EP4441089A1 - Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer - Google Patents

Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer

Info

Publication number
EP4441089A1
EP4441089A1 EP22826075.8A EP22826075A EP4441089A1 EP 4441089 A1 EP4441089 A1 EP 4441089A1 EP 22826075 A EP22826075 A EP 22826075A EP 4441089 A1 EP4441089 A1 EP 4441089A1
Authority
EP
European Patent Office
Prior art keywords
editing
seq
base
cells
guide rna
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP22826075.8A
Other languages
German (de)
English (en)
French (fr)
Inventor
Annarita MICCIO
Panagiotis ANTONIOU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Assistance Publique Hopitaux de Paris APHP
Institut National de la Sante et de la Recherche Medicale INSERM
Fondation Imagine
Universite Paris Cite
Original Assignee
Assistance Publique Hopitaux de Paris APHP
Institut National de la Sante et de la Recherche Medicale INSERM
Fondation Imagine
Universite Paris Cite
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Assistance Publique Hopitaux de Paris APHP, Institut National de la Sante et de la Recherche Medicale INSERM, Fondation Imagine, Universite Paris Cite filed Critical Assistance Publique Hopitaux de Paris APHP
Publication of EP4441089A1 publication Critical patent/EP4441089A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/795Porphyrin- or corrin-ring-containing peptides
    • C07K14/805Haemoglobins; Myoglobins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0647Haematopoietic stem cells; Uncommitted or multipotent progenitors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/65MicroRNA
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • ⁇ -hemoglobinopathies ⁇ -thalassemia and sickle cell disease (SCD) are monogenic diseases caused by mutations in the ⁇ -globin locus, affecting the synthesis or the structure of the adult hemoglobin (Hb).
  • ⁇ -thalassemia is caused by mutations in the ⁇ -globin gene (HBB) locus that reduce ( ⁇ +) or abolish ( ⁇ 0) the production of ⁇ -globin chains included in the adult hemoglobin (HbA) tetramer, leading to the precipitation of uncoupled ⁇ -globin chains, erythroid cell death and severe anemia (Taher et al., 2018).
  • HBB ⁇ -globin gene
  • HbA adult hemoglobin
  • SCD an A>T mutation in the HBB gene causes the substitution of valine for glutamic acid at position 6 of the ⁇ -globin chain ( ⁇ S), which is responsible for deoxygenation-induced polymerization of sickle hemoglobin (HbS).
  • Genome editing technology has been exploited to develop therapeutic approaches for ⁇ -hemoglobinopathies, based on direct gene correction.
  • These approaches use designer nucleases, such as the CRISPR/Cas9 system that induces DNA double-strand breaks (DSBs) via a single guide RNA (gRNA) complementary to a specific genomic target (Cavazzana et al., 2017).
  • the DSB can be repaired via homologous-directed repair (HDR), by providing a donor DNA template containing the wild type sequence.
  • HDR-mediated gene correction is poorly efficient in HSCs.
  • BCL11A is one of the major repressors of HBG1/2. Studies aimed to completely inactivate BCL11A showed that it adversely affects lymphoid development and vital HSC functions (Liu et al., 2003; Yu et al., 2012; Guda et al., 2015) and human RBC enucleation (Chang et al., 2017). On the contrary, precise BCL11A downregulation through targeting of its erythroid specific enhancers can derepress ⁇ -globin without adverse effects (Wu et al., 2019).
  • Cas9/gRNA treatment of human HSPCs induces a DNA damage response that can lead to apoptosis (Cromer et al., 2018).
  • CRISPR/Cas9 can cause P53- dependent cell toxicity and cell cycle arrest, resulting in the negative selection of cells with a functional P53 pathway (Haapaniemi et al., 2018).
  • the generation of several on- target DSBs, simultaneous on-target and off-target DSBs, or even a single on-target DSB is associated with a risk of deletion, inversion and translocation (Kosicki et al., 2018).
  • the present invention is defined by the claims.
  • the present invention relates to methods for increasing fetal hemoglobin content in eukaryotic cells and uses thereof for the treatment of hemoglobinopathies.
  • DETAILED DESCRIPTION OF THE INVENTION To avoid DSB-induced toxicity, the erythroid specific BCL11A enhancer and specifically the ATF4 binding site can be targeted using CBE- and ABE-mediated base-editing approaches in order to downregulate BCL11A expression and reactivate HbF.
  • the inventors exploited CBEs and ABEs to dissect the ATF4 binding site in SCD HSPCs and identify the critical base conversions that induce changes in enhancer activity, BCL11A downregulation, and consecutively, HbF reactivation and sickling phenotype rescue.
  • ⁇ -hemoglobinopathy has its general meaning in the art and refers to any defect in the structure or function of any hemoglobin of an individual, and includes defects in the primary, secondary, tertiary or quaternary structure of hemoglobin caused by any mutation, such as deletion mutations or substitution mutations in the coding regions of the HBB gene, or mutations in, or deletions of, the promoters or enhancers of such gene that cause a reduction in the amount of hemoglobin produced as compared to a normal or standard condition.
  • the term "sickle cell disease” has its general meaning in the art and refers to a group of autosomal recessive genetic blood disorders, which results from mutations in a globin gene and which is characterized by red blood cells that assume an abnormal, rigid, sickle shape. They are defined by the presence of ⁇ S-globin gene coding for a ⁇ -globin chain variant in which glutamic acid is substituted by valine at amino acid position 6 of the peptide: incorporation of the ⁇ S-globin in the Hb tetramers (HbS, sickle Hb) leads to Hb polymerization and to a clinical phenotype.
  • HbSS sickle cell anemia
  • HbSC sickle-hemoglobin C disease
  • HbS/ ⁇ + sickle beta-plus- thalassaemia
  • HbS/ ⁇ 0 sickle beta-zerothalassaemia
  • ⁇ -thalassemia refers to a hemoglobinopathy that results from an altered ratio of ⁇ -globin to ⁇ -like globin polypeptide chains resulting in the underproduction of normal hemoglobin tetrameric proteins and the precipitation of free, unpaired ⁇ -globin chains.
  • hematopoietic stem cell or “HSC” refers to blood cells that have the capacity to self-renew and to differentiate into precursors of blood cells. These precursor cells are immature blood cells that cannot self-renew and must differentiate into mature blood cells.
  • Hematopoietic stem progenitor cells display a number of phenotypes, such as Lin- CD34+CD38 ⁇ CD90+CD45RA ⁇ , Lin-CD34+CD38 ⁇ CD90 ⁇ CD45RA ⁇ , Lin- CD34+CD38+IL-3aloCD45RA ⁇ , and Lin-CD34+CD38+CD10+(Daley et al., Focus 18:62-67, 1996; Pimentel, E., Ed., Handbook of Growth Factors Vol. III: Hematopoietic Growth Factors and Cytokines, pp. 1-2, CRC Press, Boca Raton, Fla., 1994).
  • the stem cells self-renew and maintain continuous production of hematopoietic stem cells that give rise to all mature blood cells throughout life.
  • the hematopoietic progenitor cells or hematopoietic stem cells are isolated form peripheral blood cells.
  • peripheral blood cells refer to the cellular components of blood, including red blood cells, white blood cells, and platelets, which are found within the circulating pool of blood.
  • the eukaryotic cell is a bone marrow derived stem cell.
  • bone marrow-derived stem cells refers to stem cells found in the bone marrow.
  • Stem cells may reside in the bone marrow, either as an adherent stromal cell type that possess pluripotent capabilities, or as cells that express CD34 or CD45 cell-surface protein, which identifies hematopoietic stem cells able to differentiate into blood cells.
  • the term “mobilization” or “stem cell mobilization” refers to a process involving the recruitment of stem cells from their tissue or organ of residence to peripheral blood following treatment with a mobilization agent. This process mimics the enhancement of the physiological release of stem cells from tissues or organs in response to stress signals during injury and inflammation. The mechanism of the mobilization process depends on the type of mobilization agent administered. Some mobilization agents act as agonists or antagonists that prevent the attachment of stem cells to cells or tissues of their microenvironment.
  • mobilization agents induce the release of proteases that cleave the adhesion molecules or support structures between stem cells and their sites of attachment.
  • the term “mobilization agent” refers to a wide range of molecules that act to enhance the mobilization of stem cells from their tissue or organ of residence, e.g., bone marrow (e.g., CD34+ stem cells) and spleen (e.g., Hox11+ stem cells), into peripheral blood.
  • Mobilization agents include chemotherapeutic drugs, e.g., cyclophosphamide and cisplatin; cytokines, and chemokines, e.g., granulocyte colony-stimulating factor (G-CSF), granulocyte- macrophage colony-stimulating factor (GM-CSF), stem cell factor (SCF), Fms-related tyrosine kinase 3 (flt-3) ligand, stromal cell-derived factor 1 (SDF-1); agonists of the chemokine (C— C motif) receptor 1 (CCR1), such as chemokine (C—C motif) ligand 3 (CCL3, also known as macrophage inflammatory protein-1 ⁇ (Mip-1 ⁇ )); agonists of the chemokine (C—X—C motif) receptor 1 (CXCR1) and 2 (CXCR2), such as chemokine (C—X—C motif) ligand 2 (CXCL2) (also known as
  • a mobilization agent increases the number of stem cells in peripheral blood, thus allowing for a more accessible source of stem cells for use in transplantation, organ repair or regeneration, or treatment of disease.
  • isolated cell refers to a cell that has been removed from an organism in which it was originally found, or a descendant of such a cell.
  • the eukaryotic cell has been cultured in vitro, e.g., in the presence of other cells.
  • the eukaryotic cell is later introduced into a second organism or reintroduced into the organism from which it (or the cell from which it is descended) was isolated.
  • isolated population with respect to an isolated population of cells as used herein refers to a population of cells that has been removed and separated from a mixed or heterogeneous population of cells. In some embodiments, an isolated population is a substantially pure population of cells as compared to the heterogeneous population from which the cells were isolated or enriched.
  • alpha globin or “ ⁇ -globin” has its general meaning in the art and refers to protein that is encoded in human by the HBA1 and HBA2 genes.
  • the human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'.
  • the alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions.
  • the ENSEMBL IDs i.e. the gene identifier number from the Ensembl Genome Browser database
  • HBA1 and HBA2 are ENSG00000206172 and ENSG00000188536 respectively.
  • haemoglobin As used herein, the term “beta globin” or “ ⁇ -globin” has its general meaning in the art and refers to a globin protein, which along with alpha globin (HBA), makes up the most common form of haemoglobin (Hb) in adult humans. Normal adult human Hb is a heterotetramer consisting of two alpha chains and two beta chains. HBB is encoded by the HBB gene on human chromosome 11. It is 146 amino acids long and has a molecular weight of 15,867 Da. As used herein, the term “gamma globin” or “ ⁇ -globin” has its general meaning in the art and refers to protein that is encoded in human by the HBG1 and HBG2 genes.
  • the HBG1 and HBG2 genes are normally expressed in the fetal liver, spleen and bone marrow.
  • Two ⁇ -globin chains together with two ⁇ -globin chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) in the year following birth.
  • the ENSEMBL IDs i.e. the gene identifier number from the Ensembl Genome Browser database
  • HBG1 and HBG2 are ENSG00000213934 and ENSG00000196565 respectively.
  • transcriptional repressor has its general meaning in the art and refers a protein (transcription factor) that decreases gene transcription of a gene or set of genes.
  • BCL11A is DNA-binding proteins that bind to enhancers or promoter-proximal elements.
  • BCL11A has its general meaning in the art and refers to the gene encoding for BAF chromatin remodeling complex subunit BCL11A (Gene ID: 53335). The term is also known as EVI9; CTIP1; DILOS; ZNF856; HBFQTL5; BCL11A-L; BCL11A-S; BCL11a-M; or BCL11A-XL. Five alternatively spliced transcript variants of this gene, which encode distinct isoforms, have been reported.
  • the protein associates with the SWI/SNF complex that regulates gene expression via chromatin remodeling.
  • BCL11A is highly expressed in several hematopoietic lineages, and plays a role in the switch from ⁇ - to ⁇ -globin expression during the fetal to adult erythropoiesis transition (Sankaran VJ et al. "Human fetal hemoglobin expression is regulated by the developmental stage-specific repressor BCL11A”, Science Science.2008 Dec 19;322(5909):1839-42).
  • the term “transcriptional activator” has its general meaning in the art and refers to a protein that increases gene transcription of a gene or set of genes.
  • activators are DNA-binding proteins that bind to enhancers or promoter-proximal elements.
  • the activator ATF4 has its general meaning in the art and refers to the activating transcription factor 4 (tax-responsive enhancer element B67) that is a protein that in humans is encoded by the ATF4 gene (Gene ID:468).
  • ATF4 is thus a transcriptional activator that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1.
  • the encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2).
  • the protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB- like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication.
  • transcriptional activator binding site refers to a site present on DNA whereby the transcriptional activator according to the present disclosure binds.
  • the base-editing enzyme of the present invention edits the genome sequence of the eukaryotic cell so that the activator is able to bind to its transcriptional activator binding site.
  • the expression “+55-kb region of the erythroid-specific BCL11A enhancer” refers to the region depicted in Figure 1 and having the nucleotide acid sequence as set forth in SEQ ID NO:1.
  • the “ATF4 binding site” ranges from the nucleotide at position 21 to the nucleotide at position 31 in SEQ ID NO:1 (i.e. TTGCATCATCC (SEQ ID NO: 45)).
  • SEQ ID NO:1 “+55-kb region of the erythroid-specific BCL11A enhancer.
  • the ATF4 binding site is indicated in bold and underlined.
  • GAGCTCACAGCCTCCAAGCATTGCATCATCCTGGTACCAGGAAGGC As used herein, the term “expression” refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins.
  • Transcripts and encoded polypeptides may be collectively referred to as “gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell. Any method known in the art can be used to measure the expression of the gene (e. g. HPLC analysis of protein and RT-qPCR analysis of mRNA.) Typically, said methods are described in the EXAMPLE.
  • the expression "increasing the fetal hemoglobin content” indicates that fetal hemoglobin is at least 5% higher in the eukaryotic cell treated with the gene editing platform, than in a comparable, eukaryotic cell, wherein a gene editing platform targeting an unrelated locus is present or where no gene editing platform is present.
  • the percentage of fetal hemoglobin expression in the eukaryotic cell is at least 10% higher, at least 20% higher, at least 30% higher, at least 40% higher, at least 50% higher, at least 60% higher, at least 70% higher, at least 80% higher, at least 90% higher, at least 1-fold higher, at least 2- fold higher, at least 5-fold higher, at least 10-fold higher, at least 100 fold higher, at least 1000- fold higher, or more than an eukaryotic cell.
  • the expression "repressing the expression BCL11A” indicates the expression of BCL11A is at least 5% lower in the eukaryotic cell contacted with the gene editing platform of the present invention than in a comparable eukaryotic cell that was not contacted with said gene editing platform.
  • the percentage of BCL11A expression in the eukaryotic cell is at least 10% lower, at least 20% lower, at least 30% lower, at least 40% lower, at least 50% lower, at least 60% lower, at least 70% lower, at least 80% lower, at least 90% lower, at least 1-fold lower, at least 2-fold lower, at least 5-fold lower, at least 10 fold lower, at least 100 fold lower, at least 1000-fold lower, or less than an eukaryotic cell that was not contacted with the gene editing platform.
  • polypeptide “peptide” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, pegylation, or any other manipulation, such as conjugation with a labeling component.
  • amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
  • nucleic acid molecule or “polynucleotide” refers to a DNA molecule (for example, but not limited to, a cDNA or genomic DNA).
  • the nucleic acid molecule can be single-stranded or double-stranded.
  • isolated when referring to nucleic acid molecules or polypeptides means that the nucleic acid molecule or the polypeptide is substantially free from at least one other component with which it is associated or found together in nature.
  • complementarity refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base- pairing or other non-traditional types.
  • a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary).
  • Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
  • “Substantially complementary” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
  • stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors.
  • hybridization or “hybridizing” refers to a process where completely or partially complementary nucleic acid strands come together under specified hybridization conditions to form a double-stranded structure or region in which the two constituent strands are joined by hydrogen bonds.
  • fusion polypeptide or “fusion protein” means a protein created by joining two or more polypeptide sequences together.
  • the fusion polypeptides encompassed in this invention include translation products of a chimeric gene construct that joins the nucleic acid sequences encoding a first polypeptide, e.g., an RNA-binding domain, with the nucleic acid sequence encoding a second polypeptide, e.g., an effector domain, to form a single open- reading frame.
  • a “fusion polypeptide” or “fusion protein” is a recombinant protein of two or more proteins which are joined by a peptide bond or via several peptides.
  • the fusion protein may also comprise a peptide linker between the two domains.
  • wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
  • derived from refers to a process whereby a first component (e.g., a first molecule), or information from that first component, is used to isolate, derive or make a different second component (e.g., a second molecule that is different from the first).
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described below.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch algorithm (Needleman, Saul B. & Wunsch, Christian D. (1970). "A general method applicable to the search for similarities in the amino acid sequence of two proteins". Journal of Molecular Biology.48 (3): 443–53.).
  • the percent identity between two nucleotide or amino acid sequences may also be determined using for example algorithms such as EMBOSS Needle (pair wise alignment; available at www.ebi.ac.uk).
  • EMBOSS Needle may be used with a BLOSUM62 matrix, a “gap open penalty” of 10, a “gap extend penalty” of 0.5, a false “end gap penalty”, an “end gap open penalty” of 10 and an “end gap extend penalty” of 0.5.
  • the “percent identity” is a function of the number of matching positions divided by the number of positions compared and multiplied by 100. For instance, if 6 out of 10 sequence positions are identical between the two compared sequences after alignment, then the identity is 60%.
  • % identity is typically determined over the whole length of the query sequence on which the analysis is performed.
  • Two molecules having the same primary amino acid sequence or nucleic acid sequence are identical irrespective of any chemical and/or biological modification.
  • a first amino acid sequence having at least 90% of identity with a second amino acid sequence means that the first sequence has 90; 91; 92; 93; 94; 95; 96; 97; 98; 99 or 100% of identity with the second amino acid sequence.
  • linker refers to any means, entity or moiety used to join two or more entities.
  • a linker can be a covalent linker or a non-covalent linker.
  • covalent linkers include covalent bonds or a linker moiety covalently attached to one or more of the proteins or domains to be linked.
  • the linker can also be a non-covalent bond, e.g., an organometallic bond through a metal center such as platinum atom.
  • various functionalities can be used, such as amide groups, including carbonic acid derivatives, ethers, esters, including organic and inorganic esters, amino, urethane, urea and the like.
  • the domains can be modified by oxidation, hydroxylation, substitution, reduction etc. to provide a site for coupling. Methods for conjugation are well known by persons skilled in the art and are encompassed for use in the present invention.
  • Linker moieties include, but are not limited to, chemical linker moieties, or for example a peptide linker moiety (a linker sequence). It will be appreciated that modification which do not significantly decrease the function of the RNA- binding domain and effector domain are preferred.
  • the “linked” as used herein refers to the attachment of two or more entities to form one entity.
  • a conjugate encompasses both peptide-small molecule conjugates as well as peptide-protein/peptide conjugates.
  • the term “base-editing enzyme” refers to fusion protein comprising a defective CRISPR/Cas nuclease linked to a deaminase polypeptide. The term is also known as “base- editor”.
  • CBEs cytosine base-editing enzymes
  • ABEs adenine base-editing enzymes
  • cytosine base-editing enzymes are created by fusing the defective CRISPR/Cas nuclease to a deaminase.
  • deaminase refers to an enzyme that catalyses a deamination reaction.
  • deamination refers to the removal of an amine group from one molecule.
  • the deaminase is a cytidine deaminase, catalysing the hydrolytic deamination of cytidine or deoxycytidine to uracil or deoxyuracil, respectively.
  • the deaminase is an adenosine deaminase, catalysing the hydrolytic deamination of adenosine to inosine, which is treated like guanosine by the cell, creating an A to G (or T to C) change.
  • the term “nuclease” includes a protein (i.e.
  • CRISPR/Cas nuclease has its general meaning in the art and refers to segments of prokaryotic DNA containing clustered regularly interspaced short palindromic repeats (CRISPR) and associated nucleases encoded by Cas genes.
  • CRISPR clustered regularly interspaced short palindromic repeats
  • the CRISPR/Cas loci encode RNA-guided adaptive immune systems against mobile genetic elements (viruses, transposable elements and conjugative plasmids). Three types of CRISPR systems have been identified.
  • CRISPR clusters contain spacers, the sequences complementary to antecedent mobile elements. CRISPR clusters are transcribed and processed into mature CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) RNA (crRNA).
  • the CRISPR/Cas nucleases Cas9 and Cpf1 belong to the type II and type V CRISPR/Cas system and have strong endonuclease activity to cut target DNA. Cas9 is guided by a mature crRNA that contains about 20 nucleotides of unique target sequence (called spacer) and a trans-activating small RNA (tracrRNA) that also serves as a guide for ribonuclease III-aided processing of pre-crRNA.
  • spacer a mature crRNA that contains about 20 nucleotides of unique target sequence
  • tracrRNA trans-activating small RNA
  • the crRNA:tracrRNA duplex directs Cas9 to target DNA via complementary base pairing between the spacer on the crRNA and the complementary sequence (called protospacer) on the target DNA.
  • Cas9 recognizes a trinucleotide (NGG for S. Pyogenes Cas9) protospacer adjacent motif (PAM) to specify the cut site (the 3rd or the 4th nucleotide upstream from PAM).
  • NGS trinucleotide
  • PAM protospacer adjacent motif
  • Cas9 or “Cas9 nuclease” refers to an RNA-guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active or inactive DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9).
  • a Cas9 nuclease is also referred to sometimes as a casn1 nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat)-associated nuclease.
  • CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids).
  • CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc) and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre- crRNA. Subsequently, Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • tracrRNA trans-encoded small RNA
  • rnc endogenous ribonuclease 3
  • Cas9 protein serves as a guide for ribonuclease 3-aided processing of pre- crRNA.
  • RNA single guide RNAs
  • sgRNA single guide RNAs
  • gNRA single guide RNAs
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti et al., J. J., McShan W. M., Ajdic D. J., Savic D. J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A. N., Kenton S., Lai H. S., Lin S. P., Qian Y., Jia H.
  • Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua (NCBI Ref: NP_472073.1);
  • Cas9 nuclease comprises the amino acid sequence as set forth in SEQ ID NO: 2.
  • SEQ ID NO:2 Cas9 sequence MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTAR RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHL RKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVD AKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLD NLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQQ
  • nickase has its general meaning in the art and refers to an endonuclease which cleaves only a single strand of a DNA duplex. Accordingly, the term “Cas9 nickase” refers to a nickase derived from a Cas9 protein, typically by inactivating one nuclease domain of Cas9 protein.
  • guide RNA molecule generally refers to an RNA molecule (or a group of RNA molecules collectively) that can bind to a Cas9 protein and target the Cas9 protein to a specific location within a target DNA.
  • a guide RNA can comprise two segments: a DNA-targeting guide segment and a protein-binding segment.
  • the DNA-targeting segment comprises a nucleotide sequence that is complementary to (or at least can hybridize to under stringent conditions) a target sequence.
  • the protein-binding segment interacts with a CRISPR protein, such as a Cas9 or Cas9 related polypeptide. These two segments can be located in the same RNA molecule or in two or more separate RNA molecules. When the two segments are in separate RNA molecules, the molecule comprising the DNA-targeting guide segment is sometimes referred to as the CRISPR RNA (crRNA), while the molecule comprising the protein-binding segment is referred to as the trans-activating RNA (tracrRNA).
  • CRISPR RNA CRISPR RNA
  • tracrRNA trans-activating RNA
  • target nucleic acid refers to a nucleic acid containing a target nucleic acid sequence.
  • a target nucleic acid may be single-stranded or double-stranded, and often is double-stranded DNA.
  • a “target nucleic acid sequence,” “target sequence” or “target region,” as used herein, means a specific sequence or the complement thereof that one wishes to bind to using the CRISPR system as disclosed herein.
  • target nucleic acid strand refers to a strand of a target nucleic acid that is subject to base-pairing with a guide RNA as disclosed herein.
  • each strand can be a “target nucleic acid strand” to design crRNA and guide RNAs and used to practice the method of this invention as long as there is a suitable PAM site.
  • ribonucleoprotein complex refers to a complex or particle including a nucleoprotein and a ribonucleic acid.
  • a “nucleoprotein” as provided herein refers to a protein capable of binding a nucleic acid (e.g., RNA, DNA). Where the nucleoprotein binds a ribonucleic acid it is referred to as “ribonucleoprotein.”
  • the interaction between the ribonucleoprotein and the ribonucleic acid may be direct, e.g., by covalent bond, or indirect, e.g., by non-covalent bond (e.g. electrostatic interactions (e.g.
  • mutation has its general meaning in the art and refers to a substitution, deletion or insertion.
  • substitution means that a specific amino acid residue at a specific position is removed and another amino acid residue is inserted into the same position.
  • deletion means that a specific amino acid residue is removed.
  • insertion means that one or more amino acid residues are inserted before or after a specific amino acid residue.
  • mutagenesis refers to the introduction of mutations into a polynucleotide sequence.
  • variant refers to a first composition (e.g., a first molecule), that is related to a second composition (e.g., a second molecule, also termed a “parent” molecule).
  • the variant molecule can be derived from, isolated from, based on or homologous to the parent molecule.
  • a variant molecule can have entire sequence identity with the original parent molecule, or alternatively, can have less than 100% sequence identity with the parent molecule.
  • a variant of a sequence can be a second sequence that is at least 50; 51; 52; 53; 54; 55; 56; 57; 58; 59; 60; 61; 62; 63; 64; 65; 66; 67; 68; 69; 70; 71; 72; 73; 74; 75; 76; 77; 78; 79; 80; 81; 82; 83; 84; 85; 86; 87; 88; 89; 90; 91; 92; 93; 94; 95; 96; 97; 98; 99; 100% identical in sequence compare to the original sequence.
  • treatment refers to both prophylactic or preventive treatment as well as curative or disease modifying treatment, including treatment of patient at risk of contracting the disease or suspected to have contracted the disease as well as patients who are ill or have been diagnosed as suffering from a disease or medical condition, and includes suppression of clinical relapse.
  • the treatment may be administered to a subject having a medical disorder or who ultimately may acquire the disorder, in order to prevent, cure, delay the onset of, reduce the severity of, or ameliorate one or more symptoms of a disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
  • therapeutic regimen is meant the pattern of treatment of an illness, e.g., the pattern of dosing used during therapy.
  • a therapeutic regimen may include an induction regimen and a maintenance regimen.
  • the phrase “induction regimen” or “induction period” refers to a therapeutic regimen (or the portion of a therapeutic regimen) that is used for the initial treatment of a disease.
  • the general goal of an induction regimen is to provide a high level of drug to a patient during the initial period of a treatment regimen.
  • An induction regimen may employ (in part or in whole) a "loading regimen", which may include administering a greater dose of the drug than a physician would employ during a maintenance regimen, administering a drug more frequently than a physician would administer the drug during a maintenance regimen, or both.
  • maintenance regimen refers to a therapeutic regimen (or the portion of a therapeutic regimen) that is used for the maintenance of a patient during treatment of an illness, e.g., to keep the patient in remission for long periods of time (months or years).
  • a maintenance regimen may employ continuous therapy (e.g., administering a drug at regular intervals, e.g., weekly, monthly, yearly, etc.) or intermittent therapy (e.g., interrupted treatment, intermittent treatment, treatment at relapse, or treatment upon achievement of a particular predetermined criteria [e.g., pain, disease manifestation, etc.]).
  • the term "therapeutically effective amount” is meant a sufficient amount of population of cells to treat the disease at a reasonable benefit/risk ratio applicable to any medical treatment. It will be understood that the total usage compositions of the present invention will be decided by the attending physician within the scope of sound medical judgment.
  • the specific therapeutically effective dose level for any particular patient will depend upon a variety of factors including the age, body weight, general health, sex and diet of the patient, the time of administration, route of administration, the duration of the treatment, drugs used in combination or coincidental with the population of cells, and like factors well known in the medical arts.
  • the cells are formulated by first harvesting them from their culture medium, and then washing and concentrating the cells in a medium and container system suitable for administration (a "pharmaceutically acceptable" carrier) in a treatment-effective amount.
  • a medium and container system suitable for administration a "pharmaceutically acceptable” carrier
  • Suitable infusion medium can be any isotonic medium formulation, typically normal saline, Normosol R (Abbott) or Plasma-Lyte A (Baxter), but also 5% dextrose in water or Ringer's lactate can be utilized.
  • the infusion medium can be supplemented with human serum albumin.
  • a treatment-effective amount of cells in the composition is dependent on the relative representation of the cells with the desired specificity, on the age and weight of the recipient, and on the severity of the targeted condition.
  • This number of cells can be as low as approximately 103/kg, preferably 5x103/kg; and as high as 107/kg, preferably 108/kg.
  • the number of cells will depend upon the ultimate use for which the composition is intended, as will the type of cells included therein. Typically, the minimal dose is 2 millions of cells per kg. Usually 2 to 20 millions of cells are injected in the subject. The desired purity can be achieved by introducing a sorting step.
  • the cells are generally in a volume of a liter or less, can be 500 ml or less, even 250 ml or 100 ml or less.
  • the clinically relevant number of cells can be apportioned into multiple infusions that cumulatively equal or exceed the desired total amount of cells.
  • the first object of the present invention relates to a method for increasing fetal hemoglobin content in a eukaryotic cell comprising the step of contacting the eukaryotic cell with a gene editing platform that consists of a (a) at least one base-editing enzyme and (b) least one guide RNA molecule for guiding the base-editing enzyme to at least one target sequence in the +55-kb region of the erythroid-specific BCL11A enhancer, thereby editing and disrupting the ATF4 binding site in said region so as to repress the expression of BCL11A and subsequently increase the expression of ⁇ -globin.
  • a gene editing platform that consists of a (a) at least one base-editing enzyme and (b) least one guide RNA molecule for guiding the base-editing enzyme to at least one target sequence in the +55-kb region of the erythroid-specific BCL11A enhancer, thereby editing and disrupting the ATF4 binding site in said region so as to repress the expression
  • the eukaryotic cell is selected from the group consisting of hematopoietic progenitor cells, hematopoietic stem cells (HSCs), pluripotent cells (i.e. embryonic stem cells (ES) and induced pluripotent stem cells (iPS)).
  • the eukaryotic cell results from a stem cell mobilization.
  • the base-editing enzyme of the present invention comprises a defective CRISPR/Cas nuclease.
  • the sequence recognition mechanism is the same as for the non- defective CRISPR/Cas nuclease.
  • the defective CRISPR/Cas nuclease of the invention comprises at least one RNA binding domain.
  • the RNA binding domain interacts with a guide RNA molecule as defined hereinafter.
  • the defective CRISPR/Cas nuclease of the invention is a modified version with no nuclease activity. Accordingly, the defective CRISPR/Cas nuclease specifically recognizes the guide RNA molecule and thus guides the base-editing enzyme to its target DNA sequence.
  • the defective CRISPR/Cas nuclease can be modified to increase nucleic acid binding affinity and/or specificity, alter an enzymatic activity, and/or change another property of the protein.
  • the nuclease domains of the protein can be modified, deleted, or inactivated.
  • the protein can be truncated to remove domains that are not essential for the function of the protein. In some embodiments, the protein is truncated or modified to optimize the activity of the RNA binding domain.
  • the CRISPR/Cas nuclease consists of a mutant CRISPR/Cas nuclease i.e. a protein having one or more point mutations, insertions, deletions, truncations, a fusion protein, or a combination thereof. In some embodiments, the mutant has the RNA-guided DNA binding activity, but lacks one or both of its nuclease active sites.
  • the mutant comprises an amino acid sequence having at least 50% of identity with the wild type amino acid sequence of the CRISPR/Cas nuclease.
  • CRISPR/Cas nucleases can be used in this invention.
  • suitable CRISPR/CRISPR/Cas nucleases include Cas3, Cas4, Cas5, Cas5e (or CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9, Cas10, Cas10d, CasF, CasG, CasH, Csy1, Csy2, Csy3, Cse1 (or CasA), Cse2 (or CasB), Cse3 (or CasE), Cse4 (or CasC), Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1,
  • the CRISPR/Cas nuclease is derived from a type II CRISPR-Cas system. In some embodiments, the CRISPR/Cas nuclease is derived from a Cas9 protein.
  • the Cas9 protein can be from Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Nocardiopsis rougevillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaromonas naphthalenivorans, Polaromonas sp., Crocosphaera watsonii, Cyanothece sp., Microcystis aeruginosa, Synechococcus s
  • the CRISPR/Cas nuclease is a mutant of a wild type CRISPR/Cas nuclease (such as Cas9) or a fragment thereof.
  • the CRISPR/Cas nuclease is a mutant Cas9 protein from S. pyogenes.
  • Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science.337:816-821(2012); Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell.
  • the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain.
  • the HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9.
  • the mutations D10A and H841A completely inactivate the nuclease activity of S.
  • the CRISPR/Cas nuclease of the present invention is nickase and more particularly a Cas9 nickase i.e. the Cas9 from S. pyogenes having one mutation selected from the group consisting of D10A and H840A.
  • the nickase of the present invention comprises the amino acid sequence as set forth in SEQ ID NO: 3 or SEQ ID NO:4. SEQ ID NO: 3> S.
  • variants of dCas9 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to SEQ ID NO: 2 or 3.
  • variants of dCas9 are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 2 or 3, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
  • the second component of the base-editing enzyme herein disclosed comprises a non-nuclease DNA modifying enzyme that is a deaminase.
  • the deaminase is a cytidine deaminase.
  • the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase. In some embodiments, the deaminase is an APOBEC1 family deaminase. In some embodiments, the deaminase is an activation-induced cytidine deaminase (AID). In some embodiments, the deaminase is an ACF1/ASE deaminase.
  • APOBEC apolipoprotein B mRNA-editing complex
  • the deaminase is selected from the group consisting of AID: activation induced cytidine deaminase, APOBEC1: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 1, APOBEC3A: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A, APOBEC3B: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, APOBEC3C: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C, APOBEC3D: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D, APOBEC3F: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, APOBEC3G: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G, APOBEC3G
  • the deaminase derives from the Activation Induced cytidine Deaminase (AID).
  • AID is a cytidine deaminase that can catalyze the reaction of deamination of cytosine in the context of DNA or RNA.
  • AID changes a C base to U base. In dividing cells, this could lead to a C to T point mutation.
  • the change of C to U could trigger cellular DNA repair pathways, mainly excision repair pathway, which will remove the mismatching U-G base-pair, and replace with a T-A, A-T, C-G, or G-C pair.
  • the DNA modifying enzyme is AID* ⁇ that is an AID mutant with increased SHM activity whose Nuclear Export Signal (NES) has been removed (Hess GT, Fresard L, Han K, Lee CH, Li A, Cimprich KA, Montgomery SB, Bassik MC: Directed evolution using dCas9-targeted somatic hypermutation in mammalian cells. Nat Methods 2016, 13(12):1036-1042).
  • the deaminase consists of a variant of the amino acid sequence as set forth in SEQ ID NO:5-15.
  • the deaminase is an ADAT family deaminase.
  • the adenosine deaminase variant is a TadA deaminase.
  • the adenosine deaminase variant is a Staphylococcus aureus TadA, a Bacillus subtilis TadA, a Salmonella typhimurium TadA, a Shewanella putrefaciens TadA, a Haemophilus influenzae F3031 TadA, a Caulobacter crescentus TadA, or a Geobacter sulfurreducens TadA, or a fragment thereof.
  • the TadA deaminase is an E. coli TadA deaminase (ecTadA). In some embodiments, the TadA deaminase is a truncated E. coli TadA deaminase.
  • the truncated ecTadA may be missing one or more N-terminal amino acids relative to a full-length ecTadA. In some embodiments, the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N-terminal amino acid residues relative to the full length ecTadA.
  • the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20C- terminal amino acid residues relative to the full length ecTadA.
  • the TadA deaminase is TadA*7.10.
  • the TadA deaminase is a TadA*8 variant.
  • deaminase are described in International PCT Application WO2018/027078, WO2017/070632, WO/2020/168132, WO/2021/050571 each of which is incorporated herein by reference for its entirety.
  • amino acid sequence for the wild type TadA(wt) adenosine deaminase is shown as SEQ ID NO: 16.
  • amino acid sequence of the adenosine deaminase comprises at least 90% sequence identity to SEQ ID NO:16.
  • amino acid sequence of the adenosine deaminase comprises the modification at position 82 as numbered in SEQ ID NO: 16.
  • the amino acid sequence comprises of the adenosine deaminase comprises a V82S modification, wherein position 82 is as numbered in SEQ ID NO: 16. In some embodiments, the amino acid sequence of the adenosine deaminase comprises the modification at position 166 as numbered in SEQ ID NO:16. In some embodiments, the amino acid sequence of the adenosine deaminase comprises a T166R modification, wherein position 166 is as numbered in SEQ ID NO: 16. In some embodiments, the amino acid sequence of the adenosine deaminase comprises modifications at positions 82 and 166 as numbered in SEQ ID NO: 16.
  • the amino acid sequence of the adenosine deaminase comprises V82S and T166R modifications, wherein positions 82 and 166 are as numbered in SEQ ID NO: 16.
  • the adenosine deaminase variant further comprises one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, and Q154R.
  • the adenosine deaminase variant comprises a combination of alterations selected from the group consisting of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R.
  • the adenosine deaminase variant is TadA*8.1, TadA*8.2, TadA*8.3, TadA*8.4, TadA*8.5, TadA*8.6, TadA*8.7, TadA*8.8, TadA*8.9, TadA*8.10, TadA*8.11, TadA*8.12, TadA*8.13, TadA*8.14, TadA*8.15, TadA*8.16, TadA*8.17, TadA*8.18, TadA*8.19, TadA*8.20, TadA*8.21, TadA*8.22, TadA*8.23, or TadA*8.24.
  • the adenosine deaminase is provided as a single (e.g., provided as a monomer) TadA variant as described above. In some embodiments, adenosine deaminase is provided as a heterodimer of a wild-type TadA (TadA(wt)) linked to a TadA variant as described above.
  • TadA(wt) wild-type TadA
  • the deaminase is fused to the N-terminus of the defective CRISPR/Cas nuclease. In some embodiments, the deaminase is fused to the C-terminus of the defective CRISPR/Cas nuclease.
  • the defective CRISPR/Cas nuclease and the deaminase are fused via a linker.
  • the linker comprises a (GGGGS)n (SEQ ID NO:17), a (G)n, an (EAAAK)n (SEQ ID NO: 18), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 19) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Additional suitable linker motifs and linker configurations will be apparent to those of skill in the art.
  • suitable linker motifs and configurations include those described in Chen et al., Fusion protein linkers: property, design and functionality.
  • the fusion protein may comprise additional features.
  • Other exemplary features that may be present are localization sequences, such as nuclear localization sequences (NLS), cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins.
  • localization sequences such as nuclear localization sequences (NLS), cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins.
  • Suitable localization signal sequences and sequences of protein tags include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags, biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags.
  • BCCP biotin carboxylase carrier protein
  • MBP maltose binding protein
  • GST glutathione-S-transferase
  • GFP green fluorescent protein
  • Softags e.g., Softag
  • the guide RNA molecule of the present invention thus comprises a guide sequence for providing the targeting specificity. It includes a region that is complementary and capable of hybridization to a pre-selected target site of interest in the +55-kb region of the erythroid-specific BCL11A enhancer. According to the present disclosure, the guide RNA targets the ATF4 binding site so as to edit said site and thus disrupting the binding of ATF4 to its binding site.
  • this guide sequence can comprise from about 10 nucleotides to more than about 25 nucleotides.
  • the region of base pairing between the guide sequence and the corresponding target site sequence can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more than 25 nucleotides in length.
  • the guide sequence is about 17-20 nucleotides in length, such as 20 nucleotides.
  • a software program is used to identify candidate CRISPR target sequences on both strands of the DNA nucleic acid molecule based on desired guide sequence length and a CRISPR motif sequence (PAM) for a specified CRISPR enzyme.
  • PAM CRISPR motif sequence
  • One requirement for selecting a suitable target nucleic acid is that it has a 3′ PAM site/sequence.
  • Each target sequence and its corresponding PAM site/sequence are referred herein as a Cas-targeted site.
  • Type II CRISPR system one of the most well characterized systems, needs only Cas 9 protein and a guide RNA complementary to a target sequence to affect target cleavage.
  • target sites for Cas9 from S. pyogenes may be identified by searching for 5′-Nx-NGG- 3′ both on the input sequence and on the reverse-complement of the input. Since multiple occurrences in the genome of the DNA target site may lead to nonspecific genome editing, after identifying all potential sites, the program filters out sequences based on the number of times they appear in the relevant reference genome. For those CRISPR enzymes for which sequence specificity is determined by a “seed” sequence, such as the 11-12 bp 5′ from the PAM sequence, including the PAM sequence itself, the filtering step may be based on the seed sequence.
  • results are filtered based on the number of occurrences of the seed:PAM sequence in the relevant genome.
  • the user may be allowed to choose the length of the seed sequence.
  • the user may also be allowed to specify the number of occurrences of the seed:PAM sequence in a genome for purposes of passing the filter. The default is to screen for unique sequences. Filtration level is altered by changing both the length of the seed sequence and the number of occurrences of the sequence in the genome.
  • the program may in addition or alternatively provide the sequence of a guide sequence complementary to the reported target sequence(s) by providing the reverse complement of the identified target sequence(s). Further details of methods and algorithms to optimize sequence selection can be found in U.S. application Ser. No.
  • the gene editing platform comprising a) a cytidine base-editing enzyme and b) and at least one guide RNA molecule suitable for introducing: - one C>T mutation in the first cytidine residue of SEQ ID NO: 45 (TTGCATCATCC) and/or - one C>T mutation in the second cytidine residue of SEQ ID NO: 45 (TTGCATCATCC) and/or - one C>T mutation in the third cytidine residue of SEQ ID NO: 45 (TTGCATCATCC) and/or - one C>T mutation in the fourth cytidine SEQ ID NO: 45 (TTGCATCATCC).
  • the gene editing platform comprises a) a cytidine base-editing enzyme and b) and at least one guide RNA molecule suitable for generating the +55 CBE I editing profile of the ATF4 binding site (i.e. TTGTATTATTT (SEQ ID NO:32)).
  • the gene editing platform comprises a) a cytidine base-editing enzyme and b) and at least one guide RNA molecule suitable for generating the +55 CBE II editing profile in the ATF4 binding site (i.e. TTGCATTATTT (SEQ ID NO:33)).
  • the gene editing platform comprising a) a adenine base-editing enzyme and b) and at least one guide RNA molecule suitable for introducing: - one A>G mutation in the first adenine residue in SEQ ID NO: 45 (TTGCATCATCC) and/or - one A>G mutation in the second adenine residue of SEQ ID NO: 45 (TTGCATCATCC).
  • the gene editing platform comprises a) an adenine base-editing enzyme and b) and at least one guide RNA molecule suitable for generating the +55 ABE II profile in the ATF4 binding site (TTGCATCGTCC (SEQ ID NO:35)).
  • the gene editing platform comprises a) an adenine base-editing enzyme and b) and at least one guide RNA molecule suitable for generating the +55 ABE III profile in the ATF4 binding site (TTGCGTCGTCC (SEQ ID NO: 46)).
  • the guide RNA targets a sequence selected from Table 1 (see EXAMPLE).
  • the gene editing platform comprises a) a base-editing enzyme that is an ABE-SpRY or a CBE-SpRY and b) and at least one guide RNA molecule that targets one sequence selected in Table 1 or Table 4.
  • the gene editing platform comprises a) a base-editing enzyme and b) and at least one guide RNA molecule selected according to the combinations described in Table 4.
  • the guide RNA molecule of the present invention can be made by various methods known in the art including cell-based expression, in vitro transcription, and chemical synthesis.
  • the ability to chemically synthesize relatively long RNAs (as long as 200 mers or more) using TC- RNA chemistry allows one to produce RNAs with special features that outperform those enabled by the basic four ribonucleotides (A, C, G and U).
  • the RNA molecule of the present invention can be made with recombinant technology using a host cell system or an in vitro translation-transcription system known in the art. Details of such systems and technology can be found in e.g., WO2014144761 WO2014144592, WO2013176772, US20140273226, and US20140273233, the contents of which are incorporated herein by reference in their entireties.
  • the guide RNA molecule may include one or more modifications. Such modifications may include inclusion of at least one non-naturally occurring nucleotide, or a modified nucleotide, or analogs thereof. Modified nucleotides may be modified at the ribose, phosphate, and/or base moiety.
  • Modified nucleotides may include 2’-O-methyl analogs, 2’- deoxy analogs, or 2’-fluoro analogs.
  • the nucleic acid backbone may be modified, for example, a phosphorothioate backbone may be used.
  • LNA locked nucleic acids
  • BNA bridged nucleic acids
  • Further examples of modified bases include, but are not limited to, 2-aminopurine, 5-bromo-uridine, pseudouridine, inosine, 7-methylguanosine.
  • a plurality of guide RNA molecules are designed for targeting a plurality of sequences in the +55-kb region of the erythroid-specific BCL11A enhancer.
  • the gene editing platform disclosed herein thus comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 20 guide RNA molecules as disclosed herein.
  • a plurality of base-editing enzyme along with a plurality of guide RNA molecules are designed for targeting a plurality of sequences in the +55-kb region of the erythroid-specific BCL11A enhancer.
  • the gene editing platform disclosed herein thus comprises 2, 3 or 4 base-editing enzymes and 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 20 RNA molecules as disclosed herein.
  • the different components of the gene editing platform of the present invention are provided to the eukaryotic cell through expression from one or more expression vectors.
  • the nucleic acids encoding the guide RNA molecule or the base-editing enzyme can be cloned into one or more vectors for introducing them into the eukaryotic cell.
  • the vectors are typically prokaryotic vectors, e.g., plasmids, or shuttle vectors, or insect vectors, for storage or manipulation of the nucleic acid encoding the guide RNA molecule or the base- editing enzyme herein disclosed.
  • the nucleic acids are isolated and/or purified.
  • the present invention provides recombinant constructs or vectors having sequences encoding one or more of the guide RNA molecule or base-editing enzymes described above.
  • constructs include a vector, such as a plasmid or viral vector, into which a nucleic acid sequence of the invention has been inserted, in a forward or reverse orientation.
  • the construct further includes regulatory sequences.
  • a “regulatory sequence” includes promoters, enhancers, and other expression control elements (e.g., polyadenylation signals). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence, as well as inducible regulatory sequences.
  • the design of the expression vector can depend on such factors as the choice of the eukaryotic cell to be transformed, transfected, or infected, the desired expression level, and the like.
  • the vector can be capable of autonomous replication or integration into a host DNA.
  • the vector may also include appropriate sequences for amplifying expression.
  • the expression vector preferably contains one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells such as dihydrofolate reductase or neomycin resistance for eukaryotic cell cultures, or such as tetracycline or ampicillin resistance in E. coli.
  • any of the procedures known in the art for introducing foreign nucleotide sequences into host cells may be used. Examples include the use of calcium phosphate transfection, polybrene, protoplast fusion, electroporation, nucleofection, liposomes, microinjection, naked DNA, plasmid vectors, viral vectors, both episomal and integrative, and any of the other well-known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell.
  • the different components of the gene editing platform of the present invention are provided to the population of cells through the use of an RNA-encoded system.
  • the CBE-SpRY and the ABE-SpRY are provided by mRNA sequences encoding proteins such as SEQ ID NO:17 and SEQ ID NO:18 respectively.
  • the sequences of said mRNAs are provided as SEQ ID NO:30 and SEQ ID NO:31.
  • the base- editing system may be provided to the population of cells through the use of a chemically modified mRNA-encoded adenine or cytidine base editor together with modified guide RNA as described in Jiang, T., Henderson, J.M., Coote, K. et al. Chemical modifications of adenine base editor mRNA and guide RNA expand its application scope. Nat Commun 11, 1979 (2020).
  • engineered RNA-encoded base-editing enzymes e.g. ABE
  • engineered RNA-encoded base-editing enzymes are prepared by introducing various chemical modifications to both mRNA that encoded the base-editing enzyme and guide RNA.
  • said modifications consist in uridine depleted mRNAs modified with 5-methoxyuridine: synonymous codons may be introduced to deplete uridines as much as possible without altering the coding sequence and replaced all the remaining uridines with 5-methoxyuridine.
  • Said optimized base editing system exhibits higher editing efficiency at some genomic sites compared to DNA-encoded system. It is also possible to encapsulate the modified mRNA and guide RNA into lipid nanoparticle (LNP) for allowing lipid nanoparticle (LNP)-mediated delivery.
  • LNP lipid nanoparticle
  • the different components of the gene editing platform of the present invention are provided to the population of cells through the use of ribonucleoprotein (RNP) complexes.
  • the base-editing enzyme can be pre-complexed with one or more guide RNA molecules to form a ribonucleoprotein (RNP) complex.
  • RNP ribonucleoprotein
  • the RNP complex can thus be introduced into the eukaryotic cell. Introduction of the RNP complex can be timed.
  • the cell can be synchronized with other cells at G1, S, and/or M phases of the cell cycle.
  • RNP delivery avoids many of the pitfalls associated with mRNA, DNA, or viral delivery.
  • the RNP complex is produced simply by mixing the proteins (i.e.
  • Electroporation is a delivery technique in which an electrical field is applied to one or more cells in order to increase the permeability of the cell membrane.
  • genome editing efficiency can be improved by adding a transfection enhancer oligonucleotide.
  • a plurality of successive transfections are performed for reaching a desired level of mutagenesis in the cell.
  • a further object of the present invention relates to a method of treating a ⁇ -hemoglobinopathy in a subject in need thereof, the method comprising transplanting a therapeutically effective amount of a population of eukaryotic cells obtained by the method as above described.
  • the population of cell is autologous to the subject, meaning the population of cells is derived from the same subject.
  • the ⁇ -hemoglobinopathy is a sickle cell disease.
  • the ⁇ -hemoglobinopathy is a ⁇ -thalassemia.
  • Kits This invention further provides kits containing reagents for performing the above-described methods, including all component of the gene editing platform as disclosed herein for performing mutagenesis.
  • one or more of the reaction components e.g., guide RNA molecules, and nucleic acid molecules encoding for the base-editing enzymes for the methods disclosed herein can be supplied in the form of a kit for use.
  • the kit comprises one or more base-editing enzymes and one or more guide RNA molecules.
  • the kit can include one or more other reaction components.
  • an appropriate amount of one or more reaction components is provided in one or more containers or held on a substrate.
  • kits examples include, but are not limited to, one or more host cells, one or more reagents for introducing foreign nucleotide sequences into host cells, one or more reagents (e.g., probes or PCR primers) for detecting expression of the guide RNA or base-editing enzymes or verifying the target nucleic acid's status, and buffers or culture media for the reactions.
  • the kit may also include one or more of the following components: supports, terminating, modifying or digestion reagents, osmolytes, and an apparatus for detection.
  • the components used can be provided in a variety of forms.
  • the components e.g., enzymes, RNAs, probes and/or primers
  • the components can be suspended in an aqueous solution or as a freeze-dried or lyophilized powder, pellet, or bead.
  • the components when reconstituted, form a complete mixture of components for use in an assay.
  • the kits of the invention can be provided at any suitable temperature.
  • for storage of kits containing protein components or complexes thereof in a liquid it is preferred that they are provided and maintained below 0° C., preferably at or below ⁇ 20° C., or otherwise in a frozen state.
  • the kits can also include packaging materials for holding the container or combination of containers.
  • kits and systems include solid matrices (e.g., glass, plastic, paper, foil, micro-particles and the like) that hold the reaction components or detection probes in any of a variety of configurations (e.g., in a vial, microtiter plate well, microarray, and the like).
  • the kits may further include instructions recorded in a tangible form for use of the components.
  • FIGURES Figure 1. sgRNA design to target the +55-kb region of the erythroid-specific BCL11A enhancer. A-B.
  • RNA-mediated base editing of the erythroid-specific BCL11A enhancer in SCD HPSCs-derived erythroblasts were used for base editing experiments in SCD HSPCs.
  • a base editor mRNA and a sgRNA were co-transfected in SCD HSPCs.
  • Cells were differentiated into mature RBCs using a three-phase erythroid differentiation protocol or plated in methylcellulose- containing medium under conditions supporting erythroid (BFU-E) and granulo-monocytic (CFU-GM) differentiation.
  • BFU-E methylcellulose- containing medium under conditions supporting erythroid
  • CFU-GM granulo-monocytic
  • CBE I and II profiles were generated by CBE-SpRY and ATF4_BS_1 and ATF4_BS_2 sgRNA respectively, and ABE I and II profiles were generated by ABE-SpRY and ATF4_BS_1 and ATF4_BS_2 sgRNA respectively.
  • CBE I and II profiles were generated by CBE-SpRY, and ABE I and II profiles were generated by ABE-SpRY.
  • BFU-Es derived from SCD HSPCs that were either mock-transfected with TE buffer, or transfected with a BE mRNA only, or transfected with a BE mRNA and a sgRNA targeting the unrelated AAVS1 locus were used as negative controls (Ctrl). * p ⁇ 0.05; ** p ⁇ 0.01; *** p ⁇ 0.001; **** p ⁇ 0.0001 (One-way ANOVA).
  • HBG mRNA expression was normalized to HBA1/2 mRNA and expressed as percentage of the total HBB+HBG mRNA. Base-editing efficiency was calculated by the EditR software in samples subjected to Sanger sequencing.
  • BFU-Es derived from SCD HSPCs that were either mock-transfected with TE buffer, or transfected with a BE mRNA only, or transfected with a BE mRNA and a sgRNA targeting the unrelated AAVS1 locus were used as negative controls.
  • Figure 8 Disruption of the erythroid-specific BCL11A enhancer in SCD HSPC-derived cells with a highly processive ABE. A.
  • A-T to G-C base editing efficiency calculated by the EditR software, in SCD HSPC-derived cells (erythroid liquid cultures, BFU-E colonies, CFU-GM colonies) subjected to Sanger sequencing.
  • B. Analysis of HbF and HbS by CE-HPLC in SCD-derived BFU-E. We calculated the percentage of each Hb type over the total Hb tetramers. Data are expressed as mean ⁇ SEM (n 2 biologically independent experiments, 2 donors). **** p ⁇ 0.0001 (Two-way ANOVA).
  • CD34+ cells were thawed and cultured at a concentration of 5x105 cells/ml in the “HSPC medium” containing StemSpan (STEMCELL Technologies) supplemented with penicillin/streptomycin (Gibco), 250 nM StemRegenin1 (STEMCELL Technologies), and the following recombinant human cytokines (PeproTech): human stem cell factor (SCF) (300 ng/ml), Flt-3L (300 ng/ml), thrombopoietin (TPO) (100 ng/ml), and interleukin-3 (IL-3) (60 ng/ml).
  • SCF human stem cell factor
  • Flt-3L 300 ng/ml
  • TPO thrombopoietin
  • IL-3 interleukin-3
  • Plasmids used in this study include: pCAG-CBE4max-SpRY-P2A-EGFP (RTW5133) (Addgene #139999), pCMV-T7-SpRY-P2A-EGFP (RTW4830) (Addgene #139989).
  • pCMV_AncBE4max_P2A_GFP Additional DNA fragment (31’UTR+poly-A) containing two copies of the 3’ untranslated region (UTR) of the HBB gene and a poly-A sequence of 96 adenines was purchased by Genscript.
  • CBE-SpRY_U-delp another DNA fragment containing the uridine-depleted coding sequence of pCAG-CBE4max- SpRY-P2A-EGFP was created (CBE-SpRY_U-delp).
  • the CBE-SpRY-OPT plasmid was created by inserting the 3’UTR+poly-A fragment in the pCAG-CBE4max-SpRY-P2A-EGFP (Addgene #140003) plasmid, and by replacing the CBE4max-SpRY coding sequence with the CBE-SpRY_U-delp fragment.
  • CBE-SpRY-OPT plasmid contains a T7 promoter followed by a G nt allowing efficient capping.
  • the ABE-SpRY-OPT plasmid was created by inserting the 3’UTR+poly-A fragment in the pCMV-T7-SpRY-P2A-EGFP (RTW4830) (Addgene #139989) plasmid.
  • the AncBE4max-OPT plasmid was created by inserting point mutations in the PAM- identification domain of the Cas9 nickase of the CBE-SpRY-OPT plasmid that allow the recognition of the NGG PAM and by inserting point mutations in the deaminase domain of the CBE-SpRY-OPT plasmid that allow the ancestral reconstitution of the enzyme.
  • sgRNA design We manually designed sgRNAs targeting the +55-kb region of BCL11A (Table 1). To generate the sgRNA expression plasmid, oligonucleotides were annealed to create the sgRNA protospacer and the duplexes were ligated into the Bbs I-digested MA128 plasmid (provided by M. Amendola, Genethon, France). For RNA-mediated base editing we used chemically modified synthetic sgRNAs harboring 2′-O-methyl analogs and 3′-phosphorothioate nonhydrolyzable linkages at the first three 5′ and 3′ nucleotides (Synthego). Table 1. gRNA target sequences.
  • mRNA in vitro transcription 10 ⁇ g of base editor expressing plasmids were digested overnight with 20 Units of a restriction enzyme that cuts once right after the poly-A tail.
  • the linearized plasmids were purified using a PCR purification kit (QIAGEN #28106) and were eluted in 30 ⁇ l of DNase/RNase-free water. 1 ⁇ g of linearized plasmid was used as template for the in vitro transcription reaction (MEGAscript, Ambion #AM1334).
  • the in vitro transcription protocol was modified as follows.
  • the GTP nucleotide solution was used at a final concentration of 3.0 mM instead of 7.5 mM and the anti-reverse cap analog N7-Methyl-3'-O-Methyl-Guanosine-5'-Triphosphate-5'- Guanosine (ARCA, Trilink #N-7003) was used at a final concentration of 12.0 mM resulting in a final ratio of Cap:GTP of 4:1 that allows efficient capping of the mRNA.
  • the incubation time for the in vitro reaction was reduced to 30 minutes.
  • an additional step of polyadenylation was performed using manufacturer's guidelines (Poly-A tailing kit, Ambion).
  • RNA transfection 2x105 CD34+ HSPCs per condition were transfected with 3.0 ⁇ g of the enzyme encoding mRNA, respectively, and a synthetic sgRNA at a final concentration of 2.3 ⁇ M.
  • P3 Primary Cell 4D-Nucleofector X Kit S Lidomycin
  • CA137 program Nucleofector 4D
  • Ribonucleoprotein (RNP) transfection RNP complexes were assembled at room temperature using a 90 ⁇ M Cas9-GFP protein and a 180 ⁇ M synthetic sgRNA (ratio Cas9:sgRNA of 1:2).
  • CD34+ HSPCs (2x105 cells/condition) were transfected with RNP complexes using the P3 Primary Cell 4D-Nucleofector X Kit S (Lonza) and the CA137 program (Nucleofector 4D) in the presence of a transfection enhancer (IDT).
  • HSPC differentiation Transfected CD34+ HSPCs were differentiated into mature RBCs using a three-phase erythroid differentiation protocol, as previously described(Giarratana et al., 2005; Weber et al., 2020).
  • a basal erythroid medium supplemented with 100 ng/ml recombinant human SCF (PeproTech), 5 ng/ml recombinant human IL-3 (PeproTech), 3 IU/ml EPO Eprex (Janssen-Cilag) and 10 ⁇ 6 M hydrocortisone (Sigma).
  • Colony-forming cell (CFC) assay CD34+ HSPCs were plated at a concentration of 1x103 cells/mL in a methylcellulose-based medium (GFH4435, Stem Cell Technologies) under conditions supporting erythroid and granulo-monocytic differentiation. BFU-E and CFU-GM colonies were counted after 14 days. Colonies were randomly picked and collected as bulk populations (containing at least 25 colonies) to evaluate base editing efficiency, globin expression by RT-qPCR and RP-HPLC and hemoglobin expression by CE-HPLC. BFU-Es were randomly picked and collected as single colonies to evaluate base-editing efficiency and globin expression by RT-qPCR.
  • RT-qPCR was performed using the iTaq universal SYBR Green master mix (Biorad) and the Viia7 Real-Time PCR system (ThermoFisher Scientific), or the CFX384 Touch Real-Time PCR Detection System (Biorad). Table 3. Primers used for RT-qPCR. F, forward primer; R, reverse primer. Flow cytometry analysis HSPC-derived erythroid cells were fixed with 0.05 % cold glutaraldehyde and permeabilized with 0.1 % TRITON X-100.
  • cells were stained with an antibody recognizing GYPA erythroid surface marker (PE-Cy7-conjugated anti-GYPA antibody, 563666, BD Pharmingen) and either an antibody recognizing HbF (FITC-conjugated anti-HbF antibody, clone 2D12 552829 BD), or an antibody recognizing HbS (anti-HbS antibody, H04181601, BioMedomics) followed by the staining with a secondary antibody recognizing rabbit IgG (BV421-conjugated anti-rabbit IgG, 565014, BD).
  • an antibody recognizing GYPA erythroid surface marker PE-Cy7-conjugated anti-GYPA antibody, 563666, BD Pharmingen
  • HbF FITC-conjugated anti-HbF antibody, clone 2D12 552829 BD
  • HbS anti-HbS antibody, H04181601, BioMedomics
  • Flow cytometry analysis of CD36, CD71, GYPA, BAND3 and ⁇ 4-Integrin erythroid surface markers was performed using a V450-conjugated anti-CD36 antibody (561535, BD Horizon), a FITC- conjugated anti-CD71 antibody (555536, BD Pharmingen), a PE-Cy7-conjugated anti-GYPA antibody (563666, BD Pharmingen), a PE-conjugated anti-BAND3 antibody (9439, IBGRL) and an APC-conjugated anti-CD49d antibody (559881, BD).
  • V450-conjugated anti-CD36 antibody 561535, BD Horizon
  • a FITC- conjugated anti-CD71 antibody 555536, BD Pharmingen
  • PE-Cy7-conjugated anti-GYPA antibody 563666, BD Pharmingen
  • PE-conjugated anti-BAND3 antibody 9439, IBG
  • Flow cytometry analysis of enucleated or viable cells was performed using double-stranded DNA dyes (DRAQ5, 65-0880- 96, Invitrogen and 7AAD, 559925, BD, respectively).
  • Flow cytometry analyses were performed using Fortessa X20 (BD Biosciences) or Gallios (Beckman coulter) flow cytometers. Data were analyzed using the FlowJo (BD Biosciences) software.
  • RP-HPLC analysis of globin chains RP-HPLC analysis was performed using a NexeraX2 SIL-30AC chromatograph and the LC Solution software (Shimadzu).
  • Sickling assay HSPC-derived mature RBCs obtained at the end of the erythroid differentiation were incubated under gradual hypoxic conditions (20% O2 for 20 min; 10% O2 for 20 min; 5% O2 for 20 min; 0% O 2 for 60-80 min) and a time course analysis of sickling was performed in real time by video microscopy. Images were captured every 20 min using an AxioObserver Z1 microscope (Zeiss) and a 40x objective. Throughout the time course, images were captured and then processed with ImageJ to determine the percentage of non-sickle RBCs per field of acquisition in the total RBC population. More than 400 cells were counted per condition.
  • RNA-mediated base editing in SCD HSPCs disrupts the +55-kb region of the erythroid- specific BCL11A enhancer
  • ATF4 BS was targeted in the +55-kb region.
  • CBE-SpRY and ABE-SpRY enzymes given their PAMless nature that allowed us to design sgRNAs by placing the base editing window within different strands and positions of the ATF4 BS, thus allowing different types of conversions ( Figure 1).
  • SEQ ID NO:30 > mRNA sequence encoding for CBE-SpRY.
  • the different regions of the mRNA are indicated as follows :Kozak sequence - CBE-SpRY coding sequence - HBB 3’UTR (1 st copy) - HBB 3’UTR (2 nd copy) - Poly-a tail - Residual nucleotides (till the restriction enzyme site) GGGAGAGCCGCCACCAUGAAGCGGACCGCCGACGGCAGCGAGUUCGAGAGCCCCAAGAAGAAGCGGAAGGUGAGC AGCGAGACCGGCCCCGUGGCCGUGGACCCCACCCUGCGGCGGCGGAUCGAGCCCCACGAGUUCGAGGUGUUCUUC GACCCCCGGGAGCUGCGGAAGGAGACCUGCCUGCUGUACGAGAUCAACUGGGGCGGCCGGCACAGCAUCUGGCGG CACACCAGCCAGAACACCAACAAGCACGUGGAGGUGAACUUCAUCGAGAAGUUCACCACCACCGAGCGGUACUUCUG
  • Transfected SCD HSPCs were differentiated towards the erythroid lineage (Figure 2A).
  • CBE-SpRY coupled with ATF4_bs_1 or ATF4_bs_2 sgRNAs led to disruption of the ATF4 BS with efficiencies of 47.0% ⁇ 7.0 [mean ⁇ standard error of the mean (SEM)] and 46.7% ⁇ 3.8 and editing profiles, here after named +55 CBE I or +55 CBE II, respectively TTGTATTATTT (SEQ ID NO:32) and TTGCATTATTT (SEQ ID NO:33), respectively; Figure 2B).
  • ABE-SpRY coupled with ATF4_bs_1 or ATF4_bs_2 sgRNAs led to disruption of the ATF4 BS with efficiencies of 63.7% ⁇ 2.2 and 24.3% ⁇ 2.7 and editing profiles, here after named +55 ABE I or +55 ABE II, respectively (TTGCGTCATCC (SEQ ID NO:34) and TTGCATCGTCC (SEQ ID NO:35), respectively; Figure 2B).
  • AncBE4max plasmid for in vitro transcription and mRNA production, similarly by adding two copies of the 3’ UTR of HBB and a poly-A sequence after the 3’ UTR.
  • the optimized plasmid, AncBE4max-OPT was used for in vitro transcription and mRNA production.
  • In vitro transcribed AncBE4max-OPT or CBE- SpRY-OPT mRNAs were transfected in SCD HSPCs (1 non-mobilized donor) in combination with chemically modified ATF4_bs_1 sgRNAs ( Figure 2A). Transfected SCD HSPCs were cultures in the “HSPC medium”.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Mycology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
EP22826075.8A 2021-12-01 2022-11-30 Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer Pending EP4441089A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP21306681 2021-12-01
PCT/EP2022/083904 WO2023099591A1 (en) 2021-12-01 2022-11-30 Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer

Publications (1)

Publication Number Publication Date
EP4441089A1 true EP4441089A1 (en) 2024-10-09

Family

ID=79185911

Family Applications (1)

Application Number Title Priority Date Filing Date
EP22826075.8A Pending EP4441089A1 (en) 2021-12-01 2022-11-30 Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer

Country Status (3)

Country Link
EP (1) EP4441089A1 (https=)
JP (1) JP2024543966A (https=)
WO (1) WO2023099591A1 (https=)

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DK2476689T3 (en) 2007-05-10 2016-01-18 Agilent Technologies Inc Thiocarbonbeskyttende groups for RNA synthesis
AU2013266968B2 (en) 2012-05-25 2017-06-29 Emmanuelle CHARPENTIER Methods and compositions for RNA-directed target DNA modification and for RNA-directed modulation of transcription
US20140273230A1 (en) 2013-03-15 2014-09-18 Sigma-Aldrich Co., Llc Crispr-based genome modification and regulation
CN112301024A (zh) 2013-03-15 2021-02-02 通用医疗公司 使用RNA引导的FokI核酸酶(RFN)提高RNA引导的基因组编辑的特异性
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
IL310721B2 (en) 2015-10-23 2025-11-01 Harvard College Nucleobase editors and uses thereof
CN110214183A (zh) 2016-08-03 2019-09-06 哈佛大学的校长及成员们 腺苷核碱基编辑器及其用途
JP7693552B2 (ja) 2019-02-13 2025-06-17 ビーム セラピューティクス インク. アデノシンデアミナーゼ塩基エディターおよびそれを用いて標的配列中の核酸塩基を改変する方法
AU2020344547A1 (en) 2019-09-09 2022-03-24 Beam Therapeutics Inc. Novel nucleobase editors and methods of using same
EP4017980A4 (en) * 2019-09-30 2024-08-07 The Children's Medical Center Corporation BCL11A GUIDE AND BASIC EDITOR DISTRIBUTION

Also Published As

Publication number Publication date
JP2024543966A (ja) 2024-11-26
WO2023099591A1 (en) 2023-06-08

Similar Documents

Publication Publication Date Title
Antoniou et al. Base-editing-mediated dissection of a γ-globin cis-regulatory element for the therapeutic reactivation of fetal hemoglobin expression
US20240002843A1 (en) Compositions and methods for the treatment of hemoglobinopathies
US20230279438A1 (en) Base editing approaches for the treatment of betahemoglobinopathies
US20220033856A1 (en) Methods for increasing fetal hemoglobin content in eukaryotic cells and uses thereof for the treatment of hemoglobinopathies
AU2016278982A1 (en) CRISPR/Cas9 complex for genomic editing
US12497614B2 (en) Compositions and methods for editing beta-globin for treatment of hemaglobinopathies
JP2021521838A (ja) ブルトン型チロシンキナーゼに対するtalenベースのおよびcrispr/casベースのゲノム編集
EP4662313A1 (en) Enrichment of genetically modified hematopoietic stem cells through multiplex base editing
WO2023052366A1 (en) Base editing approaches for the treatment of beta-hemoglobinopathies
EP4441089A1 (en) Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer
US20250241956A1 (en) Base editing approaches for correcting the cd39 (cag>tag) mutation in patients suffering from beta-thalassemia
US20250161492A1 (en) Base editing approaches for the treatment of beta-thalassemia
CN120112634A (zh) B2m安全港位点的敲入策略
WO2024018056A1 (en) Base editing approaches for correcting the ivs2-1 (g>a) mutation in patients suffering from βeta-thalassemia
CN118786212A (zh) Sarm1表达降低用于细胞疗法
WO2026077659A1 (en) Enrichment of genetically modified hematopoietic stem cells through epigenome editing
WO2025017033A1 (en) Prime editing of the -115 region in the hbg1 and/or hbg2 promoter for increasing fetal hemoglobin content in a eukaryotic cell
WO2025017030A1 (en) Prime editing of the -200 region in the hbg1 and/or hbg2 promoter for increasing fetal hemoglobin content in a eukaryotic cell
WO2022243529A1 (en) GENE THERAPY FOR THE TREATMENT OF HYPER-IgE SYNDROME (HIES) BY TARGETED GENE INTEGRATION
WO2025181336A1 (en) Compositions and methods for hbb-editing in hspc
EA051805B1 (ru) Композиции и способы лечения гемоглобинопатий

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20240531

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)