="p-142" id="p-142" id="p-142"
id="p-142"
[0142] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Saroglitazar or a salt thereof and is for use at a daily dose of between about 0.1 mg/day and about 5 mg/day, about 1 mg/day and 4 mg/day, and 1.5 mg/day and 4.5 mg/day. 17 Mebrofenin or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 50 mg/day, about 1 mg/day and 45 mg/day, and 5 mg/day and 35 mg/day. id="p-144" id="p-144" id="p-144" id="p-144" id="p-144"
id="p-144"
[0144] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Cyclen or a salt thereof and is for use at a daily dose of between about 0.01 mg/day and about 0.5 mg/day, about 0.1 mg/day and 0.5mg/day, and 0.05 mg/day and 0.3 mg/day. id="p-145" id="p-145" id="p-145" id="p-145" id="p-145"
id="p-145"
[0145] According to some embodiments, the SARS-CoV-2 E protein channel blocker, the SARS-CoV-2 3a protein inhibitor, or both is Kasugamycin or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 500 mg/day, about 5 mg/day and 250mg/day, and 10 mg/day and 350 mg/day. id="p-146" id="p-146" id="p-146" id="p-146" id="p-146"
id="p-146"
[0146] According to some embodiments, the SARS-CoV-2 E protein channel blocker is Azacytidine or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 100 mg/day, about 1 mg/day and 200 mg/day, and 1 mg/day and 300 mg/day. id="p-147" id="p-147" id="p-147" id="p-147" id="p-147"
id="p-147"
[0147] According to some embodiments, the SARS-CoV-2 E protein channel blocker, the SARS-CoV-2 3a protein inhibitor, or both is Plerixafor or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 50 mg/day, about 1 mg/day and 45 mg/day, and 5 mg/day and 35 mg/day. id="p-148" id="p-148" id="p-148" id="p-148" id="p-148"
id="p-148"
[0148] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Capreomycin or a salt thereof and is for use at a daily dose of between about 50 mg/day and about 1,000 mg/day, about 10 mg/day and 700 mg/day, and 20 mg/day and 800 mg/day. id="p-149" id="p-149" id="p-149" id="p-149" id="p-149"
id="p-149"
[0149] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Pentamidine or a salt thereof and is for use at a daily dose of between about 50 mg/day and about 500 mg/day, about 30 mg/day and 400 mg/day, and 100 mg/day and 300 mg/day. id="p-150" id="p-150" id="p-150" id="p-150" id="p-150"
id="p-150"
[0150] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Spectinomycin or a salt thereof and is for use at a daily dose of between about 500 mg/day and about 5,000 mg/day, about 250 mg/day and 2,500 mg/day, and 100 mg/day and 4,500 mg/day. id="p-151" id="p-151" id="p-151" id="p-151" id="p-151"
id="p-151"
[0151] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Flumatinib or a salt thereof and is for use at a daily dose of between about 50 mg/day and about 1,000 mg/day, about 100 mg/day and 1,500 mg/day, and 50 mg/day and 5,000 mg/day. id="p-152" id="p-152" id="p-152" id="p-152" id="p-152"
id="p-152"
[0152] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Litronesib or a salt thereof and is for use at a daily dose of between about 10 mg/day and about 3,000 mg/day, about 50 mg/day and 2,500 mg/day, and 20 mg/day and 2,000 mg/day. 18 Darapladib or a salt thereof and is for use at a daily dose of between about 10 mg/day and about 1,000 mg/day, about 50 mg/day and 500 mg/day, and 100 mg/day and 800 mg/day. id="p-154" id="p-154" id="p-154" id="p-154" id="p-154"
id="p-154"
[0154] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Floxuridine or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 100 mg/day, about 5 mg/day and 80 mg/day, and 10 mg/day and 100 mg/day. id="p-155" id="p-155" id="p-155" id="p-155" id="p-155"
id="p-155"
[0155] According to some embodiments, the SARS-CoV-2 3a protein inhibitor is Fludarabine or a salt thereof and is for use at a daily dose of between about 1 mg/day and about 100 mg/day, about 2 mg/day and 80 mg/day, and 5 mg/day and 60 mg/day. id="p-156" id="p-156" id="p-156" id="p-156" id="p-156"
id="p-156"
[0156] In some embodiments, the pharmaceutical composition comprises a pharmaceutically acceptable carrier, adjuvant or excipient. id="p-157" id="p-157" id="p-157" id="p-157" id="p-157"
id="p-157"
[0157] As used herein, the term "carrier," "adjuvant" or "excipient" refers to any component of a pharmaceutical composition that is not the active agent. As used herein, the term "pharmaceutically acceptable carrier" refers to non-toxic, inert solid, semi-solid liquid filler, diluent, encapsulating material, formulation auxiliary of any type, or simply a sterile aqueous medium, such as saline. Some examples of the materials that can serve as pharmaceutically acceptable carriers are sugars, such as lactose, glucose and sucrose, starches such as corn starch and potato starch, cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt, gelatin, talc; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol, polyols such as glycerin, sorbitol, mannitol and polyethylene glycol; esters such as ethyl oleate and ethyl laurate, agar; buffering agents such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline, Ringer's solution; ethyl alcohol and phosphate buffer solutions, as well as other non-toxic compatible substances used in pharmaceutical formulations. Some non-limiting examples of substances which can serve as a carrier herein include sugar, starch, cellulose and its derivatives, powered tragacanth, malt, gelatin, talc, stearic acid, magnesium stearate, calcium sulfate, vegetable oils, polyols, alginic acid, pyrogen-free water, isotonic saline, phosphate buffer solutions, cocoa butter (suppository base), emulsifier as well as other non-toxic pharmaceutically compatible substances used in other pharmaceutical formulations. Wetting agents and lubricants such as sodium lauryl sulfate, as well as coloring agents, flavoring agents, excipients, stabilizers, antioxidants, and preservatives may also be present. Any non- toxic, inert, and effective carrier may be used to formulate the compositions contemplated 19 are well known to those of skill in the art, such as those described in The Merck Index, Thirteenth Edition, Budavari et al., Eds., Merck & Co., Inc., Rahway, N.J. (2001); the CTFA (Cosmetic, Toiletry, and Fragrance Association) International Cosmetic Ingredient Dictionary and Handbook, Tenth Edition (2004); and the "Inactive Ingredient Guide," U.S.
Food and Drug Administration (FDA) Center for Drug Evaluation and Research (CDER) Office of Management, the contents of all of which are hereby incorporated by reference in their entirety. Examples of pharmaceutically acceptable excipients, carriers and diluents useful in the present compositions include distilled water, physiological saline, Ringer's solution, dextrose solution, Hank's solution, and DMSO. These additional inactive components, as well as effective formulations and administration procedures, are well known in the art and are described in standard textbooks, such as Goodman and Gillman’s: The Pharmacological Bases of Therapeutics, 8th Ed., Gilman et al. Eds. Pergamon Press (1990); Remington’s Pharmaceutical Sciences, 18th Ed., Mack Publishing Co., Easton, Pa. (1990); and Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott Williams & Wilkins, Philadelphia, Pa., (2005), each of which is incorporated by reference herein in its entirety. The presently described composition may also be contained in artificially created structures such as liposomes, ISCOMS, slow-releasing particles, and other vehicles which increase the half-life of the peptides or polypeptides in serum.
Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. Liposomes for use with the presently described peptides are formed from standard vesicle-forming lipids which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally determined by considerations such as liposome size and stability in the blood. A variety of methods are available for preparing liposomes as reviewed, for example, by Coligan, J. E. et al, Current Protocols in Protein Science, 1999, John Wiley & Sons, Inc., New York, and see also U.S. Pat. Nos. 4,235,871, 4,501,728, 4,837,028, and 5,019,369. id="p-158" id="p-158" id="p-158" id="p-158" id="p-158"
id="p-158"
[0158] The carrier may comprise, in total, from about 0.1% to about 99.99999% by weight of the pharmaceutical compositions presented herein.
Screening assays id="p-159" id="p-159" id="p-159" id="p-159" id="p-159"
id="p-159"
[0159] According to some embodiments, there is provided a method of screening effectiveness of an agent in treating or preventing a coronavirus infection, the method comprising providing a cell comprising a membrane permeabilized coronavirus E or 3a protein, contacting the cell with the agent, and determining effect of the agent on growth of as being effective for treating or preventing a coronavirus infection, thereby screening effectiveness of an agent in treating or preventing a coronavirus infection. id="p-160" id="p-160" id="p-160" id="p-160" id="p-160"
id="p-160"
[0160] In some embodiments, the method is a negative assay. In some embodiments, the cell is charecterized by growth retardation due to the membrane permeabilized E protein or 3a protein. In some emobodemts, an agent that alleviates growth retardation is indicative as being effective for treating or preventing a coronavirus infection. id="p-161" id="p-161" id="p-161" id="p-161" id="p-161"
id="p-161"
[0161] In some embodiments, the method is a positive assay. In some embodiments, the cell + + is a K -uptake deficient cell grown in low [K ] media experience growth, due to the channel formed by the E protein or 3a protein. In some emobodemts, an agent that induces growth retardation is indicative as being effective for treating or preventing a coronavirus infection. id="p-162" id="p-162" id="p-162" id="p-162" id="p-162"
id="p-162"
[0162] In some embodiments, the coronavirus is SARS-CoV. In some embodiments, SARS- CoV is any one of SARS-CoV-1 and SARS-CoV-2. In some embodiments, the coronavirus E protein or 3a protein is a SARS-CoV-1 E protein or 3a protein, respectively. In some embodiments, the coronavirus E protein or 3a protein is a SARS-CoV-2 E protein, or 3a protein, respectively. id="p-163" id="p-163" id="p-163" id="p-163" id="p-163"
id="p-163"
[0163] In some embodiments, the method comprises performing both the negative assay and the positive assay. id="p-164" id="p-164" id="p-164" id="p-164" id="p-164"
id="p-164"
[0164] In some embodiments, the cell is a bacterial cell. In some embodiments, the cell is devoid of endogenous potassium uptake, besides an exogenously provided (e.g., expressed) membrane permeabilized SARS-CoV E protein or by the 3a protein. id="p-165" id="p-165" id="p-165" id="p-165" id="p-165"
id="p-165"
[0165] Non-limiting examples for growing a bacterial cell applicable for the screening methods provided herein, include: Astrahan, P. et al., Acta 1808, 394–8 (2011); Santner, P. et al. Biochemistry 57, 5949–5956 (2018), and Taube, R., Alhadeff, R., Assa, D., Krugliak, M. & Arkin, I. T. PLoS One 9, e105387 (2014). id="p-166" id="p-166" id="p-166" id="p-166" id="p-166"
id="p-166"
[0166] In some embodiment, the assay is for determining susceptibility of the virus to develop resistance against the agent. id="p-167" id="p-167" id="p-167" id="p-167" id="p-167"
id="p-167"
[0167] As used herein, the term "about" when combined with a value refers to plus and minus 10% of the reference value. For example, a length of about 1,000 nanometers (nm) refers to a length of 1000 nm ± 100 nm. id="p-168" id="p-168" id="p-168" id="p-168" id="p-168"
id="p-168"
[0168] It is noted that as used herein and in the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "a polynucleotide" includes a plurality of such polynucleotides and 21 equivalents thereof known to those skilled in the art, and so forth. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as "solely," "only" and the like in connection with the recitation of claim elements or use of a "negative" limitation. id="p-169" id="p-169" id="p-169" id="p-169" id="p-169"
id="p-169"
[0169] In those instances where a convention analogous to "at least one of A, B, and C, etc." is used, in general such a construction is intended in the sense one having skill in the art would understand the convention (e.g., "a system having at least one of A, B, and C" would include but not be limited to systems that have A alone, B alone, C alone, A and B together, A and C together, B and C together, and/or A, B, and C together, etc.). It will be further understood by those within the art that virtually any disjunctive word and/or phrase presenting two or more alternative terms, whether in the description, claims, or drawings, should be understood to contemplate the possibilities of including one of the terms, either of the terms, or both terms. For example, the phrase "A or B" will be understood to include the possibilities of "A" or "B" or "A and B." id="p-170" id="p-170" id="p-170" id="p-170" id="p-170"
id="p-170"
[0170] It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable sub-combination. All combinations of the embodiments pertaining to the invention are specifically embraced by the present invention and are disclosed herein just as if each and every combination was individually and explicitly disclosed. In addition, all sub- combinations of the various embodiments and elements thereof are also specifically embraced by the present invention and are disclosed herein just as if each and every such sub-combination was individually and explicitly disclosed herein. id="p-171" id="p-171" id="p-171" id="p-171" id="p-171"
id="p-171"
[0171] Additional objects, advantages, and novel features of the present invention will become apparent to one ordinarily skilled in the art upon examination of the following examples, which are not intended to be limiting. Additionally, each of the various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below finds experimental support in the following examples. id="p-172" id="p-172" id="p-172" id="p-172" id="p-172"
id="p-172"
[0172] Various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below find experimental support in the following examples. 22 id="p-173" id="p-173" id="p-173" id="p-173" id="p-173"
id="p-173"
[0173] Generally, the nomenclature used herein, and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, "Molecular Cloning: A laboratory Manual" Sambrook et al., (1989); "Current Protocols in Molecular Biology" Volumes I-III Ausubel, R. M., ed. (1994); Ausubel et al., "Current Protocols in Molecular Biology", John Wiley and Sons, Baltimore, Maryland (1989); Perbal, "A Practical Guide to Molecular Cloning", John Wiley & Sons, New York (1988); Watson et al., "Recombinant DNA", Scientific American Books, New York; Birren et al. (eds) "Genome Analysis: A Laboratory Manual Series", Vols. 1-4, Cold Spring Harbor Laboratory Press, New York (1998); methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057; "Cell Biology: A Laboratory Handbook", Volumes I-III Cellis, J. E., ed. (1994); "Culture of Animal Cells - A Manual of Basic Technique" by Freshney, Wiley-Liss, N. Y. (1994), Third Edition; "Current Protocols in Immunology" Volumes I-III Coligan J. E., ed. (1994); Stites et al. (eds), "Basic and Clinical Immunology" (8th Edition), Appleton & Lange, Norwalk, CT (1994); Mishell and Shiigi (eds), "Strategies for Protein Purification and Characterization - A Laboratory Course Manual" CSHL Press (1996); all of which are incorporated by reference. Other general references are provided throughout this document.
Materials and Methods Bacterial strains id="p-174" id="p-174" id="p-174" id="p-174" id="p-174"
id="p-174"
[0174] Three strains of K12 Escherichia coli were used in the current study: DH10B, LB650, and LR1. DH10B cells were purchased from Invitrogen (Carlsbad, CA). LB650 bacteria (ΔtrkG, ΔtrkH, and ΔkdpABC5 system) contain deletions in genes connected to potassium uptake (Stumpe, S. & Bakker, E. P. Arch Microbiol 167, 126–36 (1997)). LR1 bacteria contained a chromosomal copy of a pH sensitive green fluorescence protein (GFP) called pHluorin (Miesenböck, G and De Angelis, D A and Rothman, J E. Nature 394, 192– (1998)).
Plasmids id="p-175" id="p-175" id="p-175" id="p-175" id="p-175"
id="p-175"
[0175] The SARS-CoV-2 E protein, 3a protein, and the influenza M2 channel were expressed as fusion proteins to the maltose binding protein using the pMAL-p2X plasmid (New England Biolabs, Ipswich, MA). Genes for the viral proteins have been added with a nucleotide sequence coding for linker of seven amino-acids, six histidines, and a stop codon at the 3’ end. EcoRI and XbaI restriction sites were located at the 5’ and 3’ ends, respectively. 23 achieved by adding isopropyl
Claims (14)
1. A method for treating or preventing SARS-CoV-2 virulence in a subject in need thereof, comprising administering to said subject a therapeutically effective amount of any one of: SARS-CoV-2 E protein channel blocker and a SARS-CoV-2 3a protein inhibitor, thereby treating or preventing SARS-CoV-2 virulence in said subject.
2. The method of claim 1, wherein said preventing comprises preventing any one of: SARS-CoV-2 entry to a cell of said subject, uncoating of said SARS-CoV-2 in a cell of said subject, release of said SARS-CoV-2 from a cell of said subject, and any combination thereof.
3. The method of claim 1 or 2, wherein said subject is infected or suspected of being infected by SARS-CoV-2.
4. The method of any one of claims 1 to 3, wherein said SARS-CoV-2 E protein channel blocker is at least one molecule selected from the group consisting of: 5-Azacytidine, Memantine, Gliclazide, Mavorixafor, Saroglitazar Magnesium, Mebrofenin, Cyclen, Kasugamycin, Plerixafor, and any salt thereof.
5. The method of any one of claims 1 to 4, wherein said SARS-CoV-2 E protein channel blocker is for use at a daily dose of 0.01 to 500 mg/kg.
6. The method of any one of claims 1 to 5, wherein said SARS-CoV-2 E protein channel blocker is Ginsenoside.
7. The method of any one of claims 1 to 5, wherein said SARS-CoV-2 E protein channel blocker is Memantine.
8. The method of any one of claims 1 to 7, wherein said SARS-CoV-2 3a protein inhibitor is at least one molecule selected from the group consisting of: Capreomycin, Pentamidine, Spectinomycin, Kasugamycin, Plerixafor, Flumatinib, Litronesib, Darapladib, Floxuridine, and Fludarabine.
9. The method of claim 8, wherein said SARS-CoV-2 3a protein inhibitor is Capreomycin. 29
10. A pharmaceutical composition comprising a SARS-CoV-2 E protein channel blocker and/or SARS-CoV-2 3a protein inhibitor for use in the treatment or prevention of SARS-CoV- 2 virulence in a subject in need thereof.
11. The pharmaceutical composition of claim 10, wherein said prevention comprises prevention of any one of: SARS-CoV-2 entry to a cell of said subject, uncoating of said SARS- CoV-2, release of said SARS-CoV-2 from a cell of said subject, and any combination thereof.
12. The pharmaceutical composition of claim 10 or 11, wherein said SARS-CoV-2 E protein channel blocker is at least one molecule selected from the group consisting of: 5- Azacytidine Memantine, Gliclazide, Mavorixafor, Saroglitazar Magnesium, Mebrofenin, Cyclen, Kasugamycin, Plerixafor, and any salt thereof.
13. The pharmaceutical composition of claim 10 or 11, wherein said SARS-CoV-2 E protein channel blocker is Ginsenoside.
14. The pharmaceutical composition of any one of claims 10 to 13, wherein said SARS- CoV-2 3a protein inhibitor is at least one molecule selected from the group consisting of: Capreomycin, Pentamidine, Spectinomycin, Kasugamycin, Plerixafor, Flumatinib, Litronesib, Darapladib, Floxuridine, and Fludarabine. 30
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063018598P | 2020-05-01 | 2020-05-01 | |
US202063117619P | 2020-11-24 | 2020-11-24 | |
PCT/IL2021/050501 WO2021220284A1 (en) | 2020-05-01 | 2021-05-02 | E protein channel blockers and orf3 inhibitors as anti-covid-19 agents |
Publications (1)
Publication Number | Publication Date |
---|---|
IL297852A true IL297852A (en) | 2023-01-01 |
Family
ID=76375375
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
IL297852A IL297852A (en) | 2020-05-01 | 2021-05-02 | E protein channel blockers and orf3 inhibitors as anti-covid-19 agents |
Country Status (10)
Country | Link |
---|---|
EP (1) | EP4142702A1 (en) |
JP (1) | JP2023524522A (en) |
KR (1) | KR20230035524A (en) |
CN (1) | CN115867265A (en) |
AU (1) | AU2021265602A1 (en) |
BR (1) | BR112022022243A2 (en) |
CA (1) | CA3177537A1 (en) |
IL (1) | IL297852A (en) |
MX (1) | MX2022013744A (en) |
WO (1) | WO2021220284A1 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117942341A (en) * | 2022-10-27 | 2024-04-30 | 北京化工大学 | Application of isoquinoline alkaloid in prevention and treatment of coronavirus |
Family Cites Families (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1094566A (en) | 1963-12-28 | 1967-12-13 | Zh Biseibutsu Kagaku Kenkyukai | Kasugamycin and processes for the preparation thereof |
US3391142A (en) | 1966-02-09 | 1968-07-02 | Lilly Co Eli | Adamantyl secondary amines |
US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
US4666828A (en) | 1984-08-15 | 1987-05-19 | The General Hospital Corporation | Test for Huntington's disease |
US5019369A (en) | 1984-10-22 | 1991-05-28 | Vestar, Inc. | Method of targeting tumors in humans |
US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
US4801531A (en) | 1985-04-17 | 1989-01-31 | Biotechnology Research Partners, Ltd. | Apo AI/CIII genomic polymorphisms predictive of atherosclerosis |
US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
US5272057A (en) | 1988-10-14 | 1993-12-21 | Georgetown University | Method of detecting a predisposition to cancer by the use of restriction fragment length polymorphism of the gene for human poly (ADP-ribose) polymerase |
US5192659A (en) | 1989-08-25 | 1993-03-09 | Genetype Ag | Intron sequence analysis method for detection of adjacent and remote locus alleles as haplotypes |
WO1998007447A1 (en) | 1996-08-23 | 1998-02-26 | Algos Pharmaceutical Corporation | Anticonvulsant containing composition for treating neuropathic pain |
US5891885A (en) | 1996-10-09 | 1999-04-06 | Algos Pharmaceutical Corporation | Method for treating migraine |
US5919826A (en) | 1996-10-24 | 1999-07-06 | Algos Pharmaceutical Corporation | Method of alleviating pain |
US20030220341A1 (en) | 2001-12-21 | 2003-11-27 | Gary Bridger | Chemokine receptor binding heterocyclic compounds with enhanced efficacy |
EP1730113B1 (en) | 2004-03-15 | 2016-12-28 | Genzyme Corporation | Process for the synthesis of a cxcr4 antagonist |
US20070196428A1 (en) | 2006-02-17 | 2007-08-23 | Thierry Glauser | Nitric oxide generating medical devices |
WO2009089537A2 (en) | 2008-01-11 | 2009-07-16 | Northwestern University | Anti-cancer compounds |
MX2013010945A (en) | 2011-03-31 | 2014-03-12 | Celgene Internat Sarl | Systhesis of 5-azacytidine. |
WO2014125499A1 (en) | 2013-02-13 | 2014-08-21 | Natco Pharma Limited | Improved and commercially viable process for the preparation of high pure plerixafor base |
US20180125816A1 (en) | 2015-05-11 | 2018-05-10 | Cadila Healthcare Limited | Saroglitazar magnesium for the treatment of chylomicronemia syndrome |
CN111773282A (en) * | 2020-06-09 | 2020-10-16 | 广东金骏康生物技术有限公司 | Medicine and food dual purpose Chinese medicinal preparation and its application |
-
2021
- 2021-05-02 CA CA3177537A patent/CA3177537A1/en active Pending
- 2021-05-02 JP JP2022566682A patent/JP2023524522A/en active Pending
- 2021-05-02 MX MX2022013744A patent/MX2022013744A/en unknown
- 2021-05-02 EP EP21731597.7A patent/EP4142702A1/en active Pending
- 2021-05-02 CN CN202180046512.XA patent/CN115867265A/en active Pending
- 2021-05-02 WO PCT/IL2021/050501 patent/WO2021220284A1/en unknown
- 2021-05-02 KR KR1020227042356A patent/KR20230035524A/en active Search and Examination
- 2021-05-02 IL IL297852A patent/IL297852A/en unknown
- 2021-05-02 AU AU2021265602A patent/AU2021265602A1/en active Pending
- 2021-05-02 BR BR112022022243A patent/BR112022022243A2/en unknown
Also Published As
Publication number | Publication date |
---|---|
JP2023524522A (en) | 2023-06-12 |
AU2021265602A1 (en) | 2023-01-19 |
EP4142702A1 (en) | 2023-03-08 |
WO2021220284A1 (en) | 2021-11-04 |
CA3177537A1 (en) | 2021-11-04 |
CN115867265A (en) | 2023-03-28 |
BR112022022243A2 (en) | 2022-12-20 |
KR20230035524A (en) | 2023-03-14 |
MX2022013744A (en) | 2023-01-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Jing et al. | p-Cresyl sulfate is associated with carotid arteriosclerosis in hemodialysis patients and promotes atherogenesis in apoE−/− mice | |
Chaudhary et al. | Lipoic acid decreases inflammation and confers neuroprotection in experimental autoimmune optic neuritis | |
JP2018508569A (en) | Compounds and uses in the treatment of aging-related conditions | |
IL295459A (en) | Methods of treating tuberous sclerosis complex with cannabidiol and everolimus | |
IL293572A (en) | Methods of treatment using ilt7 binding proteins | |
Wang et al. | Intramuscular delivery of p75 NTR ectodomain by an AAV vector attenuates cognitive deficits and Alzheimer's disease‐like pathologies in APP/PS 1 transgenic mice | |
Pan et al. | Hydroxysafflor yellow A suppresses MRC-5 cell activation induced by TGF-β1 by blocking TGF-β1 binding to TβRII | |
IL297852A (en) | E protein channel blockers and orf3 inhibitors as anti-covid-19 agents | |
IL301910A (en) | Synthetic transdermal cannabidiol for the treatment of focal epilepsy in adults | |
IL298145A (en) | Combination treatment of liver disorders | |
IL257458B2 (en) | Dpep-1 binding compositions and methods of use | |
Liu et al. | Natural product piperine alleviates experimental allergic encephalomyelitis in mice by targeting dihydroorotate dehydrogenase | |
AU2023202231A1 (en) | New use of R- salbutamol for treatment of inflammatory bowel disease and its extra intestinal manifestations | |
IL261340B2 (en) | Method and composition for treating cancer or skin lesion using a vaccine | |
Machaczka et al. | Unexpected cure from cutaneous leukocytoclastic vasculitis in a patient treated with N-butyldeoxynojirimycin (miglustat) for Gaucher disease | |
TW202310842A (en) | Treatment of his hyporesponders | |
US20230190769A1 (en) | E protein channel blockers and orf3 inhibitors as anti-covid-19 agents | |
IL293160A (en) | Methods of treating hiv-1 infection | |
WO2023144830A1 (en) | Zika m protein blockers as anti-zika virus agents | |
JP2021533158A (en) | How to carry out treatment | |
IL299793A (en) | Methods for treating acute respiratory inflammatory conditions and cytokine storm syndrome | |
TWI737972B (en) | Method and kit for myocardial reperfusion, and method for attenuating or reducing myocardial reperfusion injury | |
WO2022113069A1 (en) | E protein channel blockers and orf3 inhibitors as anti-covid-19 agents | |
Duell et al. | Complementary role of evinacumab in combination with lipoprotein apheresis in patients with homozygous familial hypercholesterolemia | |
JP2014526440A (en) | Use of HDL-related molecules for the treatment and prevention of pro-inflammatory conditions |