FR2839452A1 - USE OF PEPTIDE DERIVED FROM THE HCG BETA SUBUNIT TO GENERATE A CTL ANTITUMOR RESPONSE - Google Patents
USE OF PEPTIDE DERIVED FROM THE HCG BETA SUBUNIT TO GENERATE A CTL ANTITUMOR RESPONSE Download PDFInfo
- Publication number
- FR2839452A1 FR2839452A1 FR0205691A FR0205691A FR2839452A1 FR 2839452 A1 FR2839452 A1 FR 2839452A1 FR 0205691 A FR0205691 A FR 0205691A FR 0205691 A FR0205691 A FR 0205691A FR 2839452 A1 FR2839452 A1 FR 2839452A1
- Authority
- FR
- France
- Prior art keywords
- peptide
- sequence
- peptides
- use according
- hcg
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 263
- 230000006023 anti-tumor response Effects 0.000 title description 2
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 96
- 150000001413 amino acids Chemical class 0.000 claims abstract description 49
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 claims abstract description 33
- 108010078791 Carrier Proteins Proteins 0.000 claims abstract description 27
- 102000014914 Carrier Proteins Human genes 0.000 claims abstract description 27
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 20
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 15
- 238000002360 preparation method Methods 0.000 claims abstract description 11
- 239000000203 mixture Substances 0.000 claims abstract description 10
- 230000002265 prevention Effects 0.000 claims abstract description 7
- 239000003550 marker Substances 0.000 claims abstract description 6
- 239000003814 drug Substances 0.000 claims abstract description 5
- 229960005486 vaccine Drugs 0.000 claims abstract description 5
- 230000000259 anti-tumor effect Effects 0.000 claims abstract description 4
- 239000012634 fragment Substances 0.000 claims description 58
- 210000004027 cell Anatomy 0.000 claims description 51
- 235000001014 amino acid Nutrition 0.000 claims description 50
- 229940024606 amino acid Drugs 0.000 claims description 50
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 35
- 108090000623 proteins and genes Proteins 0.000 claims description 30
- 150000001875 compounds Chemical class 0.000 claims description 15
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 11
- 235000018102 proteins Nutrition 0.000 claims description 11
- 102000004169 proteins and genes Human genes 0.000 claims description 11
- 108091054437 MHC class I family Proteins 0.000 claims description 10
- 102000043129 MHC class I family Human genes 0.000 claims description 9
- 230000005847 immunogenicity Effects 0.000 claims description 8
- 230000001580 bacterial effect Effects 0.000 claims description 7
- 239000002671 adjuvant Substances 0.000 claims description 5
- 239000013598 vector Substances 0.000 claims description 5
- 230000036039 immunity Effects 0.000 claims description 4
- LQRJAEQXMSMEDP-XCHBZYMASA-N peptide a Chemical class N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)NCCCC[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)C(\NC(=O)[C@@H](CCCCN)NC(=O)CNC(C)=O)=C/C=1C=CC=CC=1)C(N)=O)C(=O)C(\NC(=O)[C@@H](CCCCN)NC(=O)CNC(C)=O)=C\C1=CC=CC=C1 LQRJAEQXMSMEDP-XCHBZYMASA-N 0.000 claims description 4
- 230000003612 virological effect Effects 0.000 claims description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 3
- 108010052285 Membrane Proteins Proteins 0.000 claims description 3
- 108010079246 OMPA outer membrane proteins Proteins 0.000 claims description 3
- 150000002632 lipids Chemical class 0.000 claims description 3
- 239000002502 liposome Substances 0.000 claims description 3
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 claims description 3
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 2
- 102000002812 Heat-Shock Proteins Human genes 0.000 claims description 2
- 108010004889 Heat-Shock Proteins Proteins 0.000 claims description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 claims description 2
- 230000013595 glycosylation Effects 0.000 claims description 2
- 238000006206 glycosylation reaction Methods 0.000 claims description 2
- 239000003981 vehicle Substances 0.000 claims description 2
- 230000009885 systemic effect Effects 0.000 claims 1
- 230000028993 immune response Effects 0.000 abstract description 9
- 229940088597 hormone Drugs 0.000 abstract description 7
- 239000005556 hormone Substances 0.000 abstract description 7
- 102000006771 Gonadotropins Human genes 0.000 abstract description 2
- 108010086677 Gonadotropins Proteins 0.000 abstract description 2
- 239000002622 gonadotropin Substances 0.000 abstract description 2
- 230000001404 mediated effect Effects 0.000 abstract description 2
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 19
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 15
- 241000699670 Mus sp. Species 0.000 description 12
- 230000004044 response Effects 0.000 description 11
- 201000011510 cancer Diseases 0.000 description 9
- 238000005859 coupling reaction Methods 0.000 description 9
- 230000008878 coupling Effects 0.000 description 8
- 238000010168 coupling process Methods 0.000 description 8
- 230000009089 cytolysis Effects 0.000 description 8
- 238000000034 method Methods 0.000 description 8
- 238000004873 anchoring Methods 0.000 description 7
- 230000001472 cytotoxic effect Effects 0.000 description 7
- 239000012636 effector Substances 0.000 description 7
- 230000006698 induction Effects 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- -1 Fmoc amino acid Chemical class 0.000 description 6
- 108010074328 Interferon-gamma Proteins 0.000 description 6
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 6
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 5
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 5
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 5
- 230000000875 corresponding effect Effects 0.000 description 5
- 231100000433 cytotoxic Toxicity 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 238000004007 reversed phase HPLC Methods 0.000 description 5
- DTQVDTLACAAQTR-UHFFFAOYSA-N trifluoroacetic acid Substances OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- 102100037850 Interferon gamma Human genes 0.000 description 4
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 230000007402 cytotoxic response Effects 0.000 description 4
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 230000002269 spontaneous effect Effects 0.000 description 4
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 125000004213 tert-butoxy group Chemical group [H]C([H])([H])C(O*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 230000014509 gene expression Effects 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 238000011830 transgenic mouse model Methods 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 2
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000305071 Enterobacterales Species 0.000 description 2
- 239000007821 HATU Substances 0.000 description 2
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- 241000588747 Klebsiella pneumoniae Species 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- 102000009151 Luteinizing Hormone Human genes 0.000 description 2
- 108010073521 Luteinizing Hormone Proteins 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 108010004469 allophycocyanin Proteins 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 229920002866 paraformaldehyde Polymers 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 230000001817 pituitary effect Effects 0.000 description 2
- 230000003169 placental effect Effects 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 239000011550 stock solution Substances 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- DYWUPCCKOVTCFZ-LBPRGKRZSA-N (2s)-2-amino-3-[1-[(2-methylpropan-2-yl)oxycarbonyl]indol-3-yl]propanoic acid Chemical compound C1=CC=C2N(C(=O)OC(C)(C)C)C=C(C[C@H](N)C(O)=O)C2=C1 DYWUPCCKOVTCFZ-LBPRGKRZSA-N 0.000 description 1
- DHBXNPKRAUYBTH-UHFFFAOYSA-N 1,1-ethanedithiol Chemical compound CC(S)S DHBXNPKRAUYBTH-UHFFFAOYSA-N 0.000 description 1
- JMTMSDXUXJISAY-UHFFFAOYSA-N 2H-benzotriazol-4-ol Chemical compound OC1=CC=CC2=C1N=NN2 JMTMSDXUXJISAY-UHFFFAOYSA-N 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 206010060999 Benign neoplasm Diseases 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 1
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 1
- 101000582320 Homo sapiens Neurogenic differentiation factor 6 Proteins 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 241000234435 Lilium Species 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 206010064912 Malignant transformation Diseases 0.000 description 1
- 206010061309 Neoplasm progression Diseases 0.000 description 1
- 102100030589 Neurogenic differentiation factor 6 Human genes 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 241000237988 Patellidae Species 0.000 description 1
- 102000006877 Pituitary Hormones Human genes 0.000 description 1
- 108010047386 Pituitary Hormones Proteins 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007365 Sialoglycoproteins Human genes 0.000 description 1
- 108010032838 Sialoglycoproteins Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- KQNZDYYTLMIZCT-KQPMLPITSA-N brefeldin A Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](O)C[C@H]21 KQNZDYYTLMIZCT-KQPMLPITSA-N 0.000 description 1
- JUMGSHROWPPKFX-UHFFFAOYSA-N brefeldin-A Natural products CC1CCCC=CC2(C)CC(O)CC2(C)C(O)C=CC(=O)O1 JUMGSHROWPPKFX-UHFFFAOYSA-N 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 208000023965 endometrium neoplasm Diseases 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 210000000609 ganglia Anatomy 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-L glutamate group Chemical class N[C@@H](CCC(=O)[O-])C(=O)[O-] WHUUTDBJXJRKMK-VKHMYHEASA-L 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000023560 heart growth Effects 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 239000000960 hypophysis hormone Substances 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 229940040129 luteinizing hormone Drugs 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 230000036212 malign transformation Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000004976 peripheral blood cell Anatomy 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 230000035935 pregnancy Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000003257 protein preparation method Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 108010055094 transporter associated with antigen processing (TAP) Proteins 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 125000002221 trityl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C([*])(C1=C(C(=C(C(=C1[H])[H])[H])[H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 208000029387 trophoblastic neoplasm Diseases 0.000 description 1
- 230000005751 tumor progression Effects 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/59—Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g.hCG [human chorionic gonadotropin]; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Endocrinology (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Toxicology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Reproductive Health (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
L'invention concerne l'utilisation de peptides d'au moins 8 acides aminés dérivés de la sous-unité ß de l'hormone chorionique gonadotropine humaine, notée ci-après β-hCG, pour la préparation d'une composition pharmaceutique destinée à générer une réponse immunitaire médiée par des lymphocytes T cytotoxiques. L'invention concerne également l'utilisation de tels peptides, notamment mélangés ou couplés à une protéine porteuse pour la préparation d'une composition vaccinale destinée à la prévention ou le traitement des cancers exprimant le marqueur hCG. L'invention a également pour objet de tels peptides, notamment à titre de médicament antitumoral.The invention relates to the use of peptides of at least 8 amino acids derived from the β subunit of the chorionic hormone human gonadotropin, hereinafter β-hCG, for the preparation of a pharmaceutical composition intended for generating an immune response mediated by cytotoxic T cells. The invention also relates to the use of such peptides, in particular mixed or coupled to a carrier protein for the preparation of a vaccine composition intended for the prevention or treatment of cancers expressing the hCG marker. A subject of the invention is also such peptides, in particular as an anti-tumor medicament.
Description
<Desc/Clms Page number 1> <Desc / Clms Page number 1>
L'invention concerne l'utilisation de peptides d'au moins 8 acides aminés dérivés de la sous-unité (3 de l'hormone chorionique gonadotropine humaine, notée ciaprès p-hCG, pour la préparation d'une composition pharmaceutique destinée à générer une réponse immunitaire médiée par des lymphocytes T cytotoxiques. L'invention concerne également l'utilisation de tels peptides, notamment mélangés ou couplés à une protéine porteuse pour la préparation d'une composition vaccinale destinée à la prévention ou le traitement des cancers exprimant le marqueur hCG. L'invention a également pour objet de tels peptides, notamment à titre de médicament antitumoral. The invention relates to the use of peptides of at least 8 amino acids derived from the subunit (3) of human chorionic gonadotropin hormone, hereinafter referred to as p-hCG, for the preparation of a pharmaceutical composition intended to generate a Immune response mediated by cytotoxic T lymphocytes The invention also relates to the use of such peptides, in particular mixed or coupled to a carrier protein for the preparation of a vaccine composition intended for the prevention or treatment of cancers expressing the hCG marker. The subject of the invention is also such peptides, especially as an antitumoral medicament.
La vaccination est un moyen efficace de prévenir ou de réduire les infections virales ou bactériennes. Le succès des campagnes de vaccination dans ce domaine a permis d'étendre le concept de vaccin dans le domaine des maladies auto-immunes et du cancer. Vaccination is an effective way to prevent or reduce viral or bacterial infections. The success of vaccination campaigns in this area has helped to expand the concept of vaccine in the field of autoimmune diseases and cancer.
L'hCG est une hormone dimérique qui appartient à la super famille des facteurs de croissance à coeur cystéine (TGF(3, NGF, PDGFp) et à la famille des gonadotropines. HCG is a dimeric hormone that belongs to the super family of cysteine heart growth factors (TGF (3, NGF, PDGFp) and the gonadotropin family.
Cette famille comprend d'une part les hormones pituitaires LH (luteinizing hormone ou interstitial cell stimulating hormone) et FSH (folliculestimulating hormone ou follitropin) responsables de la stimulation des fonctions testiculaires et ovariennes, et d'autre part, les hormones d'origine placentaire, parmi lesquelles l'hCG synthétisée durant la grossesse et dont le rôle physiologique est de maintenir la croissance du corpus luteus fonctionnel. This family includes on the one hand the pituitary hormones LH (luteinizing hormone or interstitial cell stimulating hormone) and FSH (Folliculestimulating hormone or follitropin) responsible for the stimulation of testicular and ovarian functions, and secondly, the hormones of placental origin , including hCG synthesized during pregnancy and whose physiological role is to maintain the growth of the functional luteus corpus.
Toutes ces hormones, malgré la diversité de leurs fonctions physiologiques, sont proches de par leur structure et consistent en deux chaînes ou sous-unités a ou (3 glycosylées à des sites spécifiques et reliées par des ponts disulfures. Au sein d'une espèce donnée, la séquence de la sous-unité a est fondamentalement identique pour l'ensemble de ces hormones. L'activité hormonale de ces hybrides [alpha]ss est dictée par la particularité de la sous-unité ss. All these hormones, despite the diversity of their physiological functions, are structurally close and consist of two α or β-glycosylated chains or subunits at specific sites and linked by disulfide bridges within a given species. The sequence of the α subunit is basically identical for all of these hormones.The hormonal activity of these [alpha] ss hybrids is dictated by the particularity of the ss subunit.
Outre son origine placentaire, une localisation pituitaire a été montrée pour l'hCG ou des molécules hCG-like. Cette source pituitaire (Hoermann et coll., J. In addition to its placental origin, a pituitary localization has been shown for hCG or hCG-like molecules. This pituitary source (Hoermann et al., J.
Endocrinal Metab., 71:179-186, 1990) pourrait être à l'origine des très faibles concentrations de matériel "hCG like" présent dans le sérum d'individus sains des deux Endocrine Metab., 71: 179-186, 1990) could be the cause of the very low concentrations of "hCG like" material present in the serum of healthy individuals of both.
<Desc/Clms Page number 2><Desc / Clms Page number 2>
sexes (Odell et coll., N. Engl. J. Med., 317 :1688-1691, Odell et coll., J. Clin. sexes (Odell et al., N. Engl J. Med., 317: 1688-1691, Odell et al., J. Clin.
Endocrinol. Metab., 71 :1318-1321, Par ailleurs, l'hCG et ses fragments semblent être des produits de la transformation maligne. En effet, alors que les néoplasmes bénins n'expriment pas, ou ne produisent pas, ce genre de matériel, plusieurs auteurs ont montré que les tumeurs malignes, mais également les cellules embryonnaires et foetales, expriment l'hCG in vivo et in vitro. Il a été observé qu'une immunoréactivité envers l'hCG est présente chez 10 à 50 % des patients porteurs de différentes tumeurs non trophoblastiques parmi lesquelles des tumeurs de l'endomètre, l'ovaire, le pancréas, l'estomac, le colon, le foie, le poumon, le sein, les reins, la vessie ainsi que certains lymphomes (Braunstein et coll., Ann Intern Med., 78 :39-45, Kuida et coll., Arch. Pathol. Lab. Med., 112:282- 285, 1988). Endocrinol. Metab., 71: 1318-1321. Furthermore, hCG and its fragments appear to be products of malignant transformation. Indeed, while benign neoplasms do not express or produce this kind of material, several authors have shown that malignant tumors, but also embryonic and fetal cells, express hCG in vivo and in vitro. It has been observed that hCG immunoreactivity is present in 10 to 50% of patients with different non-trophoblastic tumors including endometrial tumors, ovarian, pancreas, stomach, colon, the liver, lung, breast, kidneys, bladder and certain lymphomas (Braunstein et al., Ann Intern Med., 78: 39-45, Kuida et al., Pathol Arch., Med Lab., 112 282-285, 1988).
Dans les cellules tumorales, l'hCG, ses sous-unités ou ses fragments peuvent être associés à la membrane, constituant ainsi un pool insoluble de sialoglycoprotéines non extractibles sans destruction de la membrane. Elles peuvent également constituer un pool soluble hydrophile sécrété par les cellules et présent dans le sang et les urines. In tumor cells, hCG, its subunits or fragments may be associated with the membrane, thereby constituting an insoluble pool of non-extractable sialoglycoproteins without destruction of the membrane. They can also constitute a hydrophilic soluble pool secreted by the cells and present in the blood and urine.
Il est à noter que dans le cas de certains types tumoraux comme le poumon ou la vessie, l'existence d'une activité ss-hCG est corrélée au stade d'avancement de la tumeur (Yoshimura et coll., Cancer, 73 :2745-2752, 1994 ; Norman et coll., Clinical Endocrinol., 23:25-34, 1985 ; Olivier et coll., Molecular Biotherapy, 1:43-47, 1988). It should be noted that for certain tumor types such as lung or bladder, the existence of ss-hCG activity is correlated with the stage of tumor progression (Yoshimura et al., Cancer, 73: 2745). 1975, Norman et al., Clinical Endocrinol., 23: 25-34, 1985, Olivier et al., Molecular Biotherapy, 1: 43-47, 1988).
L'ensemble de ces données indique qu'un ciblage immunologique de la p-hCG ou de ses fragments peut avoir un intérêt tout particulier dans le traitement de certains types de cancer. All of these data indicate that immunological targeting of p-hCG or its fragments may be of particular interest in the treatment of certain types of cancer.
Des études précliniques menées chez la souris (Acevedo et coll., Cancer Detection and Prevention, suppl. 1 :477-486, ou chez le rat (Kellen et coll., Cancer, 49 :2300-2304, 1982)ont respectivement montré l'intérêt, en terme de ralentissement de la croissance tumorale, de générer une réponse immunitaire de type anticorps dirigée contre la ss-hCG. De nombreux brevets ont été déposés dans ce sens. Preclinical studies in mice (Acevedo et al., Cancer Detection and Prevention, supra 1: 477-486, or in rats (Kellen et al., Cancer, 49: 2300-2304, 1982), respectively, showed interest, in terms of slowing tumor growth, of generating an antibody-type immune response directed against ss-hCG, numerous patents have been filed in this sense.
Il est cependant à noter que dans ce type de stratégie, seul un ralentissement temporaire de la croissance tumorale est observé. Par ailleurs, l'importance des réponses immunitaires impliquant des lymphocytes T cytotoxiques (CTL) a aussi été fortement It should be noted, however, that in this type of strategy, only a temporary slowing down of tumor growth is observed. In addition, the importance of immune responses involving cytotoxic T lymphocytes (CTL) was also strongly
<Desc/Clms Page number 3><Desc / Clms Page number 3>
documentée dans les réponses anti-tumorales notamment celles dirigées contre les cellules de mélanome (Rivoltini et al., Crit. Rev. Immunol. 18, 55-63, 1998). documented in anti-tumor responses including those directed against melanoma cells (Rivoltini et al., Crit Rev. Immunol 18, 55-63, 1998).
Les lymphocytes T cytotoxiques reconnaissent des peptides provenant de la dégradation de protéines intracellulaires qui sont présentées par les molécules du complexe majeur d'histocompatibilité (CMH) de classe I à la surface des cellules. Après processing des protéines, les peptides CTL sont sélectionnés à partir du pool de peptides cytosoliques sur la base de leur longueur et de leur séquence en amino acide et transportés vers le réticulum endoplasmique puis associés aux molécules du CMH de classe I. Plusieurs études ont montré que ces peptides naturellement présentés par le CMH de classe I ont en général une longueur de 9~1 acides aminés et contiennent des résidus d'ancrage spécifiques qui possèdent des propriétés particulières en terme d'hydrophobicité et de charge (Falk K. et al., Nature, 351:291-6, 1991 ; Hunt DF. et al., Science, 255 :1261-3, La qualité et la position de ces résidus d'ancrage sont dictées par les poches du sillon de présentation d'antigène spécifiques de chaque allèle du CMH classe I (Matsumara M. et al., Science, 257 :927-34, suggérant que les résidus d'ancrage sont essentiellement impliqués dans la fixation au CMH classe I. Cette hypothèse semble confirmée par le fait que toute altération (remplacement ou délétion) des résidus d'ancrage de ces peptides CTL abroge la fixation de ceux-ci au CMH classe I, et que toute mutation des molécules de CMH classe I au niveau des poches de fixation modifie le répertoire des peptides liés (Ruppert J. et al., Cell., 1993, 74:929-37 ; Rohren EM et al., J. Exp. Med., 1993,177: 1713-21). Cytotoxic T lymphocytes recognize peptides derived from the degradation of intracellular proteins that are presented by the major histocompatibility complex (MHC) class I molecules to the cell surface. After processing the proteins, the CTL peptides are selected from the pool of cytosolic peptides on the basis of their length and their amino acid sequence and transported to the endoplasmic reticulum and then associated with the class I MHC molecules. Several studies have shown that these peptides naturally presented by the MHC class I are generally 9 ~ 1 amino acids in length and contain specific anchoring residues which have particular properties in terms of hydrophobicity and charge (Falk K. et al. , Nature, 351: 291-6, 1991, Hunt DF et al., Science, 255: 1261-3, The quality and position of these anchor residues are dictated by the pockets of the specific antigen presenting groove. of each MHC class I allele (Matsumara M. et al., Science, 257: 927-34), suggesting that anchoring residues are primarily involved in MHC class I binding. This hypothesis seems to be confirmed by ar the fact that any alteration (replacement or deletion) of the anchoring residues of these CTL peptides abrogates their attachment to the MHC class I, and that any mutation of the MHC class I molecules at the level of the fixation pockets modifies the repertoire of bound peptides (Ruppert J. et al., Cell., 1993, 74: 929-37; Rohren EM et al., J. Exp. Med., 1993, 177: 1713-21).
Les résidus d'ancrage ne semblent pas engagés directement dans l'interaction avec le récepteur des cellules T (TCR) ce qui suggère qu'ils peuvent être remplacés sans affecter la reconnaissance des cellules T. Par ailleurs, il a été récemment montré, pour différents épitopes CTL, que la fixation et l'immunogénicité pouvaient être augmentées en remplaçant les résidus d'ancrage au CMH classe I, et ceci sans affecter la reconnaissance de ces peptides par les CTL spécifiques (Bakker ABH et al., Int. J. The anchor residues do not appear to be directly involved in the interaction with the T-cell receptor (TCR) suggesting that they can be replaced without affecting T-cell recognition. Moreover, it has recently been shown that different CTL epitopes, that the binding and immunogenicity could be increased by replacing anchoring residues with MHC class I, without affecting the recognition of these peptides by specific CTLs (Bakker ABH et al., Int. J.
Cancer, 70:302-309, 1997 ; Parkhurst MR et al., J. immunol., 157 :2539-2548, 1996). Le choix des modifications des résidus d'ancrage se fait selon des paramètres d'affinité entre les peptides et le CMH classe I et de stabilité du complexe peptide/CMH classe I (Van der Burg et al., J. Immunol., 156(9):3308-3314, 1996). Cancer, 70: 302-309, 1997; Parkhurst MR et al., J. Immunol., 157: 2539-2548, 1996). The choice of the modifications of the anchoring residues is according to parameters of affinity between the peptides and the MHC class I and stability of the peptide / MHC class I complex (Van der Burg et al., J. Immunol., 156 ( 9): 3308-3314, 1996).
<Desc/Clms Page number 4> <Desc / Clms Page number 4>
Il est cependant à noter que malgré ces modifications, une des difficultés de l'approche CTL réside dans la génération de CTL in vivo, du fait d'une immunogénicité souvent modeste de ces peptides (Melief, Adv. Cancer Res., 58:143-175, 1992 ; Nandaz et Sercarz, Cell, 82 :13-17, Ainsi, il existe aujourd'hui un besoin de disposer d'épitopes cytotoxiques potentiels présents sur la chaîne p de l'hCG pour générer une réponse CTL dirigée spécifiquement contre des cellules tumorales exprimant l'hCG. It should be noted, however, that despite these modifications, one of the difficulties of the CTL approach lies in the generation of CTL in vivo, due to the often modest immunogenicity of these peptides (Melief, Adv Cancer Res., 58: 143 -175, 1992; Nandaz and Sercarz, Cell, 82: 13-17, Thus, there is now a need for potential cytotoxic epitopes present on the p chain of hCG to generate a specifically directed CTL response. tumor cells expressing hCG.
Ceci est justement l'objet de la présente invention. This is precisely the object of the present invention.
L'invention a ainsi pour objet l'utilisation d'épitopes cytotoxiques potentiels présents sur la chaîne (3 de l'hCG, pour générer une réponse immunologique impliquant des lymphocytes T cytotoxiques, en particulier dirigés spécifiquement contre un peptide codé par la séquence génomique du gène codant pour la ss-hCG. The subject of the invention is therefore the use of potential cytotoxic epitopes present on the hCG chain (3) to generate an immunological response involving cytotoxic T lymphocytes, in particular directed specifically against a peptide encoded by the genomic sequence of the gene encoding ss-hCG.
Lesdits épitopes cytotoxiques potentiels dont la séquence est codée par un fragment génomique du gène codant pour la chaîne de l'hCG pourront également présenter au moins une mutation pour l'un au moins de leurs sites d'ancrage aux molécules CMH de classe 1 dans le but d'augmenter leur affinité et seront éventuellement couplés ou mélangés à une protéine porteuse, en présence ou non d'un adjuvant de l'immunité, afin d'augmenter leur immunogénicité si nécessaire. The said potential cytotoxic epitopes whose sequence is encoded by a genomic fragment of the gene coding for the hCG chain may also present at least one mutation for at least one of their anchoring sites to the MHC class 1 molecules in the aim of increasing their affinity and will eventually be coupled or mixed with a carrier protein, in the presence or absence of an adjuvant of immunity, in order to increase their immunogenicity if necessary.
L'invention a donc pour objet l'utilisation d'un peptide d'au moins 8, de préférence 9 acides aminés codé par un fragment génomique du gène codant pour la sshCG humaine, ou l'un de ses analogues, pour la préparation d'une composition pharmaceutique destinée à générer des lymphocytes T cytotoxiques. The subject of the invention is therefore the use of a peptide of at least 8, preferably 9 amino acids encoded by a genomic fragment of the gene coding for human sshCG, or one of its analogs, for the preparation of a pharmaceutical composition for generating cytotoxic T lymphocytes.
Dans la présente invention, on entendra désigner par le terme protéine également les peptides ou les polypeptides. In the present invention, the term "protein" will be understood to mean peptides or polypeptides.
Par analogue d'un peptide codé par un fragment génomique du gène codant pour la p-hCG humaine, on entend désigner : - un composé comprenant au moins une séquence d'acides aminés présentant un degré d'identité après alignement optimal d'au moins 70 %, de préférence d'au moins 80 %,
85 %, 90 % ou 95 % avec la séquence dudit peptide d'au moins 8 acides aminés codé par un fragment génomique du gène codant pour la ss-hCG humaine ; ou By analog of a peptide encoded by a genomic fragment of the gene encoding human p-hCG, is meant: - a compound comprising at least one amino acid sequence having an identity level after optimal alignment of at least 70%, preferably at least 80%,
85%, 90% or 95% with the sequence of said peptide of at least 8 amino acids encoded by a genomic fragment of the gene encoding human ss-hCG; or
<Desc/Clms Page number 5><Desc / Clms Page number 5>
- un composé comprenant au moins une séquence d'acides aminés présentant un degré d'identité après alignement d'au moins 70 %, de préférence d'au moins 80 %, 85 %,
90 % ou 95 % avec la séquence rétroinversée dudit peptide d'au moins 8 acides aminés codé par ledit fragment génomique, lesdits composés analogues étant capables, lorsqu'ils sont mis en présence de lymphocytes T de sujets ayant présentés un taux significatif d'hCG, de générer des lymphocytes T de type cytotoxique, en particulier spécifique dudit peptide ou antigène codé par le fragment génomique du gène codant pour la ss-hCG humaine dont ils sont issus. a compound comprising at least one amino acid sequence having a degree of identity after alignment of at least 70%, preferably at least 80%, 85%,
90% or 95% with the backward sequence of said peptide of at least 8 amino acids encoded by said genomic fragment, said analogous compounds being capable, when placed in the presence of T lymphocytes of subjects having presented a significant level of hCG to generate cytotoxic T lymphocytes, in particular specific for said peptide or antigen encoded by the genomic fragment of the gene encoding the human ss-hCG from which they originate.
Par pourcentage d'identité entre deux séquences d'acide nucléique ou d'acides aminés au sens de la présente invention, on entend désigner un pourcentage de nucléotides ou de résidus d'acides aminés identiques entre les deux séquences à comparer, obtenu après le meilleur alignement, ce pourcentage étant purement statistique et les différences entre les deux séquences étant réparties au hasard et sur toute leur longueur. Le meilleur alignement ou alignement optimal est l'alignement pour lequel le pourcentage d'identité entre les deux séquences à comparer, comme calculé ciaprès, est le plus élevé. Les comparaisons de séquences entre deux séquences d'acide nucléique ou d'acides aminés sont traditionnellement réalisées en comparant ces séquences après les avoir alignées de manière optimale, ladite comparaison étant réalisée par segment ou par fenêtre de comparaison pour identifier et comparer les régions locales de similarité de séquence. L'alignement optimal des séquences pour la comparaison peut être réalisé, outre manuellement, au moyen de l'algorithme d'homologie locale de Smith et Waterman (1981) (Ad. App. Math. 2 :482), moyen de l'algorithme d'homologie locale de Neddleman et Wunsch (1970) (J. Mol. Biol. By percentage identity between two nucleic acid or amino acid sequences in the sense of the present invention, it is meant to designate a percentage of nucleotides or identical amino acid residues between the two sequences to be compared, obtained after the best alignment, this percentage being purely statistical and the differences between the two sequences being randomly distributed over their entire length. The best alignment or alignment is the alignment for which the percentage identity between the two sequences to be compared, as calculated below, is the highest. The sequence comparisons between two nucleic acid or amino acid sequences are traditionally performed by comparing these sequences after optimally aligning them, said comparison being made by segment or comparison window to identify and compare the local regions of the sequence. sequence similarity. The optimal alignment of the sequences for the comparison can be realized, besides manually, by means of the local homology algorithm of Smith and Waterman (1981) (Ad App Math 2: 482), means of the algorithm Local homology of Neddleman and Wunsch (1970) (J. Mol Biol.
48 :443), au moyen de la méthode de recherche de similarité de Pearson et Lipman (1988) (Proc. Natl. Acad. Sci. USA 85 :2444), moyen de logiciels informatiques utilisant ces algorithmes (GAP, BESTFIT, FASTA et TFASTA dans le Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI). 48: 443), using the similarity search method of Pearson and Lipman (1988) (Proc Natl Acad Sci USA 85: 2444), a means of computer software using these algorithms (GAP, BESTFIT, FASTA and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI).
Le pourcentage d'identité entre deux séquences d'acide nucléique ou d'acides aminés est déterminé en comparant ces deux séquences alignées de manière optimale par fenêtre de comparaison dans laquelle la région de la séquence d'acide nucléique ou The percentage identity between two nucleic acid or amino acid sequences is determined by comparing these two optimally aligned sequences by comparison window in which the region of the nucleic acid sequence or
<Desc/Clms Page number 6><Desc / Clms Page number 6>
d'acides aminés à comparer peut comprendre des additions ou des délétions par rapport à la séquence de référence pour un alignement optimal entre ces deux séquences. Le pourcentage d'identité est calculé en déterminant le nombre de positions identiques pour lesquelles le nucléotide ou le résidu d'acide aminé est identique entre les deux séquences, en divisant ce nombre de positions identiques par le nombre total de positions dans la fenêtre de comparaison et en multipliant le résultat obtenu par 100 pour obtenir le pourcentage d'identité entre ces deux séquences. amino acids to be compared may include additions or deletions relative to the reference sequence for optimal alignment between these two sequences. The percentage of identity is calculated by determining the number of identical positions for which the nucleotide or amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window. and multiplying the result obtained by 100 to obtain the percentage identity between these two sequences.
Parmi lesdits composés analogues, on préfère notamment les composés comprenant une séquence d'acides aminés présentant au moins une mutation d'un acide aminé de la séquence d'acides aminés codé par un fragment génomique du gène codant pour la ss-hCG humaine dont il est issu, notamment par délétion, addition ou substitution. Among said analogous compounds, compounds which comprise an amino acid sequence having at least one mutation of an amino acid of the amino acid sequence encoded by a genomic fragment of the gene coding for human ss-hCG, of which it is preferred, are particularly preferred. is derived, in particular by deletion, addition or substitution.
De manière préférée, la séquence d'acides aminés dudit composé analogue présente une subsitution par un acide aminé naturel ou non naturel d'au moins un acide aminé de la séquence d'acides aminés codée par un fragment génomique codant pour la P-hCG humaine dont elle est issue, notamment au niveau d'un site d'ancrage au CMH de classe 1 de la séquence d'acides aminés dont elle est issue. Preferably, the amino acid sequence of said analogous compound has a substitution with a natural or non-natural amino acid of at least one amino acid of the amino acid sequence encoded by a genomic fragment coding for human P-hCG from which it originated, in particular at a MHC class 1 anchoring site of the amino acid sequence from which it originates.
Egalement de manière préférée, la séquence d'acides aminés dudit composé analogue présente une modification de la partie N et/ou C terminales de la séquence d'acides aminés codée par un fragment génomique codant pour la P-hCG humaine dont elle est issue, notamment par modification de l'acide aminé N et/ou C terminales ou par addition d'un ou plusieurs acides aminés permettant le couplage de la séquence d'acides aminés dudit composé analogue avec un composé de nature peptidique, lipidique, d'un dérivé palmitoylé ou d'un dérivé acylé. Also preferably, the amino acid sequence of said analogous compound exhibits a modification of the N and / or C terminal part of the amino acid sequence encoded by a genomic fragment coding for the human P-hCG from which it originated, in particular by modifying the amino acid N and / or C-terminal or by adding one or more amino acids allowing the coupling of the amino acid sequence of said analogous compound with a peptide-like compound, lipid, of a derivative palmitoyl or an acyl derivative.
La présente invention concerne l'utilisation selon l'invention, caractérisée en ce que ledit peptide d'au moins 8, de préférence 9 acides aminés codé par un fragment génomique du gène codant pour la (3-hCG humaine, ou l'un de ses analogues, est choisi parmi les peptides de séquence suivante : a) un fragment d'au moins 8 acides aminés consécutifs d'un peptide de séquence SEQ ID No. 1 ; The present invention relates to the use according to the invention, characterized in that said peptide of at least 8, preferably 9 amino acids encoded by a genomic fragment of the gene coding for human (3-hCG, or one of its analogs, is chosen from the peptides of the following sequence: a) a fragment of at least 8 consecutive amino acids of a peptide of SEQ ID No. 1 sequence;
<Desc/Clms Page number 7><Desc / Clms Page number 7>
b) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en a) ; et c) un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 70 %, de préférence 80 %, 85 %, 90 % ou 95 %, avec la séquence d'un peptide tel que défini en a) ou b). b) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in a); and c) a peptide whose sequence has an identity level after optimal alignment of at least 70%, preferably 80%, 85%, 90% or 95%, with the sequence of a peptide as defined in ) or b).
Par séquence d'acides aminés rétroinverso ou de la forme rétroinverso d'un peptide constitué de n résidus d'acide aminé, de séquence générale H2N-X1-X2- .........Xn-1-Xn-COOH, H2N- correspondant au radical -NH2 de l'acide aminé X1 situé en position N terminale du peptide et-COOH correspondant au radical-COOH de l'acide aminé Xn situé en position C terminale du peptide, on entend désigner la séquence d'acides aminés du peptide H2N-Xn-Xn-1-.........X2-X1-COOH, H2Ncorrespondant au radical -NH2 de l'acide aminé Xn situé en position N terminale du peptide et-COOH correspondant au radical-COOH de l'acide aminé X1 situé en position C terminale du peptide. By amino acid sequence retroinverso or retroinverso form of a peptide consisting of n amino acid residues, of general sequence H2N-X1-X2- ......... Xn-1-Xn-COOH , H2N- corresponding to the -NH2 radical of the amino acid X1 located in the N-terminal position of the peptide and-COOH corresponding to the -COOH radical of the amino acid Xn located at the C-terminal position of the peptide, is meant to denote the amino acid of the peptide H2N-Xn-Xn-1-X. X2-X1-COOH, H2N corresponding to the -NH2 radical of the amino acid Xn located at the N-terminal position of the peptide and -COOH corresponding to radical-COOH of the amino acid X1 located at the C-terminal position of the peptide.
L'invention concerne en particulier l'utilisation selon l'invention, caractérisée en ce que ledit peptide d'au moins 8 acides aminés codé par un fragment génomique du gène codant pour la p-hCG humaine, ou l'un de ses analogues, comprend au plus 15 acides aminés, de préférence au plus 14, 13, 12, 11et 10 acides aminés. The invention relates in particular to the use according to the invention, characterized in that said peptide of at least 8 amino acids encoded by a genomic fragment of the gene coding for human p-hCG, or one of its analogs, comprises at most 15 amino acids, preferably at most 14, 13, 12, 11 and 10 amino acids.
De manière plus préférée, lesdits peptides selon l'invention sont choisis parmi les peptides de séquences SEQ ID Nos. 3 à 174 identifiés aux tableaux 1 à IV des exemples 1 et 2 de la présente description, ces derniers pouvant comprendre au moins une mutation, de préférence une substitution d'un acide aminé par un acide aminé naturel ou non naturel, de manière plus préférée au plus une telle substitution. More preferably, said peptides according to the invention are chosen from the peptides of SEQ ID Nos. 3 to 174 identified in Tables 1 to IV of Examples 1 and 2 of the present description, the latter may comprise at least one mutation, preferably a substitution of an amino acid with a natural or non-natural amino acid, more preferably at most such a substitution.
De manière plus préférée, lesdits peptides selon l'invention sont choisis parmi les peptides de séquences suivantes : a) les peptides de séquence SEQ ID Nos. 9, 19, 50, 72,90, 96 ou 104 ; b) un fragment d'au plus 15 acides aminés consécutifs de la séquence SEQ ID No. 1 comprenant un peptide tel que défini en a) ; c) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en a) ou b) ; More preferably, said peptides according to the invention are chosen from the peptides of the following sequences: a) the peptides of sequence SEQ ID Nos. 9, 19, 50, 72.90, 96 or 104; b) a fragment of at most 15 consecutive amino acids of the sequence SEQ ID No. 1 comprising a peptide as defined in a); c) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in a) or b);
<Desc/Clms Page number 8><Desc / Clms Page number 8>
d) un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 70 % avec la séquence d'un peptide tel que défini en a), b) ou c), ou encore parmi les peptides de séquences suivantes : e) les peptides de séquences SEQ ID Nos. 160, 162, 165 et 173 ; etf) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en e). d) a peptide whose sequence has a degree of identity after optimal alignment of at least 70% with the sequence of a peptide as defined in a), b) or c), or among the peptides of following sequences e) the peptides of SEQ ID Nos. 160, 162, 165 and 173; andf) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in e).
De manière encore plus préférée, lesdits peptides selon l'invention sont choisis parmi les peptides de séquences suivantes : a) les peptides de séquence SEQ ID Nos. 9 ou 50; b) un fragment d'au plus 15 acides aminés consécutifs de la séquence SEQ ID No. 1 comprenant un peptide tel que défini en a) ; c) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en a) ou b) ; d) un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 70 % avec la séquence d'un peptide tel que défini en a), b) ou c), de préférence les peptides de séquences SEQ ID Nos. 162 et 165 (dérivés du peptide de séquence SEQ ID No. 9) et 173 (dérivé du peptide de séquence SEQ ID No. 50) et les peptides de séquence de la forme rétroinverso des peptides de séquences SEQ ID
Nos. 162, 165 et 173. Even more preferably, said peptides according to the invention are chosen from the peptides of the following sequences: a) the peptides of sequence SEQ ID Nos. 9 or 50; b) a fragment of at most 15 consecutive amino acids of the sequence SEQ ID No. 1 comprising a peptide as defined in a); c) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in a) or b); d) a peptide whose sequence has an identity degree after optimal alignment of at least 70% with the sequence of a peptide as defined in a), b) or c), preferably the peptides of SEQ ID sequences our. 162 and 165 (derivatives of the peptide of sequence SEQ ID No. 9) and 173 (derivative of the peptide of sequence SEQ ID No. 50) and the peptides of the sequence of the retroinverso form of the peptides of SEQ ID sequences
Our. 162, 165 and 173.
Lesdits peptides selon l'invention de séquences SEQ ID Nos. 165 et 173 sont tout particulièrement préférés, notamment le peptide de séquence SEQ ID No. 173. Said peptides according to the invention of SEQ ID Nos. 165 and 173 are very particularly preferred, in particular the peptide of sequence SEQ ID No. 173.
L'invention comprend en outre l'utilisation selon l'invention, caractérisée en ce que ledit peptide d'au moins 8 acides aminés codé par un fragment génomique du gène codant pour la p-hCG humaine, ou l'un de ses analogues est capable de s'associer au CMH de classe I pour générer des lymphocytes T cytotoxiques spécifiques dudit peptide. The invention further comprises the use according to the invention, characterized in that said peptide of at least 8 amino acids encoded by a genomic fragment of the gene coding for human p-hCG, or one of its analogs is capable of associating with MHC class I to generate cytotoxic T lymphocytes specific for said peptide.
L'invention comprend également l'utilisation selon l'invention, caractérisée en ce que ledit peptide est modifié en sa partie N et/ou C terminales et couplé à un composé peptidique, lipidique, à un dérivé palmitoylé ou à tout dérivé acylé. The invention also comprises the use according to the invention, characterized in that said peptide is modified in its part N and / or C terminal and coupled to a peptide compound, lipid, a palmitoyl derivative or any acyl derivative.
<Desc/Clms Page number 9> <Desc / Clms Page number 9>
L'invention comprend en outre l'utilisation selon l'invention, caractérisée en ce que ledit peptide est modifié par glycosylation au niveau d'un résidu sérine ou asparagine. The invention further comprises the use according to the invention, characterized in that said peptide is modified by glycosylation at a serine or asparagine residue.
De préférence, l'utilisation selon l'invention est caractérisée en ce que ledit peptide est couplé ou mélangé à une protéine porteuse choisie parmi la protéine TT (Toxoïde Tétanique) ou ses dérivés, la protéine DT (Toxoïde Diphtérique) ou ses dérivés, la KLH (Key Limpet Haemocyanin), les protéines de choc thermique ou HSP, les protéines de membranes bactériennes de type Omp, notamment d'entérobactéries, ou leurs fragments. Preferably, the use according to the invention is characterized in that said peptide is coupled to or mixed with a carrier protein selected from the TT protein (Tetanus toxoid) or its derivatives, the DT protein (Diphtheria toxoid) or its derivatives, the KLH (Key Limpet Haemocyanin), heat shock proteins or HSP, Omp type bacterial membrane proteins, especially enterobacteria, or fragments thereof.
Dans la présente invention, on entendra désigner par le terme Omp (pour Outer Membrane Protein ), les protéines de la membrane externe, et par OmpA celles de type A. In the present invention, the term Omp (for Outer Membrane Protein), the proteins of the outer membrane, and OmpA will be referred to as those of type A.
Par fragment ou composés dérivés d'une protéine porteuse, on entend désigner en particulier tout fragment de séquence d'acides aminés compris dans la séquence d'acides aminés de la protéine porteuse qui, lorsqu'il est associé à un immunogène, est capable de générer ou accroître une réponse immune, notamment humorale et/ou de type CTL, dirigée contre ledit immunogène et comprenant au moins 8 acides aminés consécutifs, de préférence au moins 10 acides aminés ou de manière plus préférée au moins 15,20, 30 ou 50 acides aminés consécutifs de la séquence d'acides aminés de ladite protéine porteuse, leurs composés dérivés comprenant au moins l'un de ses fragments. By fragment or compounds derived from a carrier protein is meant in particular any amino acid sequence fragment included in the amino acid sequence of the carrier protein which, when associated with an immunogen, is capable of generate or increase an immune response, in particular a humoral and / or CTL-like response, directed against said immunogen and comprising at least 8 consecutive amino acids, preferably at least 10 amino acids or more preferably at least 15,20, 30 or 50 amino acid sequence of the amino acid sequence of said carrier protein, their derivative compounds comprising at least one of its fragments.
Dans un mode de réalisation particulier, l'invention comprend l'utilisation selon l'invention dans laquelle la protéine porteuse Omp d'entérobactérie ou l'un de ses fragments, est obtenue par un procédé d'extraction à partir d'une culture de ladite entérobactérie ou par voie recombinante. In a particular embodiment, the invention comprises the use according to the invention in which the Omp carrier protein of enterobacteria or one of its fragments, is obtained by a method of extraction from a culture of said enterobacterium or recombinantly.
Les procédés d'extraction de protéines de membranes bactériennes sont connus de l'homme de l'art et ne seront pas développés dans la présente description. On peut citer par exemple, mais sans s'y limiter le procédé d'extraction décrit par Haeuw J. F. et al. (Eur. J. Biochem., 255:446-454, 1998). The methods for extracting bacterial membrane proteins are known to those skilled in the art and will not be developed in the present description. For example, but not limited to the extraction method described by Haeuw J.F. et al. (Eur J. Biochem., 255: 446-454, 1998).
Les méthodes de préparation de protéines recombinantes sont aujourd'hui également bien connues de l'homme de l'art. Parmi les cellules utilisables pour la Recombinant protein preparation methods are also now well known to those skilled in the art. Among the cells that can be used for
<Desc/Clms Page number 10><Desc / Clms Page number 10>
production de ces protéines recombinantes, on peut citer par exemple les cellules bactériennes (Olins P. O. et Lee S.C., Curr. Op. Biotechnology, 4 :520-525, 1993), mais également les cellules de levure (Buckholz R.G., Curr. Op. Biotechnology, 4 :538-542, 1993), de même que les cellules animales, en particulier les cultures de cellules de mammifères (Edwards C. P. et Aruffo A., Curr. Op. Biotechnology, 4 :558-563, 1993) mais également les cellules d'insectes dans lesquelles on peut utiliser des procédés mettant en oeuvre par exemple des baculovirus (Luckow V.A., Curr. Op. production of these recombinant proteins include, for example, bacterial cells (Olins PO and Lee SC, Curr Op Op Biotechnology, 4: 520-525, 1993), but also yeast cells (Buckholz RG, Curr Op. Biotechnology, 4: 538-542, 1993), as well as animal cells, particularly mammalian cell cultures (Edwards CP and Aruffo A., Curr Op., Biotechnology, 4: 558-563, 1993) but also insect cells in which methods using, for example, baculoviruses (Luckow VA, Curr Op.
Biotechnology, 4:564-572, 1993) ou encore des cellules végétales. Biotechnology, 4: 564-572, 1993) or plant cells.
De manière tout à fait préférée, l'utilisation selon l'invention est caractérisée en ce que ladite protéine porteuse est une protéine OmpA de Klebsiella pneumoniae, en particulier la protéine P40 de séquence d'acides aminés SEQ ID No. 2, l'un de ses fragments d'au moins 8 acides aminés, de préférence au moins 10,15, 20,30 ou 50 acides aminés, ou un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 80 %, de préférence 85 %, 90 % ou 95 % avec la séquence SEQ ID No. 2 ou avec l'un de sesdits fragments. Most preferably, the use according to the invention is characterized in that said carrier protein is an OmpA protein of Klebsiella pneumoniae, in particular the protein P40 of amino acid sequence SEQ ID No. 2, one of its fragments of at least 8 amino acids, preferably at least 10, 15, 20, 30 or 50 amino acids, or a peptide whose sequence has an identity level after optimal alignment of at least 80%, preferably 85%, 90% or 95% with the sequence SEQ ID No. 2 or with one of said fragments thereof.
La protéine porteuse nommée P40, dérivée de la membrane externe de type A de Klebsiella pneumoniae a été décrite en particulier dans les demandes de brevet WO 95/27787 et WO 96/14415 comme permettant d'augmenter la réponse immune notamment de type humorale, lorsque celle-ci était associée à un immunogène, et dans de nombreux documents mettant en évidence sa capacité à générer des réponses immunes de type CTL contre les antigènes qui lui sont associés. The carrier protein named P40, derived from the outer membrane type A Klebsiella pneumoniae has been described in particular in patent applications WO 95/27787 and WO 96/14415 as to increase the immune response including humoral type, when this was associated with an immunogen, and in many documents highlighting its ability to generate CTL type immune responses against the antigens associated with it.
La présente invention a aussi pour objet l'utilisation selon l'invention, caractérisée en ce que ledit peptide d'au moins 8 acides aminés codé par un fragment génomique du gène codant pour la (3-hCG humaine, ou l'un de ses analogues, est couplé par liaison covalente avec ladite protéine porteuse ou l'un de ses fragments, ledit couplage pouvant être réalisé par voie chimique ou par fusion génétique. The present invention also relates to the use according to the invention, characterized in that said peptide of at least 8 amino acids encoded by a genomic fragment of the gene coding for human (3-hCG, or one of its analogs, is coupled by covalent bonding with said carrier protein or a fragment thereof, which coupling can be carried out chemically or by genetic fusion.
Dans un mode de réalisation particulier, l'utilisation selon l'invention est caractérisée en ce qu'il est introduit un ou plusieurs éléments de liaison dans ladite protéine porteuse, ou l'un de ses fragments, et/ou dans ledit peptide d'au moins 8 acides aminés codé par un fragment génomique du gène codant pour la p-hCG humaine, ou In a particular embodiment, the use according to the invention is characterized in that one or more binding elements are introduced into said carrier protein, or one of its fragments, and / or in said peptide of at least 8 amino acids encoded by a genomic fragment of the gene encoding human p-hCG, or
<Desc/Clms Page number 11><Desc / Clms Page number 11>
l'un de ses analogues, pour faciliter le couplage chimique, de préférence, ledit élément de liaison introduit est un acide aminé. one of its analogues, to facilitate chemical coupling, preferably, said introduced linker is an amino acid.
Selon l'invention, il est possible d'introduire un ou plusieurs éléments de liaison, notamment des acides aminés pour faciliter les réactions de couplage entre la protéine porteuse, ou l'un de ses fragments, et/ou ledit peptide. Le couplage covalent entre la protéine porteuse, ou l'un de ses fragments, et ledit peptide codé par un fragment génomique du gène codant pour la (3-hCG, ou l'un de ses analogues peut être réalisé à l'extrémité N- ou C- terminale de la protéine porteuse, de l'un de ses fragments, dudit peptide ou de l'un de ses analogues. Les réactifs bifonctionnels permettant ce couplage seront déterminés en fonction de la nature de ces extrémités N- ou C- terminales. According to the invention, it is possible to introduce one or more linking elements, in particular amino acids, to facilitate the coupling reactions between the carrier protein, or one of its fragments, and / or said peptide. The covalent coupling between the carrier protein, or a fragment thereof, and said peptide encoded by a genomic fragment of the gene encoding (3-hCG, or one of its analogs can be made at the N-terminus. or C-terminus of the carrier protein, one of its fragments, said peptide or one of its analogs The bifunctional reagents allowing this coupling will be determined according to the nature of these N- or C-terminal ends .
Dans un autre mode de réalisation particulier, l'utilisation selon l'invention est caractérisée en ce que le peptide hybride obtenu après couplage entre ledit peptide codé par un fragment génomique du gène codant pour la ss-hCG humaine, ou l'un de ses analogues, et ladite protéine porteuse, ou l'un de ses fragments, est préparé par recombinaison génétique (fusion génétique). In another particular embodiment, the use according to the invention is characterized in that the hybrid peptide obtained after coupling between said peptide encoded by a genomic fragment of the gene coding for human ss-hCG, or one of its analogs, and said carrier protein, or a fragment thereof, is prepared by genetic recombination (genetic fusion).
Ledit peptide hybride peut être en effet produit par des techniques d'ADN recombinant par insertion ou addition à la séquence d'ADN codant pour ledit peptide codé par un fragment génomique du gène codant pour la (3-hCG humaine, ou l'un de ses analogues, d'une séquence codant pour ladite protéine porteuse, ou l'un de ses fragments. Said hybrid peptide may indeed be produced by recombinant DNA techniques by insertion or addition to the DNA sequence encoding said peptide encoded by a genomic fragment of the gene coding for human (3-hCG, or one of its analogues, a sequence encoding said carrier protein, or a fragment thereof.
Les procédés de synthèse de ces peptides hybrides englobent les méthodes utilisées en génie génétique pour construire des polynucléotides hybrides codant pour les séquences polypeptidiques recherchées. On pourra, par exemple, se référer avantageusement à la technique d'obtention de gènes codant pour des protéines de fusion décrite par D.V. Goeddel (Gene expression technology, Methods in Enzymology, vol. 185:3-187, 1990). The methods for synthesizing these hybrid peptides include methods used in genetic engineering to construct hybrid polynucleotides encoding the desired polypeptide sequences. For example, the technique for obtaining genes coding for fusion proteins described by D.V. Goeddel (Gene expression technology, Methods in Enzymology, vol 185: 3-187, 1990) can be advantageously referred to.
L'invention a également pour objet l'utilisation selon l'invention, caractérisée en ce que ledit peptide codé par un fragment génomique du gène codant pour la (3-hCG humaine, ou l'un de ses analogues, est véhiculé sous une forme permettant d'améliorer sa stabilité et/ou son immunogénicité. The subject of the invention is also the use according to the invention, characterized in that said peptide encoded by a genomic fragment of the gene coding for human (3-hCG, or one of its analogues, is conveyed in a form to improve its stability and / or its immunogenicity.
<Desc/Clms Page number 12> <Desc / Clms Page number 12>
Parmi les véhicules permettant d'améliorer la stabilité et/ou l'immunogénicité desdits peptides, on préfère notamment les liposomes ainsi que les vecteurs viraux ou bactériens contenant une construction nucléique codant pour ledit peptide et éventuellement en outre ladite protéine porteuse, ou l'un de ses fragments. Among the vehicles making it possible to improve the stability and / or the immunogenicity of said peptides, liposomes as well as viral or bacterial vectors containing a nucleic construct coding for said peptide and optionally also said carrier protein, or one of his fragments.
Sous un autre aspect, l'invention concerne l'utilisation selon l'invention, caractérisée en ce que la composition pharmaceutique contient un vecteur comprenant une construction nucléique codant pour le peptide hybride obtenue après couplage entre ledit peptide codé par un fragment génomique du gène codant pour la P-hCG humaine, ou l'un de ses analogues, et ladite protéine porteuse, ou l'un de ses fragments, ou une cellule hôte transformée par ledit vecteur capable d'exprimer ledit peptide hybride. In another aspect, the invention relates to the use according to the invention, characterized in that the pharmaceutical composition contains a vector comprising a nucleic construct coding for the hybrid peptide obtained after coupling between said peptide encoded by a genomic fragment of the coding gene. for human P-hCG, or an analogue thereof, and said carrier protein, or a fragment thereof, or a host cell transformed by said vector capable of expressing said hybrid peptide.
Est également comprise dans la présente invention, l'utilisation selon l'invention, caractérisée en ce que ladite composition pharmaceutique comprend en outre un adjuvant de l'immunité, cet adjuvant pouvant être mélangé ou lorsque la composition pharmaceutique comprend une protéine porteuse, ou l'un de ses fragments, éventuellement couplé à ladite protéine porteuse, ou l'un de ses fragments. Also included in the present invention, the use according to the invention, characterized in that said pharmaceutical composition further comprises an immunity adjuvant, said admixture being admixable or where the pharmaceutical composition comprises a carrier protein, or one of its fragments, optionally coupled to said carrier protein, or one of its fragments.
Sous un autre aspect, l'invention a pour objet l'utilisation selon l'invention, caractérisée en ce que les lymphocytes T cytotoxiques générés sont spécifiques de cellules antitumorales positives pour le marqueur hCG. In another aspect, the subject of the invention is the use according to the invention, characterized in that the cytotoxic T lymphocytes generated are specific for anti-tumor cells that are positive for the hCG marker.
L'invention comprend en outre l'utilisation selon l'invention pour la préparation d'une composition pharmaceutique destinée à la prévention ou le traitement des cancers associés à la présence de tumeurs positives pour le marqueur hCG. The invention further comprises the use according to the invention for the preparation of a pharmaceutical composition for the prevention or treatment of cancers associated with the presence of tumors positive for the hCG marker.
L'invention comprend en outre l'utilisation selon l'invention pour la préparation d'une composition pharmaceutique, notamment vaccinale, administrable par voie systémique mucosale ou transdermique. The invention furthermore comprises the use according to the invention for the preparation of a pharmaceutical composition, in particular a vaccine composition, which can be administered mucosally or transdermally.
Sous un dernier aspect, la présente invention comprend les peptides choisis parmi les peptides de séquence suivante : a) un fragment d'au moins 8, de préférence 9 acides aminés consécutifs d'un peptide de séquence SEQ ID No. 1 ; b) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide a) ; In a final aspect, the present invention comprises peptides selected from peptides of the following sequence: a) a fragment of at least 8, preferably 9 consecutive amino acids of a peptide of sequence SEQ ID No. 1; b) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide a);
<Desc/Clms Page number 13><Desc / Clms Page number 13>
c) un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 70 %, de préférence d'au moins 80 %, 85 %, 90 % ou 95 % avec la séquence d'un peptide a) ou b), caractérisés en ce qu'ils sont capables de générer des lymphocytes T de type cytotoxique, en particulier spécifique desdits peptides, ou capables de générer une augmentation importante du taux de lymphocytes T CD8+ produisant de l'INF-y et du TNF-a, lorsque cesdits peptides sont mis en présence de lymphocytes T de sujets ayant présenté un taux significatif d'hCG. c) a peptide whose sequence has an identity level after optimal alignment of at least 70%, preferably at least 80%, 85%, 90% or 95% with the sequence of a peptide a) or b), characterized in that they are capable of generating cytotoxic T lymphocytes, in particular specific for said peptides, or capable of generating a significant increase in the level of CD8 + T lymphocytes producing INF-γ and TNF-α. a, when said peptides are placed in the presence of T lymphocytes of subjects having a significant level of hCG.
Parmi cesdits peptides selon l'invention, on préfère notamment les peptides constitués d'au plus 15 acides aminés, de préférence au plus 14,13, 12, 11 et 10, en particulier les peptides de séquences SEQ ID Nos. 3 à 174 identifiés aux tableaux I à IV des exemples 2 et 3, ces derniers pouvant comprendre une mutation, notamment par substitution d'un acide aminé par un autre acide aminé naturel ou non naturel, de préférence au plus une telle substitution. Among these peptides according to the invention, peptides consisting of at most 15 amino acids, preferably at most 14, 13, 12, 11 and 10, in particular the peptides of SEQ ID Nos. 3 to 174 identified in Tables I to IV of Examples 2 and 3, the latter may comprise a mutation, in particular by substitution of one amino acid with another natural or non-natural amino acid, preferably at most one such substitution.
Parmi cesdits peptides selon l'invention, on préfère de manière plus particulière les peptides choisis parmi les peptides de séquences suivantes : a) les peptides de séquence SEQ ID Nos. 9, 19, 50, 72,90, 96 ou 104 ; b) un fragment d'au plus 15 acides aminés consécutifs de la séquence SEQ ID No. 1 comprenant un peptide tel que défini en a) ; c) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en a) ou b) ; d) un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 70 % avec la séquence d'un peptide tel que défini en a), b) ou c), ou encore lesdits peptides selon l'invention choisis parmi les peptides de séquences suivantes : e) les peptides de séquence SEQ ID Nos. 160, 162, 165 ou 173 ; f) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en e). Among these peptides according to the invention, peptides chosen from peptides of the following sequences are more particularly preferred: a) Peptides of sequence SEQ ID Nos. 9, 19, 50, 72.90, 96 or 104; b) a fragment of at most 15 consecutive amino acids of the sequence SEQ ID No. 1 comprising a peptide as defined in a); c) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in a) or b); d) a peptide whose sequence has a degree of identity after optimal alignment of at least 70% with the sequence of a peptide as defined in a), b) or c), or said peptides according to the invention selected from the peptides of the following sequences: e) the peptides of sequence SEQ ID Nos. 160, 162, 165 or 173; f) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in e).
Parmi cesdits peptides selon l'invention, on préfère de manière encore plus préférée, les peptides choisis parmi les peptides de séquences suivantes : a) les peptides de séquence SEQ ID Nos. 9 ou 50 ; Among these peptides according to the invention, the peptides chosen from the peptides of the following sequences are even more preferred: a) the peptides of sequence SEQ ID Nos. 9 or 50;
<Desc/Clms Page number 14><Desc / Clms Page number 14>
b) un fragment d'au plus 15 acides aminés consécutifs de la séquence SEQ ID No. 1 comprenant un peptide tel que défini en a) ; c) un peptide dont la séquence d'acides aminés est la séquence de la forme rétroinverso d'un peptide tel que défini en a) ou b) ;et d) un peptide dont la séquence présente un degré d'identité après alignement optimal d'au moins 70 % avec la séquence d'un peptide tel que défini en a), b) ou c), de préférence les peptides de séquences SEQ ID Nos. 162 et 165 (dérivés du peptide de séquence SEQ ID No. 10) et 173 (dérivé du peptide de séquence SEQ ID No. 50) et les peptides de séquence de la forme rétroinverso des peptides de séquences SEQ ID
Nos. 162,165 et 173. b) a fragment of at most 15 consecutive amino acids of the sequence SEQ ID No. 1 comprising a peptide as defined in a); c) a peptide whose amino acid sequence is the sequence of the retroinverso form of a peptide as defined in a) or b) and d) a peptide whose sequence has a degree of identity after optimal alignment at least 70% with the sequence of a peptide as defined in a), b) or c), preferably the peptides of SEQ ID Nos. 162 and 165 (derivatives of the peptide of sequence SEQ ID No. 10) and 173 (derived from the peptide of sequence SEQ ID No. 50) and the peptides of the sequence of the retroinverso form of the peptides of SEQ ID sequences
Our. 162, 165 and 173.
Les peptides selon l'invention de séquences SEQ ID Nos. 165 et 173 sont tout particulièrement préférés, notamment le peptide de séquence SEQ ID No. 173. The peptides according to the invention of SEQ ID Nos. 165 and 173 are very particularly preferred, in particular the peptide of sequence SEQ ID No. 173.
L'invention comprend également lesdits peptides selon l'invention à titre de médicament, notamment destinés à la prévention et/ou le traitement de tumeurs, en particulier les tumeurs à marqueur hCG positif. The invention also comprises said peptides according to the invention as a medicament, in particular intended for the prevention and / or the treatment of tumors, in particular hCG-positive tumors.
Enfin, la présente invention concerne des compositions pharmaceutiques comprenant un composé choisi parmi : - un peptide selon l'invention, le cas échéant couplé ou mélangé avec une protéine porteuse ou l'un de ses fragments ; ou - une construction nucléique contenant un ADN codant pour un peptide selon l'invention, le cas échéant contenant en outre un ADN codant pour une protéine porteuse ou l'un de ses fragments. Finally, the present invention relates to pharmaceutical compositions comprising a compound chosen from: a peptide according to the invention, optionally coupled or mixed with a carrier protein or one of its fragments; or - a nucleic construct containing a DNA encoding a peptide according to the invention, where appropriate further containing a DNA coding for a carrier protein or one of its fragments.
Bien entendu, de telles compositions pharmaceutiques selon l'invention pourront comprendre également un adjuvant de l'immunité capable d'augmenter l'immunogénicité de tels peptides et/ou être véhiculées sous une forme permettant d'améliorer leur stabilité et/ou leur immunogénicité comme par exemple sous forme de liposomes, ou de vecteur viral ou bactérien pour les constructions nucléiques. Of course, such pharmaceutical compositions according to the invention may also comprise an adjuvant of the immunity capable of increasing the immunogenicity of such peptides and / or being conveyed in a form which makes it possible to improve their stability and / or their immunogenicity as for example in the form of liposomes, or viral or bacterial vector for nucleic constructs.
Les légendes des figures et exemples qui suivent sont destinés à illustrer l'invention sans aucunement en limiter la portée. The legends of the figures and examples which follow are intended to illustrate the invention without in any way limiting its scope.
<Desc/Clms Page number 15> <Desc / Clms Page number 15>
Légendes des figures : Figures lA et 1B : Mesure de la sécrétion de y interféron induite par le peptide 7. 3 (SEQ ID No. 9) chez une patiente atteinte de cancer du sein (figure 1B) comparée à celle induite par un peptide non relevant (figure lA). Legends of the Figures: FIGS. 1A and 1B: Measurement of the secretion of interferon induced by peptide 7.3 (SEQ ID No. 9) in a patient suffering from breast cancer (FIG. 1B) compared to that induced by a non-peptide relevant (Figure lA).
Figures 2A à 2E : de la réponse CTL induite par le peptide 7. 3 après immunisation de souris HLA A2/Kb (figure 2A) ou C57/B16 (figure 2B). Comparaison du peptide 7. 3 et de trois de ses dérivés : 20. 2 (SEQ ID No. 160) (figure 2C), 20. 4 (SEQ ID No. 162) (figure 2D) et 20. 7 (SEQ ID No. 165) (figure 2E) pour l'induction de la réponse CTL chez des souris transgéniques HLA A2/Kb. NC : cellules cibles non chargées. FIGS. 2A to 2E: of the peptide-induced CTL response after immunization of HLA A2 / Kb (FIG. 2A) or C57 / B16 mice (FIG. 2B). Comparison of peptide 7. 3 and three of its derivatives: 20. 2 (SEQ ID No. 160) (FIG. 2C), 20. 4 (SEQ ID No. 162) (FIG. 2D) and 20. 7 (SEQ ID No. 165) (Figure 2E) for the induction of the CTL response in HLA A2 / Kb transgenic mice. NC: uncharged target cells.
Figures 3A à 3E : de la réponse CTL induite par le peptide 8. 6 après immunisation de souris HLA A2/Kb (figure 3A) ou C57/B16 (figure 3B). Comparaison du peptide 8. 6 (figure 3B) et de son dérivé, le peptide 10.18 (SEQ ID No. 173) (figures 3C et 3D) pour l'induction de la réponse CTL chez des souris transgéniques HLA A2/Kb ou C57/B16 respectivement. Dans la figure 3E, les cellules de souris immunisées avec le peptide 10.18 sont mises en présence de cibles présentant le peptide natif 8.6. FIGS. 3A to 3E: the peptide-induced CTL response after immunization of HLA A2 / Kb (FIG. 3A) or C57 / B16 mice (FIG. 3B). Comparison of peptide 8.6 (FIG. 3B) and its derivative, peptide 10.18 (SEQ ID No. 173) (FIGS. 3C and 3D) for induction of CTL response in HLA A2 / Kb or C57 transgenic mice B16 respectively. In FIG. 3E, the cells of mice immunized with the 10.18 peptide are placed in the presence of targets presenting the native peptide 8.6.
NC : Témoin cellules cibles non chargées. NC: Target cells not loaded.
EXEMPLES Exemple 1 : Synthèse, purification et caractérisation de nonapeptides de la sousunité ss de l'hCG. EXAMPLES Example 1 Synthesis, purification and characterization of nonapeptides of the subunit ss of hCG.
La séquence de la sous-unité (3 de l'hCG (ss gonadotropine chorionique humaine) (y compris la séquence signal en caractères gras) comprend 165 résidus (SEQ ID No. The hCG subunit sequence (ss human chorionic gonadotropin) (including the signal sequence in bold) comprises 165 residues (SEQ ID No.
1) : [MEMFQGLLLLLLLSMGGTWA] SKEPLRPRCRPINATLAVEKEGCPVCITVNT TICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVA LSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTP ILPQ
Les 157 nonapeptides (SEQ ID Nos. 3 à 159) de la sous-unité p de l'hCG ont été synthétisés à l'aide d'un synthétiseur multiple de peptides (Advanced ChemTech, modèle 348 oméga) en phase solide en utilisant la chimie Fmoc à l'échelle de 50 moles. Les résines de types Wang-ou 2-chlorotrityl- préchargées portant le résidu COOH-terminal 1): [MEMFQGLLLLLLLSMGGTWA] SKEPLRPRCRPINATLAVEKEGCPVCITVNT TICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVA LSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTP ILPQ
The 157 nonapeptides (SEQ ID Nos. 3 to 159) of the p-subunit of hCG were synthesized using a solid phase peptide multiple synthesizer (Advanced ChemTech, model 348 omega) using the Fmoc chemistry at the scale of 50 moles. Wang-or 2-chlorotrityl-preloaded resins bearing the COOH-terminal residue
<Desc/Clms Page number 16><Desc / Clms Page number 16>
des peptides à synthétiser ont été introduites dans les puits d'un réacteur comportant 96 puits. La fonction [alpha]-NH2 des acides aminés utilisés pour la synthèse était protégée par un groupement (Fmoc) et les fonctions des chaînes latérales des acides aminés étaient protégées par des groupes compatibles avec la chimie Fmoc [Cys(Trt) ; Arg (Pmc) ; His (Trt) ; Trp (Boc) ; Asn(Trt) ; Gln (Trt) ; Lys (Boc) ; Ser (tBu) ; Thr (tBu) ; Tyr (tBu) ; Asp(OtBu) ; Glu (OtBu)]. peptides to be synthesized were introduced into the wells of a reactor comprising 96 wells. The [alpha] -NH2 function of the amino acids used for the synthesis was protected by a group (Fmoc) and the functions of the side chains of the amino acids were protected by groups compatible with the Fmoc chemistry [Cys (Trt); Arg (Pmc); His (Trt); Trp (Boc); Asn (Trt); Gln (Trt); Lilies (Boc); Ser (tBu); Thr (tBu); Tyr (tBu); Asp (OtBu); Glu (OtBu)].
I. Protocole de synthèse Lavages préliminaires : DCM 1500 ul/puits 3 fois 5 min
DMF 1500 l/puits 3 fois 10 min 1. Déprotections : a. DMF 1125 ul/puits pipéridine 375 l/puits 1 fois 2 min rinçage : DMF 1500 ul/puits vidange b. DMF 1125 ul/puits pipéridine 375 l/puits 1 fois 10 min 2. Lavages : DMF 1500 l/puits 6 fois 2 min 3. Couplages : a. Aa/HOBt 0,5M 500 ul/puits
HBTU 0,5M 500 ul/puits
DIEA 2M 250 ul/puits 1 fois 20 min Lavages DMF 1500 ul/puits 2 fois 2 min b. Aa/HOBt 0,5M 500 ul/puits
HATU 0,5M 500 ul/puits
DIEA 2M 250 ul/puits 1 fois 20 min 4. Lavages DMF 1500 ul/puits 4 fois 2 min
DCM 1500 ul/puits 3 fois 1 min 5. Acétylation mélange
1500 ul/puits 1 fois 10 min 6. Lavages DCM 1500 ul/puits 3 fois 1 min
DMF 1500 ul/puits 4 fois 2 min ≈Mélange utilisé : Anhydride acétique 10 %, DIEA 5 % dans le DCM I. Synthesis protocol Preliminary washes: DCM 1500 ul / well 3 times 5 min
DMF 1500 l / well 3 times 10 min 1. Deprotections: a. DMF 1125 μl / piperidine well 375 l / well 1 time 2 min rinse: DMF 1500 μl / well drain b. DMF 1125 μl / piperidine well 375 l / well 1 time 10 min 2. Washings: DMF 1500 l / well 6 times 2 min 3. Couplings: a. Aa / HOBt 0.5M 500 μl / well
HBTU 0.5M 500 μl / well
DIEA 2M 250 μl / well 1 time 20 min Wash DMF 1500 μl / well 2 x 2 min b. Aa / HOBt 0.5M 500 μl / well
0.5m HATU 500 μl / well
DIEA 2M 250 μl / well 1 time 20 min 4. DMF washes 1500 μl / well 4 times 2 min
DCM 1500 ul / well 3 times 1 min 5. Acetylation mixture
1500 μl / well once 10 min 6. DCM washes 1500 μl / well 3 times 1 min
DMF 1500 μl / well 4 x 2 min ≈ Mixture used: Acetic anhydride 10%, DIEA 5% in DCM
<Desc/Clms Page number 17> <Desc / Clms Page number 17>
Le cycle comprenant les étapes 1 à 6 est répété n fois jusqu'à l'obtention des séquences désirées. Après le dernier cycle de couplage, la fonction a-NH2 du peptidylrésine est déprotégée à l'aide de pipéridine comme décrit dans l'étape 1. The cycle comprising steps 1 to 6 is repeated n times until the desired sequences are obtained. After the last coupling cycle, the α-NH 2 function of peptidylresin is deprotected with piperidine as described in step 1.
En fin de synthèse, les peptidylrésines sont lavés : Lavages DMF 1500 fil/puits 4 fois 2 min
DCM 1500 fil/puits 4 fois 3 min avant d'être séchés pendant 3 heures sous azote. At the end of the synthesis, the peptidylresins are washed: Washing DMF 1500 wire / well 4 times 2 min
DCM 1500 wire / well 4 times 3 min before being dried for 3 hours under nitrogen.
II. Clivage des peptidylrésines et récupération des peptides
Les peptides sont ensuite clivés de la résine et les fonctions des chaînes latérales des acides aminés sont déprotégées par réaction pendant 3 h à température ambiante du peptidylrésine avec un mélange de clivage dont la composition est la suivante (100 mg de peptidylrésine pour 1,5 ml du mélange) : - TFA 82,5 % ; - H20 5 %; - EDT 2,5 % ; - Thioanisol 5 % ; - Phénol 5 %. II. Cleavage of peptidylresins and recovery of peptides
The peptides are then cleaved from the resin and the functions of the side chains of the amino acids are deprotected by reaction for 3 hours at room temperature of the peptidylresin with a cleavage mixture whose composition is as follows (100 mg of peptidylresin per 1.5 ml of the mixture): - TFA 82.5%; - H20 5%; - 2.5% EDT; - Thioanisol 5%; - Phenol 5%.
La résine est séparée du peptide par simple filtration. Le peptide est ensuite précipité par addition de diéthyléther à 4 C. Le peptide brut est récupéré par centrifugation à 3000 tr/min pendant 3 min. Après trois lavages à l'éther, le peptide est repris à l'aide d'une solution aqueuse d'acide acétique puis lyophilisé. The resin is separated from the peptide by simple filtration. The peptide is then precipitated by adding diethyl ether at 4 ° C. The crude peptide is recovered by centrifugation at 3000 rpm for 3 min. After washing with ether three times, the peptide is taken up in an aqueous acetic acid solution and then lyophilized.
III. Purification des peptides
Les peptides sont repris dans un mélange d'acide acétique et d'eau et purifiés par RP-HPLC semi-préparative sur une colonne C4 ou CI 8. Le système d'élution étant un gradient H2O et acétonitrile en présence de 0,1 % de TFA. III. Purification of peptides
The peptides are taken up in a mixture of acetic acid and water and purified by semi-preparative RP-HPLC on a C4 or Cl 8 column. The elution system is a gradient of H 2 O and acetonitrile in the presence of 0.1%. of TFA.
IV. Analyses des peptides
La pureté du peptide est vérifiée par RP-HPLC en phase inverse. L'identité du peptide est confirmée par spectrométrie de masse de type ES-MS. IV. Peptide analyzes
The purity of the peptide is verified by RP-HPLC in reverse phase. The identity of the peptide is confirmed by ES-MS mass spectrometry.
<Desc/Clms Page number 18> <Desc / Clms Page number 18>
Caractéristiques des nonapeptides synthétisés : pureté des peptides : 85 % (RP-HPLC) identité des peptides: en accord avec la masse attendue (ES-MS) Abréviations : Aa : Fmoc acide aminé Boc : Tertiobutyloxycarbonyl DCM : Dichlorométhane DIEA : Diisopropyléthylamine DMF : Diméthylformamide EDT : Ethanedithiol ES-MS : Electrospray Mass Spectrometry Fmoc : 9-Fluorénylméthoxycarbonyl HATU : 0-(7-azabenzotriazol-l-yl)-l,l,3,3,-tétraméthyluronium hexafluorophosphate HBTU : 2-(lH-Benzotriazole-l-yl)-l,l,3,3-tétraméthyluronium hexafluorophosphate HOBt : Hydroxybenzotriazole NMP : N-méthyl-2-pyrrolidone Pmc : 2,2,5,7,8-Pentaméthyl-chroman-6-sulfonyl RP-HPLC : Reverse Phase - High Performance Liquide Chromatography TBu(OtBu): Tertiobutyl TFA : Trifluoroacetic acid Trt : Trityl Tableau 1 : Séquences des nonapeptides de la sous-unité [3 de l'hCG synthétisés (SEQ ID Nos. 3 à 159) MEMFQGLLLI (3) GTWASKEPL (4) NATLAVEKE (5) VNTTICAGY (6) LQGVLPALP (7) DVRFESIRL (8) EMFQGLLLL (9) TWASKEPLR (10) ATLAVEKEG (11) NTTICAGYC (12) QGVLPALPQ (13) VRFESIRLP (14) Characteristics of the synthesized nonapeptides: purity of the peptides: 85% (RP-HPLC) identity of the peptides: in agreement with the expected mass (ES-MS) Abbreviations: Aa: Fmoc amino acid Boc: Tertiobutyloxycarbonyl DCM: Dichloromethane DIEA: Diisopropylethylamine DMF: Dimethylformamide EDT: Ethanedithiol ES-MS: Electrospray Mass Spectrometry Fmoc: 9-Fluorenylmethoxycarbonyl HATU: O- (7-azabenzotriazol-1-yl) -1,1,3,3-tetramethyluronium hexafluorophosphate HBTU: 2- (1H-Benzotriazole-1) -yl) -1,1,3,3-tetramethyluronium hexafluorophosphate HOBt: Hydroxybenzotriazole NMP: N-methyl-2-pyrrolidone Pmc: 2,2,5,7,8-Pentamethyl-chroman-6-sulfonyl RP-HPLC: Reverse Phase-High Performance Liquid Chromatography TBu (OtBu): Tertiobutyl TFA: Trifluoroacetic acid Trt: Trityl Table 1: Sequences of nonapeptides of the subunit [3 of hCG synthesized (SEQ ID Nos. 3 to 159) MEMFQGLLLI (3) GTWASKEPL (4) NATLAVEKE (5) VNTTICAGY (6) LQGVLPALP (7) DVRFESIRL (8) EMFQGLLLL (9) ) TWASKEPLR (10) ATLAVEKEG (11) NTTICAGYC (12) QGVLPALPQ (13) VRFESIRLP (14)
<Desc/Clms Page number 19><Desc / Clms Page number 19>
MFQGLLLLL (15) WASKEPLRP (16) TLAVEKEGC (17) TTICAGYCP (18) GVLPALPQV (19) RFESIRLPG (20) FQGLLLLLL (21) ASKEPLRPR (22) LAVEKEGCP (23) TICAGYCPT (24) VLPALPQVV (25) FESIRLPGC (26) QGLLLLLLL (27) SKEPLRPRC (28) AVEKEGCPV (29) ICAGYCPTM (30) LPALPQVVC (31) ESIRLPGCP (32) GLLLLLLLS (33) KEPLRPRCR (34) VEKEGCPVC (35) CAGYCPTMT (36) PALPQVVCN (37) SIRLPGCPR (38) LLLLLLLSM (39) EPLRPRCRP (40) EKEGCPVCI (41) AGYCPTMTR (42) ALPQVVCNY (43) IRLPGCPRG (44) LLLLLLSMG (45) PLRPRCRPI (46) KEGCPVCIT (47) GYCPTMTRV (48) LPQVVCNYR (49) RLPGCPRGV (50) LLLLLSMGG (51) LRPRCRPIN (52) EGCPVCITV (53) YCPTMTRVL (54) PQVVCNYRD (55) LPGCPRGVN (56) LLLLSMGGT (57) RPRCRPINA (58) GCPVCITVN (59) CPTMTRVLQ (60) QVVCNYRDV (61) PGCPRGVNP (62) LLLSMGGTW (63) PRCRPINAT (64) CPVCITVNT (65) PTMTRVLQG (66) VVCNYRDVR (67) GCPRGVNPV (68) LLSMGGTWA (69) RCRPINATL (70) PVCITVNTT (71) TMTRVLQGV (72) VCNYRDVRF (73) CPRGVNPVV (74) LSMGGTWAS (75) CRPINATLA (76) VCITVNTTI (77) MTRVLQGVL (78) CNYRDVRFE (79) PRGVNPVVS (80) SMGGTWASK (81) RPINATLAV (82) CITVNTTIC (83) TRVLQGVLP (84) NYRDVRFES (85) RGVNPVVSY (86) MGGTWASKE (87) PINATLAVE (88) ITVNTTICA (89) RVLQGVLPA (90) YRDVRFESI (91) GVNPVVSYA (92) GGTWASKEP (93) INATLAVEK (94) TVNTTICAG (95) VLQGVLPAL (96) RDVRFESIR (97) VNPVVSYAV (98) NPVVSYAVA (99) LSCQCALCR(100) RSTTDCGGP (101) KDHPLTCDD (102) PRFQDSSSS (103) KAPPPSLPS (104) PVVSYAVAL (105) SCQCALCRR (106) STTDCGGPK (107) DHPLTCDDP (108) RFQDSSSSK (109) APPPSLPSP (110) VVSYAVALS (111) CQCALCRRS (112) TTDCGGPKD (113) HPLTCDDPR (114) FQDSSSSKA (115) PPPSLPSPS (116) VSYAVALSC (117) QCALCRRST (118) TDCGGPKDH (119) PLTCDDPRF (120) QDSSSSKAP (121) PPSLPSPSR (122) SYAVALSCQ (123) CALCRRSTT (124) DCGGPKDHP (125) LTCDDPRFQ (126) DSSSSKAPP (127) PSLPSPSRL (128) YAVALSCQC (129) ALCRRSTTD (130) CGGPKDHPL (131) TCDDPRFQD (132) SSSSKAPPP (133) SLPSPSRLP (134) AVALSCQCA (135) LCRRSTTDC (136) GGPKDHPLT (137) CDDPRFQDS (138) MFQGLLLLL (15) WASKEPLRP (16) TLAVEKEGC (17) TTICAGYCP (18) GVLPALPQV (19) RFESIRLPG (20) FQGLLLLLL (21) ASKEPLRPR (22) LAVEKEGCP (23) TICAGYCPT (24) VLPALPQVV (25) FESIRLPGC (26) QGLLLLLLL 27) SKEPLRPRC (28) AVEKEGCPV (29) ICAGYCPTM (30) LPALPQVVC (31) ESIRLPGCP (32) GLLLLLLLS (33) KEPLRPRCR (34) VEKEGCPVC (35) CAGYCPTMT (36) PALPQVVCN (37) SIRLPGCPR (38) LLLLLLLSM (39) EPLRPRCRP (40) EKEGCPVCI (41) AGYCPTMTR (42) ALPQVVCNY (43) IRLPGCPRG (44) LLLLLLSMG (45) PLRPRCRPI (46) KEGCPVCIT (47) GYCPTMTRV (48) LPQVVCNYR (49) RLPGCPRGV (50) LLLLLSMGG (51) LRPRCRPIN (47) 52) EGCPVCITV (53) YCPTMTRVL (54) PQVVCNYRD (55) LPGCPRGVN (56) LLLLSMGGT (57) RPRCRPINA (58) GCPVCITVN (59) CPTMTRVLQ (60) QVVCNYRDV (61) PGCPRGVNP (62) LLLSMGGTW (63) PRCRPINAT (64) CPVCITVNT (65) PTMTRVLQG (66) VVCNYRDVR (67) GCPRGVNPV (68) LLSMGGTWA (69) RCRPINATL (70) PVCITVNTT (71) TMTRVLQGV (72) VCNYRDVRF (73) CPRGVNPVV (74) LSMGGTWAS (75) CRPINATLA (76) VCITVNTTI (69) 77) MTRVLQGVL (78) CNYRDVRFE (79) PRGVNPVVS (80) SMGGTWASK (81) RPINATLAV (82) CITVNTTIC (83) TRVLQGVLP (84) NYRDVRFES (85) RGVNPVVSY (86) MGGTWASKE (87) PINATLAVE (88) ITVNTTICA (89) RVLQGVLPA (90) YRDVRFESI (91) GVNPVVSYA (92) GGTWASKEP (93) INATLAVEK (94) TVNTTICAG (95) VLQGVLPAL (96) RDVRFESIR (97) VNPVVSYAV (98) NPVVSYAVA (99) LSCQCALCR (100) RSTTDCGGP (101) KDHPLTCDD (102) PRFQDSSSS (103) KAPPPSLPS (104) PVVSYAVAL (105) SCQCALCRR (106) STTDCGGPK (107) DHPLTCDDP (108) RFQDSSSSK (109) APPPSLPSP (110) VVSYAVALS (111) CQCALCRRS (112) TTDCGGPKD (113) HPLTCDDPR (114) FQDSSSSKA (115) PPPSLPSPS (116) VSYAVALSC (117) QCALCRRST (118) TDCGGPKDH (119) PLTCDDPRF (120) QDSSSSKAP (121) PPSLPSPSR (122) SYAVALSCQ (123) CALCRRSTT (124) DCGGPKDHP (125) LTCDDPRFQ (126) DSSSSKAPP (127) PSLPSPSRL (128) YAVALSCQC (129) ALCRRSTTD (130) CGGPKDHPL (131) TCDDPRFQD (132) SSSSKAPPP (133) SLPSPSRLP (134) AVALSCQCA (135) LCRRSTTDC (136) GGPKDHPLT (137) CDDPRFQDS (138)
<Desc/Clms Page number 20><Desc / Clms Page number 20>
SSSKAPPPS (139) LPSPSRLPG (140) VALSCQCAL (141) CRRSTTDCG (142) GPKDHPLTC (143) DDPRFQDSS (144) SSKAPPPSL (145) PSPSRLPGP (146) ALSCQCALC (147) RRSTTDCGG (148) PKDHPLTCD (149) DPRFQDSSS (150) SKAPPPSLP (151) SPSRLPGPS (152) PSRLPGPSD (153) SRLPGPSDT (154) RLPGPSDTP (155) LPGPSDTPI (156) PGPSDTPIL (157) GPSDTPILP (158) PSDTPILPQ (159) 1 Le nombre mis entre parenthèse pour chacun des nonapeptides représente le numéro de la séquence SEQ ID identifié dans la liste des séquences ci-après. SPSKAPPPS (139) LPSPSRLPG (140) VALSCQCAL (141) CRRSTTDCG (142) GPKDHPLTC (143) DDPRFQDSS (144) SSKAPPPSL (145) PSPSRLPGP (146) ALSCQCALC (147) RRSTTDCGG (148) PKDHPLTCD (149) DPRFQDSSS (150) SKAPPPSLP 151) SPSRLPGPS (152) PSRLPGPSD (153) SRLPGPSDT (154) RLPGPSDTP (155) LPGPSDTPI (156) PGPSDTPIL (157) GPSDTPILP (158) PSDTPILPQ (159) 1 The number in parentheses for each nonapeptide represents the number of the sequence SEQ ID identified in the sequence listing below.
Tableau II : Dénomination et séquences des nonapeptides issus de la modification du peptide ci-après dénommée 7. 3 (SEQ ID No. 9) en position 1,2, 4,6 ou 9 (en caractères gras)
<tb>
<tb> Dénomination <SEP> du, <SEP> @
<tb> Dénomination <SEP> du <SEP> Séquence <SEP> du <SEP> nonapeptide <SEP> SEQ <SEP> ID <SEP> No. <SEP>
<tb> nonapeptide <SEP> @
<tb> 20. <SEP> 2 <SEP> IMFQGLLLL <SEP> 160
<tb> 20.3 <SEP> LMFQGLLLL <SEP> 161 <SEP>
<tb> 20.4 <SEP> FMFQGLLLL <SEP> 162
<tb> 20.5 <SEP> KMFQGLLLL <SEP> 163
<tb> 20.6 <SEP> MMFQGLLLL <SEP> 164
<tb> 20.7 <SEP> YMFQGLLLL <SEP> 165
<tb> 20.8 <SEP> VMFQGLLLL <SEP> 166
<tb> 20.9 <SEP> ELFQGLLLL <SEP> 167 <SEP>
<tb> 20.10 <SEP> EMFKGLLLL <SEP> 168 <SEP>
<tb> 20.11 <SEP> EMFEGLLLL <SEP> 169 <SEP>
<tb> 20.12 <SEP> EMFQGVLLL <SEP> 170 <SEP>
<tb> 20.13 <SEP> EMFQGLLLV <SEP> 171 <SEP>
<tb> <Tb>
<tb> Denomination <SEP> of, <SEP> @
<tb> Name <SEP> of <SEP> Sequence <SEP> of <SEP> nonapeptide <SEP> SEQ <SEP> ID <SEP> No. <SEP>
<tb> nonapeptide <SEP> @
<tb> 20. <SEP> 2 <SEP> IMFQGLLLL <SEP> 160
<tb> 20.3 <SEP> LMFQGLLLL <SEP> 161 <SEP>
<tb> 20.4 <SEP> FMFQGLLLL <SEP> 162
<tb> 20.5 <SEP> KMFQGLLLL <SEP> 163
<tb> 20.6 <SEP> MMFQGLLLL <SEP> 164
<tb> 20.7 <SEP> YMFQGLLLL <SEP> 165
<tb> 20.8 <SEP> VMFQGLLLL <SEP> 166
<tb> 20.9 <SEP> ELFQGLLLL <SEP> 167 <SEP>
<tb> 20.10 <SEP> EMFKGLLLL <SEP> 168 <SEP>
<tb> 20.11 <SEP> EMFEGLLLL <SEP> 169 <SEP>
<tb> 20.12 <SEP> EMFQGVLLL <SEP> 170 <SEP>
<tb> 20.13 <SEP> EMFQGLLLV <SEP> 171 <SEP>
<Tb>
<Desc/Clms Page number 21><Desc / Clms Page number 21>
Tableau III : Dénomination et séquences des nonapeptides de la sous-unité [3 de l'hCG modifiés en position 1 par une tyrosine
<tb>
<tb> Dénomination <SEP> Séquence <SEP> du <SEP> nonapeptide <SEP> SEQ <SEP> ID <SEP> No. <SEP>
<tb> du <SEP> nonapeptide
<tb> 10.15 <SEP> YLQGVLPAL <SEP> 172
<tb> (peptide <SEP> 7. <SEP> 2 <SEP> (SEQ <SEP> ID <SEP> No. <SEP> 96) <SEP> modifié <SEP> en <SEP> position <SEP> 1)
<tb> 10.18 <SEP> YLPGCPRGV <SEP> 173
<tb> ~~~~~(peptide <SEP> 8. <SEP> 6 <SEP> (SEQ <SEP> ID <SEP> No. <SEP> 50) <SEP> modifié <SEP> en <SEP> position <SEP> 1)
<tb>
Exemple 2 : Identification de peptides de la sshGC se fixant sur les molécules HLA A2. <Tb>
<tb> Denomination <SEP> Sequence <SEP> of the <SEP> nonapeptide <SEP> SEQ <SEP> ID <SEP> No. <SEP>
<tb> of the <SEP> nonapeptide
<tb> 10.15 <SEP> YLQGVLPAL <SEP> 172
<tb> (peptide <SEP> 7. <SEP> 2 <SEP> (SEQ <SEP> ID <SEP> No. <SEP> 96) <SEP> modified <SEP> in <SEP> position <SEP> 1)
<tb> 10.18 <SEP> YLPGCPRGV <SEP> 173
<tb> ~~~~~ (peptide <SEP> 8. <SEP> 6 <SEP> (SEQ <SEP> ID <SEP> No. <SEP> 50) <SEP> modified <SEP> in <SEP> position <SEP> 1)
<Tb>
Example 2 Identification of peptides of the sshGC binding to the HLA A2 molecules.
Afin de faire un criblage rapide des 157 nonapeptides synthétisés, ces derniers ont été évalués, dans un premier temps, par l'étude de leur capacité à se fixer au complexe HLA A2, propriété nécessaire à toute initiation d'une réponse immunitaire de type cytotoxique. Pour ce faire, la lignée cellulaire T2 a été utilisée. In order to make a rapid screening of the 157 nonapeptides synthesized, the latter were evaluated, initially, by the study of their capacity to bind to the HLA A2 complex, a property necessary for any initiation of a cytotoxic immune response. . To do this, the T2 cell line was used.
La lignée T2 est une lignée lymphocytaire humaine correspondant à un hybride cellules T/cellules B, exprimant constitutivement HLA A2. The T2 line is a human lymphocyte line corresponding to a hybrid T cells / B cells, constitutively expressing HLA A2.
Ces cellules, déficientes en transporteur TAP, expriment peu de molécules HLA A2 à leur surface. En absence de peptide, le complexe HLA A2-p2 microglobuline est en permanence recyclé dans la cellule et un niveau basal de complexe est observé à la surface de la cellule. La présence d'un peptide exogène se fixant sur les molécules HLA A2 stabilise le complexe plus ou moins longtemps, en fonction de son affinité, empêchant la réinternalisation des molécules HLA A2 et induisant ainsi une augmentation du nombre de molécules HLA A2 à la surface de la cellule T2. These cells, deficient in TAP transporter, express few HLA A2 molecules on their surface. In the absence of peptide, the HLA A2-p2 microglobulin complex is continuously recycled into the cell and a basal level of complex is observed on the surface of the cell. The presence of an exogenous peptide binding to the HLA A2 molecules stabilizes the complex for a shorter or longer time, depending on its affinity, preventing the reinternalisation of the HLA A2 molecules and thus inducing an increase in the number of HLA A2 molecules on the surface of the T2 cell.
Les 157 nonapeptides de la protéine ss-hCG ont été testés pour leur capacité à induire une stabilisation des molécules HLA A2 à la surface des cellules T2. The 157 nonapeptides of the ss-hCG protein were tested for their ability to induce stabilization of HLA A2 molecules on the T2 cell surface.
Les résultats (tableau IV) montrent que 7 peptides natifs parmi les 157 synthétisés sont capables d'induire une augmentation de l'expression de HLA A2 à la surface des cellules T2. The results (Table IV) show that 7 native peptides among the 157 synthesized are capable of inducing an increase in HLA A2 expression on the surface of T2 cells.
Ces peptides sont : 7.2 ; 7.3 ;7.11 ; 7.38 ; 8.6 ; 13.16 et 13.17. These peptides are: 7.2; 7.3, 7.11; 7.38; 8.6; 13.16 and 13.17.
<Desc/Clms Page number 22> <Desc / Clms Page number 22>
Le tableau IV présente également 4 peptides mutés (les résidus mutés sont figurés en gras), le 20. 7, 20. 4, 20. 2 (peptides mutés du 7. 3) et 10. 18 (peptide muté du 8. 6) dont l'activité est significativement augmentée par rapport aux peptides natifs. Table IV also shows 4 mutated peptides (the mutated residues are shown in bold), 20. 7, 20. 4, 20. 2 (mutated peptides of 7. 3) and 10. 18 (mutated peptide of 8. 6). whose activity is significantly increased compared to native peptides.
L'augmentation de l'expression de HLA A2 induite par les peptides de p-hCG a été comparée à celle induite par le peptide de référence Flu Ml 58-66. The increase in HLA A2 expression induced by the p-hCG peptides was compared to that induced by the reference peptide Flu Ml 58-66.
Tableau IV : de la ss-hCG se fixant sur les molécules HLA A2 des cellules T2
Exemple 3 : de la sécrétion de IFN-y par les lymphocytes T humain, induite par les peptides de la p-hCG
Les peptides positifs, décrits dans le tableau IV ont ensuite été testés sur des cellules T cytotoxiques CD8+ de patients cancéreux, pour leur capacité à induire une sécrétion d'interféron y par ces cellules. Table IV: ss-hCG binding to T2 HLA A2 molecules
Example 3: secretion of IFN-γ by human T lymphocytes, induced by the peptides of p-hCG
The positive peptides described in Table IV were then tested on CD8 + cytotoxic T cells of cancer patients for their ability to induce secretion of interferon γ by these cells.
Brièvement, 106 cellules de sang périphérique, obtenues après Ficoll sont reprises en RPMI-10 % SVF dans des tubes de 15 ml en polypropylène et mises en Briefly, 106 peripheral blood cells obtained after Ficoll are taken up in RPMI-10% FCS in polypropylene 15 ml tubes and
<Desc/Clms Page number 23><Desc / Clms Page number 23>
présence de 100 l de peptide à tester, à une concentration de 10 g/ml (solution mère à 4 mg/ml) pendant 2 h à 37 C dans un incubateur. Huit cents microlitres de RPMI-10 % SVF contenant 12,5 ug/ml de Bréfeldine A, bloquant la sécrétion de cytokines, sont ajoutés puis les tubes sont replacés pendant 4 heures dans l'incubateur, à 37 C. presence of 100 l of test peptide, at a concentration of 10 g / ml (stock solution at 4 mg / ml) for 2 h at 37 ° C. in an incubator. Eight hundred microliters of RPMI-10% FCS containing 12.5 μg / ml of Brefeldin A, blocking the secretion of cytokines, are added and the tubes are then returned to the 37 ° C incubator for 4 hours.
A la fin de la période d'incubation, 100 l de PBS-EDTA 20 mM froid sont ajoutés puis après 5 minutes, les cellules sont centrifugées et remises en suspension dans 100 l de PBS-1 % BSA-0,01 % NaN3, contenant 0,7 l d'anticorps anti-CD8 couplé à l'allophycocyanine (APC). At the end of the incubation period, 100 l of cold 20 mM PBS-EDTA are added and then after 5 minutes, the cells are centrifuged and resuspended in 100 l of PBS-1% BSA-0.01% NaN 3, containing 0.7 l of anti-CD8 antibody coupled to allophycocyanin (APC).
Après transfert en plaque 96 puits à fonds coniques, les cellules sont incubées 20 minutes à 4 C puis fixées 10 minutes, à l'obscurité, à température ambiante avec 100 l de paraformaldéhyde (PFA) 2 % dans du PBS. Après deux lavages en PBS, 50 l de PBS-Hepes 1 mM-Saponine 0,1 %, contenant 0,4 l d'anticorps anti-IFN-y couplé au FITC (solution mère à 0,5 mg/ml) sont ajoutés sur les culots cellulaires, dans chaque puits. Après 30 minutes d'incubation à 4 C, les cellules sont lavées deux fois puis transférées dans des tubes Micronic, pour une analyse par cytométrie en flux. After transferring to a 96-well plate with conical bottoms, the cells are incubated for 20 minutes at 4 ° C. and then fixed for 10 minutes, in the dark, at room temperature with 100 l of 2% paraformaldehyde (PFA) in PBS. After two washes in PBS, 50 l of 1 mM-Saponin 0.1% PBS-Hepes, containing 0.4 l of FITC-coupled anti-IFN-γ antibody (stock solution at 0.5 mg / ml) are added. on the cell pellets, in each well. After 30 minutes of incubation at 4 ° C., the cells are washed twice and then transferred to Micronic tubes for flow cytometric analysis.
L'analyse des 7 peptides de la ss-hCG, sélectionnés sur les cellules T2, a montré chez une patiente, atteint d'un cancer du sein, une fréquence de cellules T CD8 sécrétant de l'IFN-y plus élevée, lorsque les cellules étaient incubées avec le peptide 7.3 (EMFQGLLLL, SEQ ID No. 9). Analysis of the 7 ss-hCG peptides, selected on T2 cells, showed a breast cancer patient with a higher IFN-y secreting CD8 T cell frequency when the cells were incubated with peptide 7.3 (EMFQGLLLL, SEQ ID No. 9).
L'analyse par cytométrie en flux de la sécrétion de l'IFN-y par les lymphocytes T CD8, présentée dans les figures 1A et 1B, montre qu'en présence du peptide 7. 3, 0,31 % des lymphocytes T CD8 sécrètent de l'IFN-y (figure 1B) alors qu'en présence d'un peptide irrelevant, 0,03 % des T CD8 sont positifs en sécrétion d'IFN-y (figure 1A). Flow cytometric analysis of IFN-γ secretion by CD8 T cells, shown in Figures 1A and 1B, shows that in the presence of peptide 7.3, 0.31% of CD8 T cells secrete of IFN-γ (FIG. 1B) whereas in the presence of an irrelevant peptide, 0.03% of the CD8 T are positive for the secretion of IFN-γ (FIG. 1A).
Exemple 4 : Vérification de l'activité CTL des peptides décrits dans le tableau IV dans un modèle de souris transgéniques HLA A2/kb. Example 4: Verification of the CTL activity of the peptides described in Table IV in a HLA A2 / kb transgenic mouse model.
Parallèlement aux mesures d'interféron y chez les patients, chacun des peptides décrits ci-dessus dans le tableau IV et, certains de leurs analogues, ont été testés pour l'induction d'une réponse de type cytotoxique (CTL) chez la souris HLA A2/Kb. Pour ce faire, ces peptides ont été administrés individuellement, par voie sous cutanée. Deux injections constituées de 100 g de peptide + 300 ug de P40 ont été effectuées, en présence d'adjuvant incomplet de Freund (AFI) (mélange volume à volume), à une In parallel with interferon-γ measurements in patients, each of the peptides described above in Table IV and some of their analogues were tested for induction of a cytotoxic (CTL) response in HLA mice. A2 / Kb. To do this, these peptides were administered individually, subcutaneously. Two injections consisting of 100 g of peptide + 300 μg of P40 were performed, in the presence of incomplete Freund's adjuvant (AFI) (volume-to-volume
<Desc/Clms Page number 24><Desc / Clms Page number 24>
semaine d'intervalle. Dix jours après la dernière injection, les cellules des ganglions inguinaux et para aortiques sont mises en culture en présence d'IL2 et de cellules présentatrices fixées et chargées avec le peptide à tester. Sept jours après cette première stimulation, une seconde stimulation des cellules effectrices est effectuée suivie, après 5 jours d'une évaluation de l'activité cytotoxique par un test de relarguage de 51Cr. Ce test consiste à incuber des cellules EL4 A2/kb chargées avec le peptide avec différents ratio de cellules effectrices issues de la mise en culture et d'évaluer l'activité cytotoxique de ces cellules effectrices par calcul de la quantité de 5'Cr relarguée par les cellules cibles lors de leur lyse par les cellules effectrices selon la formule : (lyse des cellules cibles chargées - lyse spontanée)/ (lyse totale des cellules cibles chargées-lyse spontanée) x 100. week apart. Ten days after the last injection, the inguinal and para-aortic ganglia cells are cultured in the presence of IL2 and presenting cells fixed and loaded with the test peptide. Seven days after this first stimulation, a second stimulation of the effector cells is performed followed, after 5 days of evaluation of the cytotoxic activity by a 51 Cr release test. This test consists in incubating peptide-loaded EL4 A2 / kb cells with different ratios of effector cells resulting from culturing and evaluating the cytotoxic activity of these effector cells by calculating the amount of 5'Cr salted out by target cells when lysed by effector cells according to the formula: (lysis of charged target cells - spontaneous lysis) / (total lysis of charged target cells - spontaneous lysis) x 100.
Dans cette formule, la lyse des cellules cibles correspond pour chaque ratio à la mise en contact des cellules cibles et des cellules effectrices ; la lyse spontanée correspond au relarguage spontané de 51Cr des cellules cibles en absence de toute autre cellule et la lyse totale correspond au relarguage maximum de 51Cr lors d'une lyse de la totalité des cellules cibles par addition de triton XI 00. In this formula, the lysis of the target cells corresponds for each ratio to the contacting of the target cells and the effector cells; spontaneous lysis corresponds to the spontaneous release of 51Cr of the target cells in the absence of any other cell and the total lysis corresponds to the maximum release of 51Cr during lysis of all the target cells by addition of triton XI 00.
Afin de déterminer la spécificité de la réaction, un témoin est effectué en remplaçant les cellules cibles chargées avec le peptide par des cellules cibles non chargées qui ne doivent donc pas être reconnues par les cellules effectrices et par conséquent ne doivent pas être lysées par ces dernières. In order to determine the specificity of the reaction, a control is carried out by replacing the target cells loaded with the peptide with uncharged target cells which therefore do not have to be recognized by the effector cells and therefore must not be lysed by the latter. .
Par ailleurs, les souris HLA A2/Kb étant des souris chimériques pour le complexe d'histocompatibilité de classe I, l'expérience ci-dessus a également été répétée sur des souris C57/B16 d'haplotype Kb afin de vérifier la part de la participation du classe I murin dans la présentation des peptides. Moreover, the HLA A2 / Kb mice being chimeric mice for the class I histocompatibility complex, the above experiment was also repeated on Kb-haplotype C57 / B16 mice in order to verify the part of the participation of murine class I in the presentation of peptides.
Les figures 2A à 2E et 3A à 3E ci-après montrent que parmi tous les peptides testés, seul un peptide natif, le 7. 3 est capable de générer une réponse CTL significative chez les souris HLA A2 Kb (figure 2A). Les résultats obtenus avec le peptide 7.3 sont en parfait accord avec ceux observés chez l'une des patientes testées dans l'exemple 3. Figures 2A to 2E and 3A to 3E below show that among all the peptides tested, only a native peptide, the 7. 3 is able to generate a significant CTL response in HLA A2 Kb mice (Figure 2A). The results obtained with the peptide 7.3 are in perfect agreement with those observed in one of the patients tested in Example 3.
Il faut cependant noter que ce peptide semble également capable d'être reconnu dans le contexte du classe I murin puisque l'induction d'une réponse CTL est observée chez la souris C57/B16 (figure 2B). Des peptides dérivés du 7.3 ont également été testés (figures It should be noted, however, that this peptide also seems to be capable of being recognized in the context of murine class I since the induction of a CTL response is observed in C57 / B16 mice (FIG. 2B). Peptides derived from 7.3 were also tested (Figures
<Desc/Clms Page number 25><Desc / Clms Page number 25>
2C, 2D, 2E). Il s'agit des peptides 20. 2, 20. 4 et 20. 7 modifiés en position 1 par remplacement du résidu acide glutamique par l'isoleucine, la phénylalanine et la tyrosine respectivement. Les données présentées dans les figures 2C, 2D et 2E montrent que le remplacement du glutamate par la tyrosine en position 1 (peptide 20. 7) augmente significativement l'induction de la réponse cytotoxique du peptide muté par rapport au peptide natif. Le remplacement du glutamate par la phénylalanine en position 1 (peptide 20. 4) est sans effet sur la cinétique et l'intensité de la réponse CTL. En revanche, la substitution du glutamate par l'isoleucine (peptide 20. 2) semble avoir un effet négatif sur l'induction de la réponse cytotoxique. 2C, 2D, 2E). These are peptides 20. 2, 20. 4 and 20. 7 modified in position 1 by replacement of the glutamic acid residue with isoleucine, phenylalanine and tyrosine respectively. The data presented in FIGS. 2C, 2D and 2E show that the replacement of glutamate by tyrosine in position 1 (peptide 20.sup.7) significantly increases the induction of the cytotoxic response of the mutated peptide relative to the native peptide. Replacement of glutamate with phenylalanine at position 1 (peptide 20. 4) has no effect on the kinetics and intensity of the CTL response. On the other hand, the substitution of glutamate by isoleucine (peptide 20. 2) seems to have a negative effect on the induction of the cytotoxic response.
Un intérêt tout particulier a été apporté au peptide 8. 6 qui, sous sa forme native n'est pas capable de générer une réponse cytotoxique, quel que soit le type de souris utilisé (figures 3A et 3B), mais qui en revanche sous sa forme mutée en position 1 (peptide 10. 18, figures 3C et 3D) induit des réponses CTL fortes chez la souris HLA A2/Kb et nulles chez la souris C57/B16. L'importance particulière du peptide 10.18 réside en fait dans l'observation que des cellules effectrices issues de souris immunisées par ce peptide muté sont capables de lyser des cellules cibles chargées par le peptide natif 8.6.(figure 3E). Il est à noter que dans le cas du 8. 6 comme dans le cas du 7. 3, la présence d'une tyrosine en position 1 semble apporter un bénéfice particulier à l'induction de la réponse cytotoxique. Ces résultats sont en accord avec les données de la littérature publiées par l'équipe de Hans-gehorg Rammensee et al. (Immunogenetics, 41, 178-228, 1995) Of particular interest has been provided to peptide 8, which in its native form is not capable of generating a cytotoxic response, whatever the type of mouse used (FIGS. 3A and 3B), but which in contrast under its mutant form in position 1 (peptide 10-18, FIGS. 3C and 3D) induces strong CTL responses in HLA A2 / Kb mouse and zero in C57 / B16 mice. The particular importance of peptide 10.18 lies in the fact that effector cells from mice immunized with this mutated peptide are capable of lysing target cells loaded with native peptide 8.6 (FIG. 3E). It should be noted that in the case of 8. 6 as in the case of 7. 3, the presence of a tyrosine in position 1 seems to bring a particular benefit to the induction of the cytotoxic response. These results are consistent with literature data published by the team of Hans-gehorg Rammensee et al. (Immunogenetics, 41, 178-228, 1995)
Claims (23)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR0205691A FR2839452A1 (en) | 2002-05-07 | 2002-05-07 | USE OF PEPTIDE DERIVED FROM THE HCG BETA SUBUNIT TO GENERATE A CTL ANTITUMOR RESPONSE |
| PCT/FR2003/001420 WO2003095486A1 (en) | 2002-05-07 | 2003-05-07 | Use of a peptide derived from the beta-subunit of hcg in order to generate an anti-tumour ctl-type response |
| AU2003255563A AU2003255563A1 (en) | 2002-05-07 | 2003-05-07 | Use of a peptide derived from the beta-subunit of hcg in order to generate an anti-tumour ctl-type response |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR0205691A FR2839452A1 (en) | 2002-05-07 | 2002-05-07 | USE OF PEPTIDE DERIVED FROM THE HCG BETA SUBUNIT TO GENERATE A CTL ANTITUMOR RESPONSE |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| FR2839452A1 true FR2839452A1 (en) | 2003-11-14 |
Family
ID=29286342
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| FR0205691A Withdrawn FR2839452A1 (en) | 2002-05-07 | 2002-05-07 | USE OF PEPTIDE DERIVED FROM THE HCG BETA SUBUNIT TO GENERATE A CTL ANTITUMOR RESPONSE |
Country Status (3)
| Country | Link |
|---|---|
| AU (1) | AU2003255563A1 (en) |
| FR (1) | FR2839452A1 (en) |
| WO (1) | WO2003095486A1 (en) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1452868A2 (en) | 2003-02-27 | 2004-09-01 | Pepscan Systems B.V. | Method for selecting a candidate drug compound |
| FR2870847A1 (en) * | 2004-05-26 | 2005-12-02 | Pierre Fabre Medicament Sa | New polypeptides representing linear epitopes of beta-human chorionic gonadotropin, useful in vaccines e.g. for treatment or prevention of cancer, also related nucleic acid and antibodies |
| EP1844337B1 (en) | 2005-01-24 | 2013-07-03 | Pepscan Systems B.V. | Binding compounds, immunogenic compounds and peptidomimetics |
| EP1933864A4 (en) * | 2005-09-07 | 2009-12-16 | Receptor Logic Ltd | Antibodies as t cell receptor mimics, methods of production and uses thereof |
| WO2008013454A2 (en) * | 2006-07-26 | 2008-01-31 | Pepscan Systems B.V. | Immunogenic compounds and protein mimics |
| EP2130836B1 (en) * | 2008-06-03 | 2013-02-13 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Means and methods for producing zinc fingers and concatemers thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001010907A2 (en) * | 1999-08-06 | 2001-02-15 | University Of Maryland Biotechnology Institute | Therapeutic polypeptides and methods for using same |
-
2002
- 2002-05-07 FR FR0205691A patent/FR2839452A1/en not_active Withdrawn
-
2003
- 2003-05-07 AU AU2003255563A patent/AU2003255563A1/en not_active Abandoned
- 2003-05-07 WO PCT/FR2003/001420 patent/WO2003095486A1/en not_active Application Discontinuation
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001010907A2 (en) * | 1999-08-06 | 2001-02-15 | University Of Maryland Biotechnology Institute | Therapeutic polypeptides and methods for using same |
Non-Patent Citations (5)
| Title |
|---|
| DANGLES VIRGINIE ET AL: "Tumor-associated antigen human chorionic gonadotropin beta contains numerous antigenic determinants recognized by in vitro-induced CD8+ and CD4+ T lymphocytes.", CANCER IMMUNOLOGY, IMMUNOTHERAPY: CII. GERMANY FEB 2002, vol. 50, no. 12, February 2002 (2002-02-01), pages 673 - 681, XP002236556, ISSN: 0340-7004 * |
| GEISSLER M ET AL: "GENETIC IMMUNIZATION WITH THE FREE HUMAN CHORIONIC GONADOTROPIN BETA SUBUNIT ELICITS CYTOTOXIC T LYMPHOCYTE RESPONSES AND PROTECTS AGAINST TUMOR FORMATION IN MICE", LABORATORY INVESTIGATION, UNITED STATES AND CANADIAN ACADEMY OF PATHOLOGY, BALTIMORE,, US, vol. 76, no. 6, June 1997 (1997-06-01), pages 859 - 871, XP000929755, ISSN: 0023-6837 * |
| HOUSSEAU F ET AL: "REACTION OF PERIPHERAL-BLOOD LYMPHOCYTES TO THE HUMAN CHORIONIC GONADOTROPIN BETA SUB-UNIT IN PATIENTS WITH PRODUCTIVE TUMORS", INTERNATIONAL JOURNAL OF CANCER, NEW YORK, NY, US, vol. 63, no. 5, 27 November 1995 (1995-11-27), pages 633 - 638, XP000609237, ISSN: 0020-7136 * |
| TRIOZZI P L ET AL: "EFFECTS OF A BETA-HUMAN CHORIONIC GONADOTROPIN SUBUNIT IMMONOGEN ADMINISTERED IN AQUEOUS SOLUTION WITH A NOVEL NONIONIC BLOCK COPOLYMER ADJUVANT IN PATIENTS WITH ADVANCED CANCER", CLINICAL CANCER RESEARCH, THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 3, no. 12, PART 1, December 1997 (1997-12-01), pages 2355 - 2362, XP000941669, ISSN: 1078-0432 * |
| TRIOZZI P L ET AL: "Human chorionic gonadotropin as a target for cancer vaccines.", ONCOLOGY REPORTS. GREECE 1999 JAN-FEB, vol. 6, no. 1, January 1999 (1999-01-01), pages 7 - 17, XP008015526, ISSN: 1021-335X * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2003095486A1 (en) | 2003-11-20 |
| AU2003255563A1 (en) | 2003-11-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9765114B2 (en) | Method for cancer immunotherapy | |
| US20160243209A1 (en) | Tumor antigen based on products of the tumor suppressor gene wt1 | |
| ES2626115T3 (en) | Immunogenic peptides and their use in transplantation | |
| WO2011133948A2 (en) | Highly active polypeptides and methods of making and using the same | |
| MX2010006070A (en) | Cancer vaccine composition. | |
| JP2002507544A (en) | Modified antibodies with enhanced ability to elicit anti-idiotypic responses | |
| JP2003510094A (en) | MUC-1 derived peptides | |
| Miconnet et al. | Cancer vaccine design: a novel bacterial adjuvant for peptide-specific CTL induction | |
| CA2145391A1 (en) | Vaccines and antigenic conjugates | |
| ES2316191T3 (en) | NEW ANTIGENIC TUMOR PROTEIN SART-3 AND ANTIGENIC TUMOR PEPTIDE OF THE SAME. | |
| FR2839452A1 (en) | USE OF PEPTIDE DERIVED FROM THE HCG BETA SUBUNIT TO GENERATE A CTL ANTITUMOR RESPONSE | |
| EP3711775A1 (en) | Nano-particles that contain synthetic variants of gm3 ganglioside as adjuvants in vaccines | |
| Pifferi et al. | Development of synthetic, self-adjuvanting, and self-assembling anticancer vaccines based on a minimal saponin adjuvant and the tumor-associated MUC1 antigen | |
| FR2830940A1 (en) | Process for selecting ligands for human leukocyte antigen DP4, useful as immunomodulators for treating e.g. tumors, based on inhibition of binding | |
| JP2020524145A (en) | Bacterial vaccine | |
| WO2004011486A2 (en) | Method for solubilizing hydrophobic peptides and use thereof for inducing an antitumoral and/or anti-infectious ctl response | |
| EP1103561B1 (en) | Hla-a2 restraint tumor antigen peptide originating in sart-1 | |
| CN113906046A (en) | Immunogenic peptides having an oxidoreductase motif comprising a modified cysteine | |
| FR2842812A1 (en) | Solubilizing hydrophobic peptides, useful e.g. in vaccines against infectious microbes or tumors, by attachment of at least three lysine residues | |
| FR2816060A1 (en) | METHOD FOR IDENTIFYING NEW MOXULES BINDING TO THE LOX RECEPTOR AND USE OF SUCH MOLECULES | |
| WO2000050071A1 (en) | PROTEIN OmpA OF KLEBSIELLA PNEUMONIAE ASSOCIATED WITH THE HCG HORMONE OR A COMPOUND INVOLVED IN CELL PROLIFERATION OR FERTILITY | |
| FR2842811A1 (en) | Solubilizing hydrophobic peptides, useful e.g. in vaccines against infectious microbes or tumors, by attachment of at least three arginine or lysine residues | |
| CN107223133A (en) | A kind of solvable heterogeneous dimerization φt cell receptor and its preparation method and application | |
| US6838445B1 (en) | Tumor antigen peptide originating in SART-1 | |
| FR2816059A1 (en) | METHOD FOR IDENTIFYING NEW MOLECULES BINDING TO SCAVENGER RECEPTORS AND REPORTED VIA A TOLL RECEPTOR |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ST | Notification of lapse |
Effective date: 20060131 |