EP4665378A2 - Anti-angiogenic agent and methods of using such agent - Google Patents
Anti-angiogenic agent and methods of using such agentInfo
- Publication number
- EP4665378A2 EP4665378A2 EP24757617.6A EP24757617A EP4665378A2 EP 4665378 A2 EP4665378 A2 EP 4665378A2 EP 24757617 A EP24757617 A EP 24757617A EP 4665378 A2 EP4665378 A2 EP 4665378A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- polypeptide
- amino acid
- seq
- agent
- angiogenic agent
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70507—CD2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This disclosure pertains to inhibiting or preventing angiogenesis to control or treat angiogenic-dependent conditions, which are characterized by or depend upon blood vessel proliferation. Additionally, the disclosure relates to the use of an anti-angiogenic agent in combination wi th a chemotherapeutic agent.
- Angiogenesis is the process by which new blood vessels are formed from extant capillaries, while vasculogenesis involves the growth of vessels deriving from endothelial progenitor cells.
- Angiogenesis is a combinatorial process that is regulated by a balance between pro- and anti-angiogenic molecules.
- Angiogenic stimuli e.g. hypoxia or inflammatory cytokines
- VEGF vascular endothelial growth factor
- FGF fibroblast growth factor
- angiogenesis plays a role in the growth of atherosclerotic plaque, diabetic retinopathy, degenerative maculopathy, retrolental fibroplasia, idiopathic pulmonary fibrosis, acute adult respiratory distress syndrome, and asthma. Furthermore, tumor progression is associated with neovascularization, which facilitates nutrient delivery' to progressively growing tumor tissues.
- angiogenesis inhibitors have only recently become a mainstay in cancer therapeutics. Accordingly, there is an ongoing need for new methods and agents to reduce pathological angiogenesis. This disclosure aims to address this need, among others.
- FIG. 1 A displays a schematic drawing of an anti -angiogenic agent, showing the two short strands of the protein's anti-parallel P-sheet;
- FIG. IB displays another schematic drawing of an anti-angiogenic agent, showing the two short strands of the protein's anti-parallel P-sheet with the hydrophobic surface facing outward;
- FIG. 1C displays another schematic drawing of an anti-angiogenic agent, showing the two short strands of the protein's anti-parallel P-sheet with the hydrophobic surface facing inward;
- FIG. 2 displays NMR spectra of a folded (top) and an unfolded (bottom) anti- angiogenic agent and host protein;
- FIG. 3 A displays a proliferation assay companng an anti-angiogenic agent to a prior art agent (Anginex) using HUVEC cells;
- FIG. 3B displays a proliferation assay comparing an anti-angiogenic agent to aprior art agent (Anginex) using M4A4 cancer cells;
- FIG. 4A displays a graph demonstrating that tumor volume remained relatively constant during treatment with an anti-angiogenic agent (treatment started after 8 days);
- FIG. 4B displays a graph demonstrating that tumor volume remained relatively constant during treatment with an anti-angiogenic agent (treatment started after 22 days);
- FIG. 5 displays a graph showing substantial differences in tumor weights following the first treatment with an anti-angiogenic agent
- FIG. 6 displays a pictorial representation demonstrating slower tumor growth rates in mice treated with the anti-angiogenic agent compared to mice treated with buffer and host proteins;
- FIG. 7 displays results of vessel density studies in mice treated with an anti- angiogenic agent;
- FIG. 8 shows that no significant body mass changes were observed in mice across any treatment group
- FIG. 9 shows how cell viability can vary with dosage
- FIG. 10 shows a tumor growth curve over 14 days or more of treatment using different doses of the anti-angiogenic agent
- FIG. 11 shows a comparison of tumor growth curves between AVASTIN® and rProAgio-PEG
- FIG. 12 displays a graph showing the weight of the tumor at the end of the 14-day treatment course.
- FIG. 13 displays a graph representing the viability of various examples of the anti- angiogenic agent.
- angiogenesis refers to the growth, development, and remodeling of the vascular bed. aiming to improve tissue oxygenation and nutrient delivery. This process includes the formation of new capillaries by sprouting from existing blood vessels, as well as the enlargement, maturation, and modification of existing vessels in terms of direction and flow properties, ultimately optimizing blood perfusion of tissues.
- amino acid refers to naturally occurring and non-natural amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, by way of example only, an alpha-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group. Such analogs may have modified R groups (by way of example, norleucine) or may have modified peptide backbones, while still retaining the same basic chemical structure as a naturally occurring amino acid.
- Non-limiting examples of amino acid analogs include homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- “conservatively modified variants” applies to both natural and non-natural amino acid and natural and non-natural nucleic acid sequences, and combinations thereof.
- “conservatively modified variants” refers to those natural and non-natural nucleic acids which encode identical or essentially identical natural and non-natural amino acid sequences, or where the natural and non- natural nucleic acid does not encode a natural and non-natural amino acid sequence, to essentially identical sequences.
- the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
- nucleic acid variations are “silent variations.” which are one species of conservatively modified variations.
- every natural or non-natural nucleic acid sequence herein which encodes a natural or non-natural polypeptide also describes every possible silent variation of the natural or non-natural nucleic acid.
- each codon in a natural or non-natural nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
- each silent variation of a natural and non-natural nucleic acid which encodes a natural and non-natural polypeptide is implicit in each described sequence.
- an agent or a compound being administered refers to a sufficient amount of an agent or a compound being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result can be reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
- an agent or a compound being administered includes, but is not limited to, a natural amino acid polypeptide, non-natural amino acid polypeptide, modified natural amino acid polypeptide, or modified non-amino acid polypeptide.
- compositions containing such natural amino acid polypeptides, non-natural amino acid polypeptides, modified natural amino acid polypeptides, or modified non- natural amino acid polypeptides can be administered for prophylactic, enhancing, and/or therapeutic treatments.
- An appropriate “effective” amount in any individual case may be determined using techniques, such as a dose escalation study.
- nucleic acid sequence refers to the order and identity of the nucleotides comprising a nucleic acid.
- nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in single- or double-stranded form.
- the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
- Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
- terminal glycine refers to a glycine amino acid residue located at the end of a polypeptide chain.
- the term “terminal” can apply to either the N-terminus (amino end) or C-terminus (carboxyl end) of the chain. Therefore, a “terminal glycine” could be the first amino acid residue at the N-terminus or the last residue at the C- tenninus of a peptide or protein.
- the terminal glycine can be the N- Terminus.
- the terminal glycine can be the C-terminus.
- nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed- base and/or deoxyinosine residues.
- nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
- a particular nucleic acid sequence also implicitly encompasses “splice variants.”
- a particular protein encoded by a nucleic acid implicitly encompasses any protein encoded by a splice variant of that nucleic acid.
- “Splice variants” as the name suggests, are products of alternative splicing of a gene. After transcription, an initial nucleic acid transcript may be spliced such that different (alternate) nucleic acid splice products encode different polypeptides.
- Mechanisms for the production of splice variants vary, but include alternate splicing of exons. Alternate polypeptides derived from the same nucleic acid by read-through transcription are also encompassed by this definition. Any products of a splicing reaction, including recombinant forms of the splice products, are included in this definition.
- polypeptide “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- pharmaceutically acceptable refers to a material, including but not limited, to a salt, carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively nontoxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
- prophylactically effective amount refers that amount of a composition containing at least one non-natural amino acid polypeptide or at least one modified non-natural amino acid polypeptide prophylactically applied to a patient which will relieve to some extent one or more of the symptoms of a disease, condition or disorder being treated. In such prophylactic applications, such amounts may depend on the patient's state of health, weight, and the like. It is considered well within the skill of the art for one to determine such prophylactically effective amounts by routine experimentation, including, but not limited to, a dose escalation clinical trial.
- phrase “substantially similar,” in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 75%, preferably at least 85%, more preferably at least 90%, 95% or higher or any integral value therebetween nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm such as those described below for example, or by visual inspection.
- the substantial identity 7 exists over a region of the sequences that is at least about 10, preferably about 20, more preferable about 40-60 residues in length or any integral value therebetween, preferably over a longer region than 60-80 residues, more preferably at least about 90-100 residues, and most preferably the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence for example.
- synergistic refers to a combination of prophylactic or therapeutic effective agents which is more effective than the additive effects of any two or more single agents.
- a synergistic effect of a combination of prophylactic or therapeutic agents may permit the use of lower dosages of one or more of the agents and/ or less frequent administration of the agents to a subject with a specific disease or condition.
- a synergistic effect of a combination of prophylactic or therapeutic agents may be used to avoid or reduce adverse or unwanted side effects associated with the use of any single therapy.
- terapéuticaally effective amount refers to the amount of a composition containing at least one non-natural amino acid polypeptide and/or at least one modified non-natural amino acid polypeptide administered to a patient already suffering from a disease, condition or disorder, sufficient to cure or at least partially arrest, or relieve to some extent one or more of the symptoms of the disease, disorder or condition being treated.
- the effectiveness of such compositions depend on conditions including, but not limited to, the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician.
- therapeutically effective amounts may be determined by routine experimentation, including but not limited to a dose escalation clinical trial.
- This application provides an anti-angiogenic agent and a method for inhibiting angiogenesis, wherein a condition dependent on angiogenesis in a mammal is addressed by administering an anti-angiogenic agent to the mammal in a therapeutically effective amount and frequency.
- This administration aims to achieve regression or arrest of the condition without causing significant toxicity.
- the conditions that can be treated include various neoplasms, such as solid tumor neoplasms like breast carcinoma, lung carcinoma, prostate carcinoma, colon carcinoma, ovarian carcinoma, neuroblastoma, central nervous system tumors, glioblastoma multiforme, and melanoma.
- the anti- angiogenic agent is capable of inducing regression or arrest in most, if not all, solid tumors.
- the mammal undergoing treatment can be a human.
- the anti-angiogenic agent comprises polypeptides derived from domain one of CD2, sourced from both human and non-human origins.
- the structure and function of domain one of CD2 are modified to create new polypeptides with enhanced stability’ and activity.
- the modifications may produce at least two short strands of anti-parallel [3-sheets that emulate the active sites of various endogenous anti- angiogenic polypeptides, such as PF4, IL8, TSP-1, Endostatin, and other synthetic peptides.
- anti-angiogenic agents or polypeptides might feature a P-sheet structure with two segments in an anti-parallel arrangement, a hydrophobic surface facing inward, a hydrophilic surface facing outward, and segments comprising at least four amino acids, with some instances requiring six or more, and others eight or more amino acids per segment.
- the amino acid residues may alternate between hydrophilic and hydrophobic properties.
- the anti-angiogenic agent can have a terminal glycine.
- the anti-angiogenic agents can be used for in vivo, in vitro, and ex vivo applications, displaying anti-angiogenic effects in both clinical and non-clinical settings.
- Methods to systematically vary’ polypeptide sequences through directed evolution are well- established.
- the disclosed methods can be applied to develop non-CD2 polypeptides featuring at least two short strands of an anti-parallel P-sheet.
- the anti-angiogenic agent can be prepared using rational polypeptide design, identifying and predicting the impact of specific amino acid residues on a polypeptide's properties.
- This method may include creating a training set of polypeptide variants, deriving an activity model to predict effects based on amino acid modifications, and using this model to identify amino acids at specific positions that confer desired activities and properties.
- the agent could be developed by introducing mutations within the host polypeptide or domain one of CD2.
- Specialists in the field can employ recombinant technology to create specific anti-angiogenic agents, including using site-directed mutagenesis to generate desired polypeptides from sequences identified as SEQ ID NOS: 1-12.
- Mutated nucleic acid sequences accounting for the genetic code's degeneracy, can be subcloned into suitable expression vectors for production in hosts like yeast or E. coli, followed by standard purification processes.
- the anti-angiogenic agent can have a terminal glycine.
- the agent has a terminal glycine.
- the agent shown in SEQ ID NO: 12 has a terminal glycine. Glycine, being the smallest of the 20 standard amino acids, can influence the solubility, stability, and bioavailability of a peptide-based therapeutic agent.
- the agent may incorporate N-linked glycosylation, a process in eukaryotes that influences polypeptide folding, solubility, and circulation duration.
- This glycosylation often requires the consensus sequence Asn-X-Ser/Thr, particularly in loop regions of the peptide, such as observed with the yeast Pichia expression system at position N65.
- anti -angiogenic agents aim to control or inhibit angiogenesis, understood as preventing new blood vessel formation or the differentiation of circulating stem cells into endothelial cells. Moreover, these agents can induce apoptosis in activated endothelial cells, thereby inhibiting angiogenesis, which may include destroying existing vessels near or within tumors activated by angiogenesis factors.
- the inhibition mechanism is thought to involve controlling apoptosis, with the developed polypeptides showing strong activity' in inducing endothelial cell apoptosis without affecting epithelial and fibroblast cells in vitro. They also demonstrated minimal impact on the tube structure formed by HUVEC cells, indicating lower toxicity towards existing normal blood vessels. Survival factors implicated include vascular endothelial cell growth factors or mitogens, alongside factors that aid in cell recovery’ post-injury'.
- anti-angiogenic agents may be incorporated into methods of treating a mammal by inhibiting angiogenesis that include the steps of administering the anti- angiogenic agents.
- the anti-angiogenic polypeptide exhibited extended circulation time compared to small molecules and short peptide agents.
- Specific embodiments provide methods of inhibiting angiogenesis and methods of treating angiogenesis-associated diseases.
- the present invention provides methods of inhibiting or reducing tumor growth and methods of treating an individual suffering from cancer. These methods involve administering to the individual a therapeutically effective amount of one or more polypeptide therapeutic agents as described above. These methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans.
- angiogenesis-associated diseases include, but are not limited to, angiogenesis-dependent cancer, including, for example, solid tumors, blood bom tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; inflammatory disorders such as immune and non-immune inflammation; chronic articular rheumatism and psoriasis; ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity 7 , macular degeneration, comeal graft rejection, neo vascular glaucoma, retrolental fibroplasia, rubeosis; Osler-Webber Syndrome; myocardial angiogenesis; plaque neovascularization: telangiectasia; hemophiliac joints; angiofibroma; and wound granulation and wound healing; tel
- One potential benefit of the combination of an anti-angiogenic agent and a chemotherapeutic agent may be an improvement in the treatment and control of an angiogenic dependent condition with reduced doses of a chemotherapeutic agent.
- the combination can be administered for a prolonged period of time, or optionally a shorter duration of treatment may be administered due to the increased effectiveness of the combination.
- administration of the polypeptide therapeutic agents of the invention may be continued while the other therapy is being administered and/or thereafter.
- Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses.
- administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
- the anti-angiogenesis agent can be administered in combination with chemotherapeutic and other therapeutic agents, as well as radio-therapies.
- the chemotherapeutic agent may be selected from the group consisting of vinca alkaloid, camptothecan, taxane, or platinum analogue, including vincristine, vinblastine, vinorelbine, vindesine, paclitaxel, docetaxel, 5 FU, cisplatin, carboplatin, irinotecan, topotecan or cyclophosphamide.
- the chemotherapeutic agent can be administered in a low-dose regimen, in combination with the anti-angiogenic agent because of the anti-tumor effect of the anti-angiogenic agent.
- the chemotherapeutic agent can be administered at less than the maximum tolerated dose.
- the anti-angiogenic agent may be used with anti-neoplastic agents, including the following anti-neoplastic agents : Acivicim Aclarubicin; Acodazole Hydrochloride; AcrQnine; Adozelesin; Aldesleukin; Altretamine; Ambomycin; Ametantrone Acetate; Aminoglutethimide; Amsacrine; Anastrozole; Anthramycin; Asparaginase; Asperlin; Azacitidine; Azetepa; Azotomycin; Batimastat; Benzodepa; Bicalutamide; Bisantrene Hydrochloride; Bisnafide Dimesylate; Bizelesin; Bleomycin Sulfate; Brequinar Sodium; Bropirimine; Busulfan; Cactinomycin; Calusterone; Caracemide; Carbetimer; Carboplatin; Carmustine; Carubicin Hydrochloride;
- anti-neoplastic compounds include: 20-epi-l,25 dihydroxyvitamin D3; 5- ethynyluracil; abiraterone; aclarubicin; acylfulvene; adecypenol; adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine; amidox; amifostine; aminolevulinic acid; amrubicin; atrsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti-dorsahzing morphogenetic polypeptide-1; antiandrogen, prostatic carcinoma; antiestrogen; antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid: ara-CDP
- Anti-angiogenic agent may be used with Anti-cancer Supplementary Potentiating Agents, including the following Supplementary Potentiating Agents: Anti-cancer Supplementary Potentiating Agents: Tricyclic anti-depressant drugs (e.g., imipramine, desipramine, amitryptyline. clomiprainine, trimipramine, doxepin, nortriptyline, protript line, amoxapine and maprotiline); non-tricyclic anti-depressant drugs (e.g..).
- Tricyclic anti-depressant drugs e.g., imipramine, desipramine, amitryptyline. clomiprainine, trimipramine, doxepin, nortriptyline, protript line, amoxapine and maprotiline
- non-tricyclic anti-depressant drugs e.g..
- the compounds of the invention also can be administered with cytokines such as granulocyte colony stimulating factor. Those of ordinary skill in the art will recognize also numerous other compounds that fall within this category of agents that are useful in combination with the anti-angiogenic agent.
- Ca.sup.++ antagonists e.g., verapamil, nifedipine, nitrendipine and caroverine
- Calmodulin inhibitors e.g., prenylamine, trifluoroperazine and clomipramine
- Amphotericin B Triparanol analogues (e.g., tamoxifen); antiarrhythmic drugs (e.g., quinidine); antihypertensive drugs (e.g., reserpine); Thiol depleters (e.g., buthionine and sulfoximine) and Multiple Drug Resistance reducing agents such as Cremaphor EL.
- the compounds of the invention also can be administered with cytokines such as gran
- One embodiment also includes a kit for treating an angiogenic dependent condition in a mammal comprising an anti-angiogenic agent and a chemotherapeutic agent.
- the combination of agents is provided to allow? administration in an amount and frequency therapeutically effective to produce an inhabitation or regression of angiogenesis.
- the anti-angiogenic agent and/or polynucleotides are administered alone or in combination with an anti-inflammatory agent.
- Anti-inflammatory agents that may be administered with the anti-angiogenic agents of the invention include, but are not limited to, corticosteroids (e.g.
- Pharmaceutical agents include the following categories and specific examples. It is not intended that the category be limited by the specific examples. Those of ordinary skill in the art will be able to identity' readily those pharmaceutical agents that have utility outside of the central nervous system. Those of ordinary skill in the art will recognize also numerous other compounds that fall within the categories and that are useful according to the invention.
- polyethylene glycol may be used to derivatize polypeptides of the invention, include, for example, polyfethylene glycol) (PEG), poly(vinylpyrrohdone), polyoxomers, polysorbate and poly(vinyl alcohol), with PEG polymers being particularly preferred.
- PEG polymers are PEG polymers having a molecular weight from about 100 to about 40,000.
- Other suitable hydrophilic polymers in addition to those exemplified above, will be readily apparent to one skilled in the art based on the present disclosure.
- the polymers used may include polymers that can be attached to the polypeptides of the invention via alkylation or acylation reactions.
- the anti-angiogenic agent was PEGylated with a PEG-chain of 20 kDa.
- polyethylene glycol molecules should be attached to the polypeptide with consideration of effects on functional or antigenic domains of the polypeptide.
- attachment methods available to those skilled in the art.
- polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as. a free amino or carboxyl group.
- Reactive groups are those to which an activated polyethylene glycol molecule may be bound.
- the amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residues; those having a free carboxyl group may include aspartic acid residues glutamic acid residues and the C-terminal amino acid residue.
- Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecules.
- Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group.
- polyethylene glycol as an illustration of the present composition, one may select from a variety' of polyethylene glycol molecules (by molecular weight, branching, etc.), the proportion of polyethylene glycol molecules to polypeptide (polypeptide) molecules in the reaction mix, the type of pegylation reaction to be perfonned, and the method of obtaining the selected N-terminally pegylated polypeptide. Under the appropriate reaction conditions, substantially selective derivatization of the polypeptide at the N-terminus with a carbonyl group containing polymer is achieved.
- a variety of administration routes are available. The particular mode selected can depend upon the anti-angiogenic agent, the particular condition being treated and the dosage required for efficacy. These methods may 7 be practiced using any mode of administration that is medically acceptable, meaning any mode that produces effective levels of an immune response without causing clinically unacceptable adverse effects. Certain modes of administration are parenteral routes.
- compositions comprise a therapeutically effective amount of active component (e.g., the anti-angiogenic agent, the anti-angiogenic agent plus chemotherapeutic or the anti- angiogenic agent plus anti-inflammatory agent), and a pharmaceutically acceptable carrier.
- active component e.g., the anti-angiogenic agent, the anti-angiogenic agent plus chemotherapeutic or the anti- angiogenic agent plus anti-inflammatory agent
- pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
- the composition can be formulated as a suppository. with traditional binders and carriers such as triglycerides.
- Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
- Such compositions will contain a therapeutically effective amount of the anti- angiogenic agent together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
- the formulation should suit the mode of administration.
- the amount of the anti-angiogenic agent that will be effective in the treatment can be determined by standard clinical techniques.
- in vitro assays may optionally be employed to help identify optimal dosage ranges.
- the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
- the agent or pharmaceutical compositions can be tested in vitro, and then in vivo for the desired therapeutic or prophylactic activity, prior to use in humans.
- in vitro assays to demonstrate the therapeutic or prophylactic utility of a compound or pharmaceutical composition include, the effect of a compound on a cell line or a patient tissue sample.
- the effect of the compound or composition on the cell line and/or tissue sample can be determined utilizing techniques known to those of skill in the art including, but not limited to, rosette formation assays and cell lysis assays.
- in vitro assays which can be used to determine whether administration of a specific compound is indicated, include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a compound, and the effect of such compound upon the tissue sample is observed.
- the anti-angiogenic agent can be formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
- compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
- the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity’ of active agent.
- composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
- an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- Various delivery systems are known and can be used to administer a compound of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis, construction of a nucleic acid as part of a retroviral or other vector, etc.
- Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
- the compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
- the anti-angiogenic agent may be desirable to administer the anti-angiogenic agent locally to the area in need of treatment.
- This may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery', by injection, by means of a catheter, by means of a suppository’, or by means of an implant, said implant being of a porous, non- porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
- care should be taken to use materials to which the polypeptide does not absorb.
- the nucleic acid can be administered in vivo to promote expression of its encoded polypeptide, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector, or by direct injection, or by use of microparticle bombardment, or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox-hke peptide which is known to enter the nucleus, etc.
- a nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
- a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid.
- the polynucleotide insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few; Other suitable promoters will be known to the skilled artisan.
- the expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome binding site for translation.
- the coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
- the expression vectors will preferably include at least one selectable marker.
- polynucleotides encoding the anti-angiogenic agent may be fused to polynucleotides encoding signal sequences which will direct the localization of a polypeptide to particular compartments of a prokaryotic or eukaryotic cell and/or direct the secretion of a polypeptide.
- signal sequences which will direct the localization of a polypeptide to particular compartments of a prokaryotic or eukaryotic cell and/or direct the secretion of a polypeptide.
- E. coli one may wish to direct the expression of the protein to the periplasmic space.
- vectors are commercially available for the construction of fusion proteins which will direct the localization of a protein.
- stents comprising a generally tubular structure (which includes for example, spiral shapes), the surface of which is coated with an anti- angiogenic agent as described above.
- a stent can be a scaffolding, usually cylindrical in shape, that may be inserted into a body passageway (e.g., bile ducts) or a portion of a body passageway, which has been narrowed, irregularly contoured, obstructed, or occluded by a disease process (e.g., ingrowth by a tumor) in order to prevent closure or reclosure of the passageway.
- a body passageway e.g., bile ducts
- a disease process e.g., ingrowth by a tumor
- an anti-angiogenic agent in a wide variety of surgical procedures.
- an anti-angiogenic protein in the form of, for example, a spray or film
- a spray or film may be utilized to coat or spray an area prior to removal of a tumor, in order to isolate normal surrounding tissues from malignant tissue, and/or to prevent the spread of disease to surrounding tissues.
- surgical meshes which have been coated with anti-angiogenic protein may be utilized in any procedure wherein a surgical mesh might be utilized.
- Example 1 Expression of anti-angiogenic agent
- the anti -angiogenic agent was expressed and purified from bacterial E.coli. To help ensure the designed polypeptide still folded properly, the structure was confirmed with 1H- NMR analyses.
- the NMR spectrum of anti-angiogenic agent (120 pM) and CD2-D1 (120 pM) were compared. As shown in FIG. 2, the NMR spectrum of the anti-angiogenic agent was almost identical to that of CD2-D1 (top), whereas the unfolded polypeptide (by organic solvent) showed a completely different spectrum (bottom).
- the resulting polypeptide exhibited very similar structural properties as demonstrated by similarity of 1 H-NMR, CD, and fluorescence spectrum of both the host protein and the developed protein.
- Example 2 Endothelial Cells and Apoptosis
- cell viability assays were carried out using HUVEC cells.
- the cells were treated with various concentrations of one example of a developed anti-angiogenic agent, anginex, and host polypeptide with which the anti-angiogenic agent was derived.
- the anti-angiogenic agent was more effective in apoptosis induction of the HUVEC cells (Fig. 2A).
- cell proliferation assays were carried out with HUVEC, M4A4, cells in the presence of 5 pM or 10 pM of Anti-angiogenic agent, Anginex, and host protein.
- Example 3 Inhibition of tumor growth of xenograft of PC-3 cells
- a xenograft model of PC-3 cells was prepared using immunodeficient mice. Tumor bearing mice (6 mice per group) were treated with an anti-angiogenic agent (10 mg/kg), a PEGylated anti-angiogenic agent (10 mg/kg), a host protein (10 mg/kg), and buffer saline for two weeks via daily dose. The treatments were started 7 days post tumor inoculation. The tumors were measured either by volume or by bioluminescence of tumor cells.
- FIG. 4A shows graphically that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 8 days.
- FIG. 4B shows graphically the dose dependent effect and that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 22 days.
- the tumors grew in normal rate in the mice treated with buffer and the host proteins. At the end of treatment course, tumors in each treatment group were cut out and weighed.
- Example 4 Vessel density after the treatments
- Example 5 Toxicity and immunogenicity of the Anti-angiogenic agent
- Toxicity of the parental protein of domain 1 of CD2 was previously analyzed and was not toxic in mice.
- the toxicity’ of the anti-angiogenesis polypeptide was examined using CD-I mice. Firstly, the body weights of tumor bearing nude mice were carefully monitored during a 14-day treatment course. As shown in FIG. 8, no significant changes in mice body weight were observed in any treatment group. In addition, the toxicity’ was tested in normal CD-I mice. Three groups of mice (7 mice per group) were injected i.v. with one dose, two doses and three doses of 100 JJ.1 of the polypeptide (100 mg/kg, 20 times of used dosage) with three day intervals between each injection. The animals were returned to their cages for 30 days. No deaths were observed among the tested mice. All animals behaved normally (no change in eating habits; no abnormal weight gain or loss; and no abnormal appearance on fur).
- the polypeptide shown in Sequence ID No: 11 was expressed and purified from the Pichia pastoris expression system. Expression of this polypeptide in yeast Pichia pastoris was achieved by both intracellular and secretion expression. This polypeptide was further purified using an ion exchange column. The polypeptide was expressed as a His-tag polypeptide. The His-tag was removed by thrombin cleavage. The glycosylated protein expressed and purified from Yeast Pichia pastoris was an anti-angiogenetic agent and was found have N-linked glycosylation. As shown in FIG. 13, cells treated by various examples of the anti-angiogenic agent showed robust viability.
- the polypeptide shown in Sequence ID No: 12 was expressed and purified an expression system. Expression of this polypeptide in yeast Pichia pastoris is achieved by both intracellular and secretion expression. This polypeptide is further purified using an ion exchange column. The glycine tenninal protein is an anti-angiogenetic agent. Cells are treated by various examples, including the polypeptide described as Sequence ID No: 12 has robust viability.
- SEQ ID NO: 1 is the amino acid sequence of domain one of CD2 from a rat (WT Rat CD2-D1):
- SEQ ID NO:2 is the amino acid sequence of domain one of CD2 from human (WT Human CD2-D1):
- SEQ ID NO:3. referred to as M1WT or Agiol, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO1 by mutations W7Q, G8M.
- SEQ ID NO:4 is the amino acid sequence of a variant domain one of CD2 d derived from SEQ ID NO1 by mutations E41L K43V, K45L, M46G, K47S, P48V, and G53L:
- SEQ ID NO:5 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO1 by mutations E41N, M46Q, and F49S:
- SEQ ID NO: 6 referred to as ProAgio-PEG or Agio2, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO3 by mutations M23C:
- SEQ ID NO:7 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO1 by mutations E41I, K43V, K45L, M46G, K47S, and F49S:
- SEQ ID NOV referred to as hProAgioB or Agio3
- hProAgioB is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO2 by mutations E8S, T9V, W10Q, G1 IM, A12K, D99N, I102V, Q103I, and E104L
- SEQ ID NO: 11 is the amino acid sequence of a variant domain one of CD2 form yeast: KEITNALSVQMKLGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEK
- SEQ ID NO: 12 referred to as Agio6, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO:9 by mutations M30C and aterminal glycine (G) or an additional terminal glycine (G):
- Example 8 Effectiveness against AVASTIN®
- FIG. 11 is the tumor growth curve of Avastin® and rProAgio-PEG or Agio2.
- FIG. 12 shows graphic representation of the weight of the tumor at end of 14 day treatment course - the tumors in each treatment group were extracted and weighed. There were significant differences in the tumor weights and growlh of the animal groups that were treated by Agio2 and AVASTIN®.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Heart & Thoracic Surgery (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Cardiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Description
ANTI-ANGIOGENIC AGENT AND METHODS OF USING SUCH AGENT
GOVERNMENT LICENSE RIGHTS
[0001] This invention was made with U.S. Government support under Grant No. CAI 18113 awarded by the National Institutes of Health. The U.S. Government has certain rights in the invention.
PRIOR RELATED APPLICATION DATA
[0002] This application claims the benefit of U.S. Provisional Patent Application No. 63/484.968, filed February 14, 2023. which is incorporated by reference herein in its entirety.
TECHNICAL FIELD
[0003] This disclosure pertains to inhibiting or preventing angiogenesis to control or treat angiogenic-dependent conditions, which are characterized by or depend upon blood vessel proliferation. Additionally, the disclosure relates to the use of an anti-angiogenic agent in combination wi th a chemotherapeutic agent.
BACKGROUND
[0004] Angiogenesis is the process by which new blood vessels are formed from extant capillaries, while vasculogenesis involves the growth of vessels deriving from endothelial progenitor cells. Angiogenesis is a combinatorial process that is regulated by a balance between pro- and anti-angiogenic molecules. Angiogenic stimuli (e.g. hypoxia or inflammatory cytokines) result in the induced expression and release of angiogenic growth factors such as vascular endothelial growth factor (VEGF) or fibroblast growth factor (FGF). These growth factors stimulate endothelial cells (EC) in the existing vasculature to proliferate and migrate through the tissue to form new' endothelialized channels. Angiogenesis is involved in the proliferation of endothelial cells.
[0005] Inappropriate, or pathological, angiogenesis plays a role in the growth of atherosclerotic plaque, diabetic retinopathy, degenerative maculopathy, retrolental fibroplasia, idiopathic pulmonary fibrosis, acute adult respiratory distress syndrome, and asthma. Furthermore, tumor progression is associated with neovascularization, which
facilitates nutrient delivery' to progressively growing tumor tissues. Although the idea of impeding cancer progression by targeting its blood supply was proposed over 30 years ago, angiogenesis inhibitors have only recently become a mainstay in cancer therapeutics. Accordingly, there is an ongoing need for new methods and agents to reduce pathological angiogenesis. This disclosure aims to address this need, among others.
[0006] Accordingly, there is an ongoing need for new methods and agents to reduce pathological angiogenesis. This disclosure aims to address this need, among others.
BRIEF DESCRIPTION OF THE FIGURES
[0007] FIG. 1 A displays a schematic drawing of an anti -angiogenic agent, showing the two short strands of the protein's anti-parallel P-sheet;
[0008] FIG. IB displays another schematic drawing of an anti-angiogenic agent, showing the two short strands of the protein's anti-parallel P-sheet with the hydrophobic surface facing outward;
[0009] FIG. 1C displays another schematic drawing of an anti-angiogenic agent, showing the two short strands of the protein's anti-parallel P-sheet with the hydrophobic surface facing inward;
[0010] FIG. 2 displays NMR spectra of a folded (top) and an unfolded (bottom) anti- angiogenic agent and host protein;
[0011] FIG. 3 A displays a proliferation assay companng an anti-angiogenic agent to a prior art agent (Anginex) using HUVEC cells;
[0012] FIG. 3B displays a proliferation assay comparing an anti-angiogenic agent to aprior art agent (Anginex) using M4A4 cancer cells;
[0013] FIG. 4A displays a graph demonstrating that tumor volume remained relatively constant during treatment with an anti-angiogenic agent (treatment started after 8 days);
[0014] FIG. 4B displays a graph demonstrating that tumor volume remained relatively constant during treatment with an anti-angiogenic agent (treatment started after 22 days);
[0015] FIG. 5 displays a graph showing substantial differences in tumor weights following the first treatment with an anti-angiogenic agent;
[0016] FIG. 6 displays a pictorial representation demonstrating slower tumor growth rates in mice treated with the anti-angiogenic agent compared to mice treated with buffer and host proteins;
[0017] FIG. 7 displays results of vessel density studies in mice treated with an anti- angiogenic agent;
[0018] FIG. 8 shows that no significant body mass changes were observed in mice across any treatment group;
[0019] FIG. 9 shows how cell viability can vary with dosage;
[0020] FIG. 10 shows a tumor growth curve over 14 days or more of treatment using different doses of the anti-angiogenic agent;
[0021] FIG. 11 shows a comparison of tumor growth curves between AVASTIN® and rProAgio-PEG;
[0022] FIG. 12 displays a graph showing the weight of the tumor at the end of the 14-day treatment course; and
[0023] FIG. 13 displays a graph representing the viability of various examples of the anti- angiogenic agent.
DEFINITIONS
[0024] The following definitions are provided to facilitate understanding of certain terms used throughout this specification.
[0025] The term “angiogenesis” refers to the growth, development, and remodeling of the vascular bed. aiming to improve tissue oxygenation and nutrient delivery. This process includes the formation of new capillaries by sprouting from existing blood vessels, as well as the enlargement, maturation, and modification of existing vessels in terms of direction and flow properties, ultimately optimizing blood perfusion of tissues.
[0026] The term “amino acid” refers to naturally occurring and non-natural amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, by way of example only, an alpha-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group. Such analogs may have modified R groups (by way of example, norleucine) or may have modified peptide
backbones, while still retaining the same basic chemical structure as a naturally occurring amino acid. Non-limiting examples of amino acid analogs include homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
[0027] The term “conservatively modified variants” applies to both natural and non-natural amino acid and natural and non-natural nucleic acid sequences, and combinations thereof. With respect to particular nucleic acid sequences, “conservatively modified variants” refers to those natural and non-natural nucleic acids which encode identical or essentially identical natural and non-natural amino acid sequences, or where the natural and non- natural nucleic acid does not encode a natural and non-natural amino acid sequence, to essentially identical sequences. By way of example, because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations.” which are one species of conservatively modified variations. Thus by way of example every natural or non-natural nucleic acid sequence herein which encodes a natural or non-natural polypeptide also describes every possible silent variation of the natural or non-natural nucleic acid. One of skill will recognize that each codon in a natural or non-natural nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a natural and non-natural nucleic acid which encodes a natural and non-natural polypeptide is implicit in each described sequence.
[0028] The term “effective amount.” as used herein, refers to a sufficient amount of an agent or a compound being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated. The result can be reduction and/or alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. By way of example, an agent or a compound being administered includes, but is not limited to, a natural amino acid polypeptide, non-natural amino acid polypeptide, modified natural amino acid polypeptide, or modified non-amino acid polypeptide. Compositions containing such natural amino acid polypeptides, non-natural amino acid polypeptides, modified natural amino acid polypeptides, or modified non-
natural amino acid polypeptides can be administered for prophylactic, enhancing, and/or therapeutic treatments. An appropriate “effective” amount in any individual case may be determined using techniques, such as a dose escalation study.
[0029] The term “nucleic acid sequence” as used herein, refers to the order and identity of the nucleotides comprising a nucleic acid.
[0030] The term “nucleic acid” refers to deoxyribonucleotides or ribonucleotides and polymers thereof in single- or double-stranded form. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
[0031] The term "terminal glycine" refers to a glycine amino acid residue located at the end of a polypeptide chain. In protein chemistry, the term "terminal" can apply to either the N-terminus (amino end) or C-terminus (carboxyl end) of the chain. Therefore, a "terminal glycine" could be the first amino acid residue at the N-terminus or the last residue at the C- tenninus of a peptide or protein. In one example the terminal glycine can be the N- Terminus. In another example, the terminal glycine can be the C-terminus.
[0032] Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed- base and/or deoxyinosine residues. The term nucleic acid is used interchangeably with gene, cDNA, mRNA, oligonucleotide, and polynucleotide.
[0033] A particular nucleic acid sequence also implicitly encompasses “splice variants.” Similarly, a particular protein encoded by a nucleic acid implicitly encompasses any protein encoded by a splice variant of that nucleic acid. “Splice variants” as the name suggests, are products of alternative splicing of a gene. After transcription, an initial nucleic acid transcript may be spliced such that different (alternate) nucleic acid splice products encode different polypeptides. Mechanisms for the production of splice variants vary, but include
alternate splicing of exons. Alternate polypeptides derived from the same nucleic acid by read-through transcription are also encompassed by this definition. Any products of a splicing reaction, including recombinant forms of the splice products, are included in this definition.
[0034] The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
[0035] The tenn “pharmaceutically acceptable”, as used herein, refers to a material, including but not limited, to a salt, carrier or diluent, which does not abrogate the biological activity or properties of the compound, and is relatively nontoxic, i.e., the material may be administered to an individual without causing undesirable biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.
[0036] The term “prophylactically effective amount,” as used herein, refers that amount of a composition containing at least one non-natural amino acid polypeptide or at least one modified non-natural amino acid polypeptide prophylactically applied to a patient which will relieve to some extent one or more of the symptoms of a disease, condition or disorder being treated. In such prophylactic applications, such amounts may depend on the patient's state of health, weight, and the like. It is considered well within the skill of the art for one to determine such prophylactically effective amounts by routine experimentation, including, but not limited to, a dose escalation clinical trial.
[0037] The phrase “substantially similar,” in the context of two nucleic acids or polypeptides, refers to two or more sequences or subsequences that have at least 75%, preferably at least 85%, more preferably at least 90%, 95% or higher or any integral value therebetween nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm such as those described below for example, or by visual inspection. Preferably, the substantial identity7 exists over a region of the sequences that is at least about 10, preferably about 20, more preferable about 40-60 residues in length or any integral value therebetween, preferably over a longer region than 60-80 residues, more preferably at least about 90-100
residues, and most preferably the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence for example.
[0038] The term “synergistic”, as used herein, refers to a combination of prophylactic or therapeutic effective agents which is more effective than the additive effects of any two or more single agents. A synergistic effect of a combination of prophylactic or therapeutic agents may permit the use of lower dosages of one or more of the agents and/ or less frequent administration of the agents to a subject with a specific disease or condition. In some cases, a synergistic effect of a combination of prophylactic or therapeutic agents may be used to avoid or reduce adverse or unwanted side effects associated with the use of any single therapy.
[0039] The term “therapeutically effective amount,” as used herein, refers to the amount of a composition containing at least one non-natural amino acid polypeptide and/or at least one modified non-natural amino acid polypeptide administered to a patient already suffering from a disease, condition or disorder, sufficient to cure or at least partially arrest, or relieve to some extent one or more of the symptoms of the disease, disorder or condition being treated. The effectiveness of such compositions depend on conditions including, but not limited to, the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician. By way of example only, therapeutically effective amounts may be determined by routine experimentation, including but not limited to a dose escalation clinical trial.
DETAILED DESCRIPTION
[0040] This application provides an anti-angiogenic agent and a method for inhibiting angiogenesis, wherein a condition dependent on angiogenesis in a mammal is addressed by administering an anti-angiogenic agent to the mammal in a therapeutically effective amount and frequency. This administration aims to achieve regression or arrest of the condition without causing significant toxicity. The conditions that can be treated include various neoplasms, such as solid tumor neoplasms like breast carcinoma, lung carcinoma, prostate carcinoma, colon carcinoma, ovarian carcinoma, neuroblastoma, central nervous system tumors, glioblastoma multiforme, and melanoma. Although no list is exhaustive, the anti-
angiogenic agent is capable of inducing regression or arrest in most, if not all, solid tumors. The mammal undergoing treatment can be a human.
[0041 ] In a specific embodiment, the anti-angiogenic agent comprises polypeptides derived from domain one of CD2, sourced from both human and non-human origins. The structure and function of domain one of CD2 are modified to create new polypeptides with enhanced stability’ and activity. For illustration, the modifications may produce at least two short strands of anti-parallel [3-sheets that emulate the active sites of various endogenous anti- angiogenic polypeptides, such as PF4, IL8, TSP-1, Endostatin, and other synthetic peptides. These anti-angiogenic agents or polypeptides might feature a P-sheet structure with two segments in an anti-parallel arrangement, a hydrophobic surface facing inward, a hydrophilic surface facing outward, and segments comprising at least four amino acids, with some instances requiring six or more, and others eight or more amino acids per segment. The amino acid residues may alternate between hydrophilic and hydrophobic properties. The anti-angiogenic agent can have a terminal glycine.
[0042] The anti-angiogenic agents can be used for in vivo, in vitro, and ex vivo applications, displaying anti-angiogenic effects in both clinical and non-clinical settings. Methods to systematically vary’ polypeptide sequences through directed evolution are well- established. The disclosed methods can be applied to develop non-CD2 polypeptides featuring at least two short strands of an anti-parallel P-sheet.
[0043] The anti-angiogenic agent can be prepared using rational polypeptide design, identifying and predicting the impact of specific amino acid residues on a polypeptide's properties. This method may include creating a training set of polypeptide variants, deriving an activity model to predict effects based on amino acid modifications, and using this model to identify amino acids at specific positions that confer desired activities and properties.
[0044] Alternatively, the agent could be developed by introducing mutations within the host polypeptide or domain one of CD2. Specialists in the field can employ recombinant technology to create specific anti-angiogenic agents, including using site-directed mutagenesis to generate desired polypeptides from sequences identified as SEQ ID NOS: 1-12. Mutated nucleic acid sequences, accounting for the genetic code's degeneracy, can be subcloned into suitable expression vectors for production in hosts like yeast or E. coli,
followed by standard purification processes. The anti-angiogenic agent can have a terminal glycine.
[0045] In one embodiment, the agent has a terminal glycine. The agent shown in SEQ ID NO: 12 has a terminal glycine. Glycine, being the smallest of the 20 standard amino acids, can influence the solubility, stability, and bioavailability of a peptide-based therapeutic agent.
[0046] In one embodiment, the agent may incorporate N-linked glycosylation, a process in eukaryotes that influences polypeptide folding, solubility, and circulation duration. This glycosylation often requires the consensus sequence Asn-X-Ser/Thr, particularly in loop regions of the peptide, such as observed with the yeast Pichia expression system at position N65.
[0047] Specific embodiments of the anti -angiogenic agents aim to control or inhibit angiogenesis, understood as preventing new blood vessel formation or the differentiation of circulating stem cells into endothelial cells. Moreover, these agents can induce apoptosis in activated endothelial cells, thereby inhibiting angiogenesis, which may include destroying existing vessels near or within tumors activated by angiogenesis factors. The inhibition mechanism is thought to involve controlling apoptosis, with the developed polypeptides showing strong activity' in inducing endothelial cell apoptosis without affecting epithelial and fibroblast cells in vitro. They also demonstrated minimal impact on the tube structure formed by HUVEC cells, indicating lower toxicity towards existing normal blood vessels. Survival factors implicated include vascular endothelial cell growth factors or mitogens, alongside factors that aid in cell recovery’ post-injury'.
[0048] These anti-angiogenic agents may be incorporated into methods of treating a mammal by inhibiting angiogenesis that include the steps of administering the anti- angiogenic agents. In certain embodiments, the anti-angiogenic polypeptide exhibited extended circulation time compared to small molecules and short peptide agents.
[0049] Specific embodiments provide methods of inhibiting angiogenesis and methods of treating angiogenesis-associated diseases. In other embodiments, the present invention provides methods of inhibiting or reducing tumor growth and methods of treating an individual suffering from cancer. These methods involve administering to the individual a therapeutically effective amount of one or more polypeptide therapeutic agents as described
above. These methods are particularly aimed at therapeutic and prophylactic treatments of animals, and more particularly, humans.
[0050] As described herein, angiogenesis-associated diseases include, but are not limited to, angiogenesis-dependent cancer, including, for example, solid tumors, blood bom tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; inflammatory disorders such as immune and non-immune inflammation; chronic articular rheumatism and psoriasis; ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity7, macular degeneration, comeal graft rejection, neo vascular glaucoma, retrolental fibroplasia, rubeosis; Osler-Webber Syndrome; myocardial angiogenesis; plaque neovascularization: telangiectasia; hemophiliac joints; angiofibroma; and wound granulation and wound healing; telangiectasia psoriasis scleroderma, pyogenic granuloma, cororany collaterals, ischemic limb angiogenesis, comeal diseases, rubeosis, arthritis, diabetic neovascularization, fractures, vasculogenesis. hematopoiesis.
[0051] One potential benefit of the combination of an anti-angiogenic agent and a chemotherapeutic agent may be an improvement in the treatment and control of an angiogenic dependent condition with reduced doses of a chemotherapeutic agent. The combination can be administered for a prolonged period of time, or optionally a shorter duration of treatment may be administered due to the increased effectiveness of the combination.
[0052] Depending on the nature of the combinatory therapy, administration of the polypeptide therapeutic agents of the invention may be continued while the other therapy is being administered and/or thereafter. Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses. In some instances, administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
[0053] In one embodiment, the anti-angiogenesis agent can be administered in combination with chemotherapeutic and other therapeutic agents, as well as radio-therapies. The chemotherapeutic agent may be selected from the group consisting of vinca alkaloid, camptothecan, taxane, or platinum analogue, including vincristine, vinblastine, vinorelbine, vindesine, paclitaxel, docetaxel, 5 FU, cisplatin, carboplatin, irinotecan, topotecan or
cyclophosphamide. The chemotherapeutic agent can be administered in a low-dose regimen, in combination with the anti-angiogenic agent because of the anti-tumor effect of the anti-angiogenic agent. The chemotherapeutic agent can be administered at less than the maximum tolerated dose.
[0054] It is contemplated that the anti-angiogenic agent may be used with anti-neoplastic agents, including the following anti-neoplastic agents : Acivicim Aclarubicin; Acodazole Hydrochloride; AcrQnine; Adozelesin; Aldesleukin; Altretamine; Ambomycin; Ametantrone Acetate; Aminoglutethimide; Amsacrine; Anastrozole; Anthramycin; Asparaginase; Asperlin; Azacitidine; Azetepa; Azotomycin; Batimastat; Benzodepa; Bicalutamide; Bisantrene Hydrochloride; Bisnafide Dimesylate; Bizelesin; Bleomycin Sulfate; Brequinar Sodium; Bropirimine; Busulfan; Cactinomycin; Calusterone; Caracemide; Carbetimer; Carboplatin; Carmustine; Carubicin Hydrochloride; Carzelesin; Cedefingol; Chlorambucil; Cirolemycin; Cisplatin; Cladribine; Crisnatol Mesylate; Cyclophosphamide; Cytarabine; Dacarbazine; Dactinomycin; Daunorubicin Hydrochloride; Decitabine; Dexormaplatin; Dezaguanine; Dezaguanine Mesylate; Diaziquone; Docetaxel; Doxorubicin; Doxorubicin Hydrochloride; Droloxifene; Droloxifene Citrate; Dromostanolone Propionate; Duazomycin; Edatrexate; Eflomithine Hydrochloride; Elsamitrucin; Enloplatin; Enpromate; Epipropidine; Epirubicin Hydrochloride; Erbulozole; Esorubicin Hydrochloride; Estramustine; Estramustine Phosphate Sodium; Etanidazole; Ethiodized Oil I 131; Etoposide; Etoposide Phosphate; Etoprine; Fadrozole Hydrochloride; Fazarabine; Fenretinide; Floxuridine; Fludarabine Phosphate; Fluorouracil; Flurocitabine; Fosquidone; Fostriecin Sodium; Gemcitabine; Gemcitabine Hydrochloride; Gold Au 198; Hydroxyurea; Idarubicin Hydrochloride; Ifosfamide; Ilmofosine; Interferon Alfa-2a; Interferon Alfa-2b; Interferon Alfa-nl; Interferon Alfa-n3; Interferon Beta- I a; Interferon Gamma- I b; Iproplatin; Irinotecan Hydrochloride; Lanreotide Acetate; Letrozole; Leuprolide Acetate; Liarozole Hydrochloride; Lometrexol Sodium; Lomustine; Losoxantrone Hydrochloride; Masoprocol; Maytansine; Mechlorethamine Hydrochloride; Megestrol Acetate; Melengestrol Acetate; Melphalan; Menogaril; Mercaptopurine; Methotrexate; Methotrexate Sodium; Metoprine; Meturedepa; Mitindomide; Mitocarcin; Mitocromin; Mitogillin; Mitomalcin; Mitomycin; Mitosper; Mitotane; Mitoxantrone Hydrochloride; Mycophenolic Acid; Nocodazole; Nogalamycin; Ormaplatin; Oxisuran; Paclitaxel;
Pegaspargase; Peliomycin; Pentamustine; Peplomycin Sulfate; Perfosfamide; Pipobroman; Piposulfan; Piroxantrone Hydrochloride: Plicamycin; Plomestane; Porfimer Sodium; Porfiromycin; Prednimustine; Procarbazine Hydrochloride; Puromycin; Puromycin Hydrochloride; Pyrazofurin; Riboprine; Rogletimide; Safmgol; Safingol Hydrochloride; Semustine; Simtrazene; Sparfosate Sodium; Sparsomycin; Spirogemianium Hydrochloride; Spiromustine; Spiroplatin; Streptonigrin; Streptozocin; Strontium Chloride Sr 89; Sulofenur; Talisomycin; Taxane; Taxoid; Tecogalan Sodium; Tegafur; Teloxantrone Hydrochloride; Temoporfm; Teniposide; Teroxirone; Testolactone; Thiamiprine; Thioguanine; Thiotepa; Tiazofurin; Tirapazamine; Topotecan Hydrochloride; Toremifene Citrate; Trestolone Acetate; Triciribine Phosphate; Trimetrexate; Trimetrexate Glucuronate; Triptorelin; Tubulozole Hydrochloride; Uracil Mustard; Uredepa; Vapreotide; Verteporfin; Vinblastine Sulfate; Vincristine Sulfate; Vindesine; Vindesine Sulfate; Vinepidine Sulfate; Vinglycinate Sulfate; Vinleurosine Sulfate; Vinorelbine Tartrate; Vinrosidine Sulfate; Vinzolidine Sulfate; Vorozole; Zeniplatin; Zinostatin; Zorubicin Hydrochloride.
[0055] Other anti-neoplastic compounds include: 20-epi-l,25 dihydroxyvitamin D3; 5- ethynyluracil; abiraterone; aclarubicin; acylfulvene; adecypenol; adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine; amidox; amifostine; aminolevulinic acid; amrubicin; atrsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti-dorsahzing morphogenetic polypeptide-1; antiandrogen, prostatic carcinoma; antiestrogen; antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid: ara-CDP-DL-PTBA; arginine deaminase; asulacrine; atamestane; atrimustine; axinastatin 1; axinastatin 2; axinastatin 3; azasetron; azatoxin; azatyrosine; baccatin III derivatives; balanol; batimastat; BCR/ABL antagonists; benzochlorins; benzoylstaurosporine; beta lactam derivatives; beta-alethine; betaclamycin B; betulinic acid; bFGF inhibitor; bicalutamide; bisantrene; bisaziridinylspermine; bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine; calcipotriol; calphostin C; camptothecin derivatives; canarypox IL-2; capecitabine; carboxamide- amino-triazole; carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; chlorins; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene
analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4; combretastatin analogue; conagenin; crambescidin 816; crisnatol; ciyptophycin 8; cryptophycin A derivatives; curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexifosfamide; dexrazoxane; dexverapamil; diaziquone; didemnin B; didox; diethylnorspermine; dihydro-5-azacytidine; dihydrotaxol, 9-; dioxamycin; diphenyl spiromustine; docosanol; dolasetron; doxifluridine; droloxifene; dronabinol; duocannycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflomithine; elemene; emitefur; epirubicin; epristeride; estramustine analogue; estrogen agonists; estrogen antagonists; etanidazole; etoposide phosphate: exemestane; fadrozole; fazarabine; fenretinide; filgrastim; fmasteride; flavopiridol; flezelastine; fluasterone; fludarabine; fluorodaunorunicin hydrochloride; forfenimex; formestane; fostriecin; fotemustine; gadolinium texaphyrin; gallium nitrate; galocitabine; ganirelix; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; heregulin; hexamethylene bisacetamide; hypericin; ibandronic acid; idarubicin; idoxifene; idramantone; ilmofosine; ilomastat; imidazoacridones; imiquimod: immunostimulant peptides; insulin-like growth factor- 1 receptor inhibitor; interferon agonists; interferons; interleukins; iobenguane; iododoxorubicin; ipomeanol, 4-; irinotecan; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide: kahalalide F; lamellarin-N triacetate; lanreotide; leinamycin; lenograstim; lentinan sulfate; leptolstatin; letrozole; leukemia inhibiting factor; leukocyte alpha interferon: leuprolide+estrogen+progesterone; leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds; lissoclinamide 7; lobaplatin; lombricine; lometrexol: lonidamine; losoxantrone; lovastatin: loxoribine; lurtotecan; lutetium texaphyrin; lysofylline; lytic peptides; maitansine: mannostatin A; marimastat; masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase; metoclopramide; MIF inhibitor; mifepristone; miltefosine; mirimostim; mismatched double stranded RNA; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporm; mitoxantrone; mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A +myobacterium cell wall sk; mopidamol; multiple drug resistance genie inhibitor; multiple tumor suppressor 1 -based therapy; mustard
anticancer agent; mycaperoxide B; mycobacterial cell wall extract; myriaporone; N- acetyldinaline; N-substituted benzamides; nafarelin; nagrestip; naloxone +pentazocine; napavin; naphterpin; nartograstim; nedaplatin; nemorubicin; neridronic acid; neutral endopeptidase; nilutamide; nisamycin; nitric oxide modulators; nitroxide antioxidant; nitrullyn; O6-benzylguanine; octreotide; okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; paclitaxel analogues; paclitaxel derivatives; palauamine; palmitoylrhizoxin; pamidronic acid; panaxytriol; panomifene; parabactin; pazelliptine; pegaspargase; peldesine; pentosan polysulfate sodium; pentostatin; pentrozole; perflubron; perfbsfamide; perillyl alcohol; phenazinomycin; phenylacetate; phosphatase inhibitors; picibanil; pilocarpine hydrochloride; pirarubicin; piritrexim; placetin A; placetin B; plasminogen activator inhibitor; platinum complex; platinum compounds; platinumtriamine complex; porfimer sodium; porfiromycin; propyl bis-acridone; prostaglandin J2; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor; protein kinase C inhibitors, microalgal; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; purpurins; pyrazoloacridine; pyridoxylated hemoglobin polyoxyethylene conjugate; raf antagonists; raltitrexed; ramosetron; ras famesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; retelliptine demethylated; rhenium Re 186 etidronate; rhizoxin; ribozymes; RII retinamide; rogletimide; rohitukine; romurtide; roquinimex; rubiginone Bl; ruboxyl; safingol; saintopin; SarCNU; sarcophytol A; sargramostim; Sdi 1 mimetics; semustine; senescence derived inhibitor 1; sense oligonucleotides; signal transduction inhibitors; signal transduction modulators; single chain antigen binding protein; sizofiran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D; spiromustine; splenopentin; spongistatin 1; squalamine; stem cell inhibitor; stem-cell division inhibitors; stipiamide; stromelysin inhibitors; sulfmosine; superactive vasoactive intestinal peptide antagonist; suradista; suramin; swainsonine; synthetic glycosaminoglycans; tallimustine; tamoxifen methiodide; tauromustine; tazarotene; tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfm; temozolomide; teniposide; tetrachlorodecaoxide; tetrazomine; thaliblastine; thalidomide; thiocoraline; thrombopoietin; thrombopoietin mimetic; thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin
ethyl etiopurpurin; tirapazamine; titanocene dichloride; topotecan; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine; triciribine; trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors; tyrphostins; UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfin; vinorelbine; vinxaltine; vitaxin; vorozole; zanoterone; zeniplatin; zilascorb; zinostatin stimalamer. Those of ordinary skill in the art will recognize also numerous other compounds that fall within this category of agents that are useful in combination with the anti-angiogenic agent.
[0056] It is contemplated that the anti-angiogenic agent may be used with Anti-cancer Supplementary Potentiating Agents, including the following Supplementary Potentiating Agents: Anti-cancer Supplementary Potentiating Agents: Tricyclic anti-depressant drugs (e.g., imipramine, desipramine, amitryptyline. clomiprainine, trimipramine, doxepin, nortriptyline, protript line, amoxapine and maprotiline); non-tricyclic anti-depressant drugs (e.g.. sertraline, trazodone and citalopram); Ca.sup.++ antagonists (e.g., verapamil, nifedipine, nitrendipine and caroverine); Calmodulin inhibitors (e.g., prenylamine, trifluoroperazine and clomipramine); Amphotericin B; Triparanol analogues (e.g., tamoxifen); antiarrhythmic drugs (e.g., quinidine); antihypertensive drugs (e.g., reserpine); Thiol depleters (e.g., buthionine and sulfoximine) and Multiple Drug Resistance reducing agents such as Cremaphor EL. The compounds of the invention also can be administered with cytokines such as granulocyte colony stimulating factor. Those of ordinary skill in the art will recognize also numerous other compounds that fall within this category of agents that are useful in combination with the anti-angiogenic agent.
[0057] One embodiment also includes a kit for treating an angiogenic dependent condition in a mammal comprising an anti-angiogenic agent and a chemotherapeutic agent. The combination of agents is provided to allow? administration in an amount and frequency therapeutically effective to produce an inhabitation or regression of angiogenesis. In certain embodiments, the anti-angiogenic agent and/or polynucleotides are administered alone or in combination with an anti-inflammatory agent. Anti-inflammatory agents that may be administered with the anti-angiogenic agents of the invention include, but are not limited to, corticosteroids (e.g. betamethasone, budesonide, cortisone, dexamethasone, hydrocortisone, methylprednisolone, prednisolone, prednisone, and triamcinolone),
nonsteroidal anti-inflammatory drugs (e.g., diclofenac, diflunisal, etodolac, fenoprofen, floctafenine, flurbiprofen, ibuprofen, indomethacin, ketoprofen, meclofenamate, mefenamic acid, meloxicam, nabumetone, naproxen, oxaprozin, phenylbutazone, piroxicam, sulindac, tenoxicam, tiaprofenic acid, and tolmetin.), as well as antihistamines, aminoarylcarboxylic acid derivatives, aryl acetic acid derivatives, arylbutyric acid derivatives, arylcarboxylic acids, arylpropionic acid derivatives, pyrazoles, pyrazolones, salicylic acid derivatives, thiazinecarboxamides, e-acetamidocaproic acid, S- adenosylmethionine, 3-amino4-hydroxybutyric acid, amixetrine, bendazac, benzydamine, bucolome, difenpiramide, ditazol, emorfazone, guaiazulene, nabumetone, nimesulide, orgotein, oxaceprol, paranyline, perisoxal, pifoxime, proquazone, proxazole, and tenidap. [0058] Pharmaceutical agents include the following categories and specific examples. It is not intended that the category be limited by the specific examples. Those of ordinary skill in the art will be able to identity' readily those pharmaceutical agents that have utility outside of the central nervous system. Those of ordinary skill in the art will recognize also numerous other compounds that fall within the categories and that are useful according to the invention.
[0059] In some embodiments, it may be desired to increase the solubility and blood circulation time of the ant-angiogenic agent. To increase polypeptide solubility, blood circulation time, polyethylene glycol may be used to derivatize polypeptides of the invention, include, for example, polyfethylene glycol) (PEG), poly(vinylpyrrohdone), polyoxomers, polysorbate and poly(vinyl alcohol), with PEG polymers being particularly preferred. The PEG polymers are PEG polymers having a molecular weight from about 100 to about 40,000. Other suitable hydrophilic polymers, in addition to those exemplified above, will be readily apparent to one skilled in the art based on the present disclosure. Generally, the polymers used may include polymers that can be attached to the polypeptides of the invention via alkylation or acylation reactions. In one example, the anti-angiogenic agent was PEGylated with a PEG-chain of 20 kDa.
[0060] The polyethylene glycol molecules (or other chemical moieties) should be attached to the polypeptide with consideration of effects on functional or antigenic domains of the polypeptide. There are a number of attachment methods available to those skilled in the art. For example, polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as. a free amino or carboxyl group. Reactive groups are those to
which an activated polyethylene glycol molecule may be bound. The amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residues; those having a free carboxyl group may include aspartic acid residues glutamic acid residues and the C-terminal amino acid residue. Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecules. Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group. One may specifically desire polypeptides chemically modified at the N- terminus. Using polyethylene glycol as an illustration of the present composition, one may select from a variety' of polyethylene glycol molecules (by molecular weight, branching, etc.), the proportion of polyethylene glycol molecules to polypeptide (polypeptide) molecules in the reaction mix, the type of pegylation reaction to be perfonned, and the method of obtaining the selected N-terminally pegylated polypeptide. Under the appropriate reaction conditions, substantially selective derivatization of the polypeptide at the N-terminus with a carbonyl group containing polymer is achieved.
[0061] A variety of administration routes are available. The particular mode selected can depend upon the anti-angiogenic agent, the particular condition being treated and the dosage required for efficacy. These methods may7 be practiced using any mode of administration that is medically acceptable, meaning any mode that produces effective levels of an immune response without causing clinically unacceptable adverse effects. Certain modes of administration are parenteral routes.
[0062] Certain specific embodiments also provide pharmaceutical compositions. Such compositions comprise a therapeutically effective amount of active component (e.g., the anti-angiogenic agent, the anti-angiogenic agent plus chemotherapeutic or the anti- angiogenic agent plus anti-inflammatory agent), and a pharmaceutically acceptable carrier. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if
desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository. with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Such compositions will contain a therapeutically effective amount of the anti- angiogenic agent together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.
[0063] The amount of the anti-angiogenic agent that will be effective in the treatment (see, e.g. FIG. 9), inhibition and prevention of a disease or disorder associated with aberrant expression and/or activity of a therapeutic polypeptide can be determined by standard clinical techniques. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
[0064] More specifically, the agent or pharmaceutical compositions can be tested in vitro, and then in vivo for the desired therapeutic or prophylactic activity, prior to use in humans. For example, in vitro assays to demonstrate the therapeutic or prophylactic utility of a compound or pharmaceutical composition include, the effect of a compound on a cell line or a patient tissue sample. The effect of the compound or composition on the cell line and/or tissue sample can be determined utilizing techniques known to those of skill in the art including, but not limited to, rosette formation assays and cell lysis assays. In accordance with the invention, in vitro assays which can be used to determine whether administration of a specific compound is indicated, include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a compound, and the effect of such compound upon the tissue sample is observed.
[0065] It is contemplated that the anti-angiogenic agent can be formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous
administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity’ of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0066] Various delivery systems are known and can be used to administer a compound of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis, construction of a nucleic acid as part of a retroviral or other vector, etc. Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. In addition, it may be desirable to introduce the pharmaceutical compounds or compositions of the invention into the central nervous system by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter.
[0067] In a specific embodiment, it may be desirable to administer the anti-angiogenic agent locally to the area in need of treatment. This may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery', by injection, by means of a catheter, by means of a suppository’, or by means of an implant, said implant being of a porous, non- porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. When administering a polypeptide, care should be taken to use materials to which the polypeptide does not absorb.
[0068] In a specific embodiment where the anti-angiogenic agent is a nucleic acid encoding a polypeptide, the nucleic acid can be administered in vivo to promote expression of its encoded polypeptide, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector, or by direct injection, or by use of microparticle bombardment, or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox-hke peptide which is known to enter the nucleus, etc. Alternatively, a nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
[0069] Other embodiments are directed to vectors containing a polynucleotide encoding anti-angiogenic agent, host cells, and the production of anti-angiogenic agent by synthetic and recombinant techniques. The vector may be, for example, a phage, plasmid, viral, or retroviral vector. Retroviral vectors may be replication competent or replication defective. In the latter case, viral propagation generally will occur only in complementing host cells. The polynucleotides encoding the anti-angiogenic agent may be joined to a vector containing a selectable marker for propagation in a host. Generally, a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. The polynucleotide insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few; Other suitable promoters will be known to the skilled artisan. The expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome binding site for translation. The coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated. As indicated, the expression vectors will preferably include at least one selectable marker.
[0070] It is contemplated that regulatory genes and sequence may used with the expression and replication of the anti-angiogenic agent. The nature of the regulatory sequences for gene expression may vary between species or cell types, but shall in general include, as necessary', 5' non-transcribing and 5' non-translating sequences involved with initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT
sequence, and the like. Promoters may be constitutive or inducible. Regulatory sequences may also include enhancer sequences or upstream activator sequences, as desired.
[0071 ] In one embodiment, polynucleotides encoding the anti-angiogenic agent may be fused to polynucleotides encoding signal sequences which will direct the localization of a polypeptide to particular compartments of a prokaryotic or eukaryotic cell and/or direct the secretion of a polypeptide. For example, in E. coli, one may wish to direct the expression of the protein to the periplasmic space. Several vectors are commercially available for the construction of fusion proteins which will direct the localization of a protein.
[0072] One specific embodiment provides stents, comprising a generally tubular structure (which includes for example, spiral shapes), the surface of which is coated with an anti- angiogenic agent as described above. A stent can be a scaffolding, usually cylindrical in shape, that may be inserted into a body passageway (e.g., bile ducts) or a portion of a body passageway, which has been narrowed, irregularly contoured, obstructed, or occluded by a disease process (e.g., ingrowth by a tumor) in order to prevent closure or reclosure of the passageway.
[0073] One specific embodiment also provides use of an anti-angiogenic agent in a wide variety of surgical procedures. For example, within one aspect of the present invention an anti-angiogenic protein (in the form of, for example, a spray or film) may be utilized to coat or spray an area prior to removal of a tumor, in order to isolate normal surrounding tissues from malignant tissue, and/or to prevent the spread of disease to surrounding tissues. Within yet other aspects of the present invention, surgical meshes which have been coated with anti-angiogenic protein may be utilized in any procedure wherein a surgical mesh might be utilized.
[0074] The examples which follow are set forth to aid in understanding the invention, but are not intended to, and should not be construed as, limiting the scope of the invention in any manner.
EXAMPLES
[0075] Example 1 : Expression of anti-angiogenic agent
[0076] The anti -angiogenic agent was expressed and purified from bacterial E.coli. To help ensure the designed polypeptide still folded properly, the structure was confirmed with 1H- NMR analyses. The NMR spectrum of anti-angiogenic agent (120 pM) and CD2-D1 (120
pM) were compared. As shown in FIG. 2, the NMR spectrum of the anti-angiogenic agent was almost identical to that of CD2-D1 (top), whereas the unfolded polypeptide (by organic solvent) showed a completely different spectrum (bottom). The resulting polypeptide exhibited very similar structural properties as demonstrated by similarity of 1 H-NMR, CD, and fluorescence spectrum of both the host protein and the developed protein.
[0077] Example 2: Endothelial Cells and Apoptosis
[0078] To determine the effects of the anti-angiogenic agent on the endothelial cells, cell viability assays were carried out using HUVEC cells. The cells were treated with various concentrations of one example of a developed anti-angiogenic agent, anginex, and host polypeptide with which the anti-angiogenic agent was derived. As shown in FIG. 3A, the anti-angiogenic agent was more effective in apoptosis induction of the HUVEC cells (Fig. 2A). We further tested whether the effects were specific to endothelial cells. To this end, cell proliferation assays were carried out with HUVEC, M4A4, cells in the presence of 5 pM or 10 pM of Anti-angiogenic agent, Anginex, and host protein. As shown in FIGs. 3B and 9, it was clear that strong inhibition in cell proliferation by the agent with HUVEC cells, while no effects were observed with epithelial M4A4 cells. The observations indicated that the effects of anti-angiogenic agent were endothelial cell specific.
[0079] Example 3: Inhibition of tumor growth of xenograft of PC-3 cells
[0080] The strong activity of the anti-angiogenic agent in inhibiting growth and induction of apoptosis on HUVEC cells was evident. A xenograft model of PC-3 cells was prepared using immunodeficient mice. Tumor bearing mice (6 mice per group) were treated with an anti-angiogenic agent (10 mg/kg), a PEGylated anti-angiogenic agent (10 mg/kg), a host protein (10 mg/kg), and buffer saline for two weeks via daily dose. The treatments were started 7 days post tumor inoculation. The tumors were measured either by volume or by bioluminescence of tumor cells.
[0081] As shown in FIGs. 4A and 4B, the anti-angiogenic agent and the anti-angiogenic agent-PEG inhibited the tumor growth. FIG. 4A shows graphically that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 8 days. FIG. 4B shows graphically the dose dependent effect and that tumor volume remained relatively constant during the course of treatment with an anti-angiogenic agent when treatment was started after 22 days. As controls, the
tumors grew in normal rate in the mice treated with buffer and the host proteins. At the end of treatment course, tumors in each treatment group were cut out and weighed.
[0082] As shown in FIG. 5, there were substantial differences in the tumor weights comparing the anti-angiogenic agent and control groups. This time the tumors were initialized with 2x106 cells. The treatments were started at 22 days after tumor implantation. The anti-angiogenic agent inhibited the tumor growth completely.
[0083] As shown in FIG. 6, in the control groups, the tumors grew at a normal rate in the mice treated with buffer and the host proteins (CD2). From the images, it can be seen that the tumors remained steady when treated with the exemplary7 anti-angiogenic agents. For reference purposes only, Protein M1WT may be referred to as Agiol and M1PEG may be referred to as Agio2.
[0084] Example 4: Vessel density after the treatments
[0085] FIG. 7 shows that the vessel density, monitored using immunofluorecense staining of tumor tissue sections collected from treated mice, was dramatically reduced after treatment with an anti-angiogenic agent with PEGylated anti-angiogenic agent compared to the group of treatment with PEGylated host protein and buffer. To determine whether the effects of the anti-angiogenic agent treatment were indeed on the tumor blood vessels, the tumors after treatments were harvested. Tissue slides were prepared from the collected tumors. The slides were immunostained with antibody against CD31, a molecular marker specific for endothelial cells. The immunostaining of the tumor tissue slides were visualized by confocal microscopy. The results indicated that the anti-angiogenic agent had specific effects on tumor angiogensis.
[0086] Example 5: Toxicity and immunogenicity of the Anti-angiogenic agent
[0087] Toxicity of the parental protein of domain 1 of CD2 was previously analyzed and was not toxic in mice. To help ensure that the new' designs did not alter the toxicity' of the protein, the toxicity’ of the anti-angiogenesis polypeptide was examined using CD-I mice. Firstly, the body weights of tumor bearing nude mice were carefully monitored during a 14-day treatment course. As shown in FIG. 8, no significant changes in mice body weight were observed in any treatment group. In addition, the toxicity’ was tested in normal CD-I mice. Three groups of mice (7 mice per group) were injected i.v. with one dose, two doses
and three doses of 100 JJ.1 of the polypeptide (100 mg/kg, 20 times of used dosage) with three day intervals between each injection. The animals were returned to their cages for 30 days. No deaths were observed among the tested mice. All animals behaved normally (no change in eating habits; no abnormal weight gain or loss; and no abnormal appearance on fur).
[0088] The toxicity studies showed that the anti-angiogenic agent and anti-angiogenic agent with PEG did not have acute toxicity for at least three doses that were approximately 20 fold higher than the dosage used in the tumor mice treatment. In addition, we also tested whether there w ere any liver, kidney, and cardiovascular damages upon treatment with the anti-angiogenic agent and anti-angiogenic agent with PEG. Histological analyses revealed no damage to organs of treated animals.
[0089] Example 6: N-Linked Glycosylation
[0090] The polypeptide shown in Sequence ID No: 11 was expressed and purified from the Pichia pastoris expression system. Expression of this polypeptide in yeast Pichia pastoris was achieved by both intracellular and secretion expression. This polypeptide was further purified using an ion exchange column. The polypeptide was expressed as a His-tag polypeptide. The His-tag was removed by thrombin cleavage. The glycosylated protein expressed and purified from Yeast Pichia pastoris was an anti-angiogenetic agent and was found have N-linked glycosylation. As shown in FIG. 13, cells treated by various examples of the anti-angiogenic agent showed robust viability.
[0091] Example 7: Terminal Glycine
[0092] The polypeptide shown in Sequence ID No: 12 was expressed and purified an expression system. Expression of this polypeptide in yeast Pichia pastoris is achieved by both intracellular and secretion expression. This polypeptide is further purified using an ion exchange column. The glycine tenninal protein is an anti-angiogenetic agent. Cells are treated by various examples, including the polypeptide described as Sequence ID No: 12 has robust viability.
[0093] Example 8: Sequences
[0094] SEQ ID NO: 1 is the amino acid sequence of domain one of CD2 from a rat (WT Rat CD2-D1):
RDSGTVWGAL GHGINLNIPN FQMTDDIDEV RWERGSTLVA
EFKRKMKPFL KSGAFEILAN GDLKIKNLTR DDSGTYNVTV
YSTNGTRILN KALDLRILE
[0095] SEQ ID NO:2 is the amino acid sequence of domain one of CD2 from human (WT Human CD2-D1):
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEK ETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKI QER
[0096] SEQ ID NO:3. referred to as M1WT or Agiol, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO1 by mutations W7Q, G8M. A9K, D94N, R96K, I97V, L98I, and E99I:
RDSGTVQMKL GHGINLNIPN FQMTDDIDEV RWERGSTLVA EFKRKMKPFL KSGAFEILAN GDLKIKNLTR DDSGTYNVTV YSTNGTRILN KALNLKVII
[0097] SEQ ID NO:4 is the amino acid sequence of a variant domain one of CD2 d derived from SEQ ID NO1 by mutations E41L K43V, K45L, M46G, K47S, P48V, and G53L:
RDSGTVKWKA GHGINLNIPN FQMTDDIDEV RWERGSTLVA EFKRKMKPFL KSGAFEILAN GDLKIKNLTR DDSGTYNVTV YSTNGTRILN KALSLDVNI
[0098] SEQ ID NO:5 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO1 by mutations E41N, M46Q, and F49S:
RDSGTEVIKA GHGINLNIPN FQMTDDIDEV RWERGSTLVA
EFKRKMKPFL KSGAFEILAN GDLKIKNLTR DDSGTYNVTV
YSTNGTRILN KALKLTAIL
[0099] SEQ ID NO: 6, referred to as ProAgio-PEG or Agio2, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO3 by mutations M23C:
RDSGTVQMKL GHGINLNIPN FQCTDDIDEV RWERGSTLVA EFKRKMKPFL KSGAFEILAN GDLKIKNLTR DDSGTYNVTV YSTNGTRILN KALNLKVII
[0100] SEQ ID NO:7 is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO1 by mutations E41I, K43V, K45L, M46G, K47S, and F49S:
RDSGTVWGAL GHGINLNIPN FQMTDDIDEV RWERGSTLVA IFVRLGSVKM KPLLKSGAFE ILANGDLKIK NLTRDDSGTY NVTVYSTNGT RILNKALDLR ILE
[0101] SEQ ID NO:8 is the amino acid sequence of a variant domain one of CD2: RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVANFKRKQKPS L KSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILE
[0102] SEQ ID NOV, referred to as hProAgioB or Agio3, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO2 by mutations E8S, T9V, W10Q, G1 IM, A12K, D99N, I102V, Q103I, and E104L
KE1TNALSVQMKLGQD1NLDIPSFQMSDDIDD1KWEKTSDKKKIAQFRKEK ETFKEKDTYELLKNGALKIKHLKTDDQDIYKVSIADTKGKNVLEKIFNLK VIIR
[0103] SEQ ID NOTO , referred to as hProAgio or Agio4, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NOV by mutations M30C:
KEITNALSVQMKLGQDINLDIPSFQCSDDIDDIKWEKTSDKKKIAQFRKEK ETFKEKDTYELLKNGALKIKHLKTDDQDIYKVSIADTKGKNVLEKIFNLK VII
[0104] SEQ ID NO: 11, referred to as hProAgioY or Agio5, is the amino acid sequence of a variant domain one of CD2 form yeast:
KEITNALSVQMKLGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEK
ETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIADTKGKNVLEKIFNLK
VIT
[0105] SEQ ID NO: 12, referred to as Agio6, is the amino acid sequence of a variant domain one of CD2 derived from SEQ ID NO:9 by mutations M30C and aterminal glycine (G) or an additional terminal glycine (G):
GKEITNALSVQMKLGQDINLDIPSFQCSDDIDDIKWEKTSDKKKIAQFRKE KETFKEKDTYELLKNGALKIKHLKTDDQDIYKVSIADTKGKNVLEKIFNL KVII
[0106] Example 7: Tumor Grow th Suppression
[0107] FIG. 10 shows the growth curve of the tumor through 14 days or more of treatment. The results show that hProAgio or Agio4, developed from the polypeptide encoding SEQ ID NO: 10. was effective in suppressing tumor growth. The experiments were carried out using PC-3 xenograft using hProAgio or Agio4 (10 mg/kg, daily dose) and using buffered saline as a control. The treatments were started 8 days post tumor inoculation.
[0108] Example 8: Effectiveness against AVASTIN®
[0109] To further test the effectiveness of the anti-angiogenic polypetide, experiments with PC-3 xenografts using rProAgio-PEG or Agio2 (20 mg/k, daily dose) and Avastin (20 mg/kg, one dose every two days) were carried and analyzed. The treatments were started 21 days post tumor inoculation. FIG. 11 is the tumor growth curve of Avastin® and rProAgio-PEG or Agio2. FIG. 12 shows graphic representation of the weight of the tumor at end of 14 day treatment course - the tumors in each treatment group were extracted and weighed. There were significant differences in the tumor weights and growlh of the animal groups that were treated by Agio2 and AVASTIN®.
[0110] The foregoing detailed description and the appended figures have been presented only for illustrative and descriptive purposes. They are not intended to be exhaustive and are not intended to limit the spirit of the invention. The embodiments w ere selected and described to best explain the principles of the invention and its practical applications. One
skilled in the art will recognize that many variations can be made to the invention disclosed in this specification without departing from the scope and spirit of the invention.
Claims
1. A polypeptide for reducing or inhibiting angiogenesis comprising an amino acid segment with a variation of domain one of the cluster of differentiation 2 (CD2) protein from human or rat, wherein the polypeptide has more than 95% sequence identity to SEQ ID NO: 12 and wherein the polypeptide has a terminal glycine.
2. The polypeptide of claim 1, wherein the polypeptide has more than 99% sequence identity to SEQ ID NO: 12.
3. The polypeptide of claim 1, wherein the polypeptide's amino acid sequence is identical to SEQ ID NO: 12.
4. The polypeptide of claim 1, further comprising a polyethylene glycol (PEG) moiety.
5. The polypeptide of claim 1, further comprising a glycan moiety.
6. A pharmaceutical composition comprising a therapeutically effective amount of a polypeptide with an amino acid segment having a variation of domain one of CD2 protein from human or rat, wherein the polypeptide has more than 95% sequence identity to SEQ ID NO: 12.
7. The pharmaceutical composition of claim 6, wherein the polypeptide is suitable for systemic administration.
8. An injectable solution or suspension comprising the polypeptide of claim 1, wherein the polypeptide is in a suspension.
9. The injectable solution or suspension of claim 8, further comprising a pharmaceutically acceptable excipient, carrier, or diluent.
10. A method of reducing angiogenesis in an individual needing such reduction, involving administering a therapeutically effective dose of a polypeptide with an amino acid segment varying from domain one of CD2 protein, where the polypeptide has more
than 95% sequence identity to SEQ ID NO: 12 and the terminus of the polypeptide is a glycine.
11. The method of claim 10, where the amino acid sequence is identical to SEQ ID NO: 12.
12. The method of claim 10, wherein the individual has a disorder selected from the group consisting of tumor growth, atherosclerosis, diabetic retinopathy, age-related maculopathy, and retrolental fibroplasia.
13. The method of claim 10, wherein the polypeptide is administered by a route selected from the group consisting of intravenous, in or around a solid tumor, systemic, intraarterial, intraocular, intraperitoneal, and topical.
14. The method of claim 10, further comprising administering a therapeutically effective amount of at least one other therapeutic agent.
15. The method of claim 10, further comprising administering radiation therapy and administering a therapeutically effective or prophylactic amount of a second agent.
16. The method of claim 10, wherein the polypeptide is administered as part of a pharmaceutical composition including a pharmaceutically acceptable carrier or diluent.
17. The method of claim 10, further comprising administering radiation therapy.
18. The method of claim 10, wherein the angiogenesis is pathogenic.
19. The method of claim 10, wherein the individual has cancer.
20. The method of claim 19, wherein the cancer is breast carcinoma, lung carcinoma, colon carcinoma, prostate carcinoma, ovarian carcinoma, neuroblastoma, central nervous system tumor, glioblastoma multiforme or melanoma.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202363484968P | 2023-02-14 | 2023-02-14 | |
| PCT/US2024/015787 WO2024173546A2 (en) | 2023-02-14 | 2024-02-14 | Anti-angiogenic agent and methods of using such agent |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4665378A2 true EP4665378A2 (en) | 2025-12-24 |
Family
ID=92422264
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP24757617.6A Pending EP4665378A2 (en) | 2023-02-14 | 2024-02-14 | Anti-angiogenic agent and methods of using such agent |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP4665378A2 (en) |
| JP (1) | JP2026505594A (en) |
| CN (1) | CN121240871A (en) |
| AU (1) | AU2024223049A1 (en) |
| WO (1) | WO2024173546A2 (en) |
-
2024
- 2024-02-14 WO PCT/US2024/015787 patent/WO2024173546A2/en not_active Ceased
- 2024-02-14 EP EP24757617.6A patent/EP4665378A2/en active Pending
- 2024-02-14 JP JP2025546492A patent/JP2026505594A/en active Pending
- 2024-02-14 CN CN202480022775.0A patent/CN121240871A/en active Pending
- 2024-02-14 AU AU2024223049A patent/AU2024223049A1/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| CN121240871A (en) | 2025-12-30 |
| JP2026505594A (en) | 2026-02-16 |
| AU2024223049A1 (en) | 2025-09-25 |
| WO2024173546A2 (en) | 2024-08-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2019202174B2 (en) | Anti-angiogenic agent and method of using such agent | |
| US20040087531A1 (en) | Compositions and methods for the treatment of cancer | |
| US20040156828A1 (en) | Adeno-associated virus mediated B7.1 vaccination synergizes with angiostatin to eradicate disseminated liver metastatic cancers | |
| US20210008173A1 (en) | Endostatin peptides for the treatment of tumors, fibrosis and acute lung injury | |
| US12410230B2 (en) | Anti-angiogenic agent and methods of using such agent | |
| WO2024173546A2 (en) | Anti-angiogenic agent and methods of using such agent | |
| US20240390465A1 (en) | Endostatin Peptides for the Treatment of Tumors, Fibrosis and Acute Lung Injury | |
| WO2019213173A1 (en) | Neural stem cell compositions including chimeric poxviruses for cancer treatment | |
| US20240158521A1 (en) | DNA-ENCODED BISPECIFIC ANTIBODIES TARGETING IL13Ra2 AND METHODS OF USE IN CANCER THERAPEUTICS | |
| US20230241167A1 (en) | Use of Caveolin-1 Scaffolding Domain Peptides for Treating Disease and Disorders | |
| WO2010057962A2 (en) | Crf conjugates with extended half-lives |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20250912 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR |