EP4408410A1 - Inhibiteurs de l'interaction entre les protéines kinases rock et pdk1 - Google Patents

Inhibiteurs de l'interaction entre les protéines kinases rock et pdk1

Info

Publication number
EP4408410A1
EP4408410A1 EP22805778.2A EP22805778A EP4408410A1 EP 4408410 A1 EP4408410 A1 EP 4408410A1 EP 22805778 A EP22805778 A EP 22805778A EP 4408410 A1 EP4408410 A1 EP 4408410A1
Authority
EP
European Patent Office
Prior art keywords
formula
pharmaceutically acceptable
compound
advantageously
group
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP22805778.2A
Other languages
German (de)
English (en)
Inventor
Benoit Schneider
Jean-Philippe Herbeuval
Nassima BEKADDOUR BENATIA
Anne Baudry
Mathéa PIETRI
Nicolas PIETRANCOSTA
Laurent LE CORRE
Rodolphe Alves De Sousa
Patricia Busca
Christine Gravier-Pelletier
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Institut National de la Sante et de la Recherche Medicale INSERM
Sorbonne Universite
Universite Paris Cite
Original Assignee
Centre National de la Recherche Scientifique CNRS
Institut National de la Sante et de la Recherche Medicale INSERM
Sorbonne Universite
Universite Paris Cite
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National de la Recherche Scientifique CNRS, Institut National de la Sante et de la Recherche Medicale INSERM, Sorbonne Universite, Universite Paris Cite filed Critical Centre National de la Recherche Scientifique CNRS
Publication of EP4408410A1 publication Critical patent/EP4408410A1/fr
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/275Nitriles; Isonitriles
    • A61K31/277Nitriles; Isonitriles having a ring, e.g. verapamil
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4151,2-Diazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/4353Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
    • A61K31/437Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a five-membered ring having nitrogen as a ring hetero atom, e.g. indolizine, beta-carboline
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07CACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C2601/00Systems containing only non-condensed rings
    • C07C2601/12Systems containing only non-condensed rings with a six-membered ring
    • C07C2601/16Systems containing only non-condensed rings with a six-membered ring the ring being unsaturated

Definitions

  • TITLE Inhibitors of the interaction between ROCK and PDK1 protein kinases
  • the present invention relates to inhibitors of the interaction between ROCK and PDK1 protein kinases and their uses as anti-inflammatory and anti-interferon agents.
  • the present invention also relates to a pharmaceutical composition comprising an inhibitor of the interaction between ROCK and PDK1 protein kinases and its use in the prevention and/or treatment of inflammatory diseases, viral and/or bacterial infections and autoimmune diseases. .
  • Inflammation is a beneficial physiological process for the body insofar as it is transient. For example, it helps fight bacterial or viral infections. Nevertheless, many pathologies affecting several organs such as the intestine, the central nervous system, the osteo-articular system, the skin, the lungs, etc. are associated with chronic tissue inflammation. Chronic inflammation alters tissue homeostasis, leading to functional abnormalities such as digestive disorders, amplification of neurological or neurodegenerative diseases, motor disability, skin lesions, respiratory failure... Chronic inflammation damage results from the continuous production of inflammatory cytokines (TNFa, interleukins, interferons) by immune cells or related cells (microglia cells in the central nervous system) which leads to the deterioration of cells sensitive to inflammatory factors. Very few drugs (steroidal and non-steroidal) currently make it possible to contain the inflammatory response (aspirin, ibuprofen, paracetamol, corticosteroids), some of which generate significant side effects in humans.
  • TNFa inflammatory cytokines
  • the subject of the present invention is a compound of formula (I): or a pharmaceutically acceptable salt thereof, for its use in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the ROCK protein kinase and the PDK1 protein kinase, in which :
  • - m is chosen from 0, 1 and 2
  • - n is chosen from 0, 1 and 2
  • - Ri represents a group -COR2, where R2 is selected from the group consisting of a group -OH, a group -NH2, an alkoxy group, an alkylamine group, an arylalkylamine group, a group -NH-NH2, and a group - CH2-Ar substituted or unsubstituted by at least one halogen atom, where Ar represents an aryl group,
  • R3 represents a nitrogen atom, a group -NHCOR7, a group -NHCOORs, or a group -COSRg, where R7, Rs and Rg are C1 to C6 alkyl groups substituted or unsubstituted by at least one atom of halogen,
  • - R4 represents a nitrogen atom or an -NH2 group
  • - R5 and Re which are identical or different, are chosen independently of one another from the group consisting of hydrogen, an -OH group, an -NH group, an -NH2 group, an alkoxy group, a thiol group, a sulfonamide group, an alkylamine group and an aryl group substituted or unsubstituted by at least one halogen, and in which: z
  • the compounds of formula (I) are capable of binding to the zone of interaction between the ROCK and PDK1 protein kinases, in particular on a specific protein domain of the ROCK protein kinase , advantageously on a specific protein domain of the ROCK1 protein kinase.
  • the compounds of formula (I) according to the present invention are capable of preventing and/or inhibiting and/or blocking the production and/or secretion by immune cells of inflammatory cytokines, such as tumor necrosis factor alpha (TNFa), interleukins IL-ip, IL-6, IL-10, IL-12p70, IL-18, IL-23, IL-33 but also the different subtypes of interferons (IFN), such as interferon alpha-2 (IFNa2), interferon gamma (IFNy) and the MCP1 protein, without producing side effects.
  • inflammatory cytokines such as tumor necrosis factor alpha (TNFa), interleukins IL-ip, IL-6, IL-10, IL-12p70, IL-18, IL-23, IL-33
  • IFN interferon alpha-2
  • IFNy interferon gamma
  • the specific interaction zone between the ROCK and PDK1 protein kinases targeted by the compounds of formula (I) according to the present invention relates to the following amino acids of the ROCK1 protein kinase: proline 21 to glutamate 24 (P21-E24), tryptophan 122 with valine 136 (W122-V136), alanine 188 with phenylalanine 194 (A188-F194), lysine 222 (K222) and arginine 404 with tyrosine 405 (R404-Y405), the positions of the amino acids being established with regard to the sequences of amino acids of ROCK1 protein kinase (SEQ ID No.11).
  • lysine 222 (K222), phenylalanine 130 (F130), asparagine 132 (N 132), serine 133 (S133), methionine 192 (M192) and arginine 404 (R404) are essential for interaction with compounds of formula (I) according to the present invention on the biological level, the positions of the amino acids being established with regard to the sequence of amino acids of the protein kinase ROCK1 (SEQ ID No.11).
  • the compounds of formula (I) of the invention act as agents dissociating the ROCK/PDK1 protein complex or preventing its formation in immune cells, by inserting themselves between the ROCK and PDK1 protein kinases at the level of the contact surface between the two protein kinases, thus blocking the interaction between the two protein kinases ROCK and PDK1.
  • the compounds of formula (I) have a broad spectrum immunosuppressive action in immune cells, acting both as an anti-inflammatory agent and as an anti-interferon agent, as shown in the examples of the present application.
  • the present invention also relates to a compound of formula (I) for its use in the prevention and/or treatment of a pathology requiring the use of an inhibitor the interaction between the ROCK protein kinase and the PDK1 protein kinase, said pathology being chosen from: inflammatory diseases, viral infections, bacterial infections and autoimmune diseases.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and / or a pharmaceutically acceptable vehicle.
  • the pharmaceutical composition also comprises at least one second active ingredient.
  • the pharmaceutical composition is suitable for simultaneous administration or sequential administration.
  • the pharmaceutical composition is in a form suitable for its oral, parenteral or topical administration.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and / or a pharmaceutically acceptable vehicle for its use in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the ROCK enzyme and/or of the PDK1 enzyme.
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and / or a pharmaceutically acceptable vehicle for its use in the prevention and / or treatment of a pathology requiring the use of an inhibitor of the interaction between the protein kinase ROCK and the protein kinase PDK1, said pathology being chosen from: inflammatory diseases, viral infections, bacterial infections and autoimmune diseases.
  • the term “inhibitor” is understood to mean a compound capable of inhibiting or of blocking or of neutralizing the expression of the targeted metabolic activity; the metabolic activity being lower, or even zero, in the presence of the inhibitor.
  • the inhibitor of the interaction between the ROCK and PDK1 protein kinases is capable of blocking the interaction between the two proteins, either by entering into competition with one of the protein kinases, or by blocking one of the protein kinases , thus causing a decrease in the expression of the activity of the protein kinases ROCK and PDK1.
  • the inhibitor of the interaction between ROCK and PDK1 protein kinases is neutralizing.
  • the inhibitor inhibits or neutralizes the biological function of one of the ROCK or PDK1 protein kinases, which has the consequence of protecting cells from inflammatory stress.
  • the neutralization capacity of the inhibitor can be tested by a standard test, in particular by measuring the capacity of the inhibitor to block the interaction between the protein kinases ROCK and PDK1 and to reduce the enzymatic activity of the kinases ROCK and PDK1 (IC50 ).
  • the inhibitor has an IC50 of between 11 nM and 30 nM.
  • the inhibitor of the interaction between the ROCK protein kinases and PDK1 is an agent dissociating the ROCK-PDK1 protein kinase complex or preventing the formation of the ROCK-PDK1 protein kinase complex.
  • agent dissociating the ROCK/PDK1 protein kinase complex or preventing its formation means an intercalating agent capable of dissociating the ROCK-PDK1 protein kinase complex or an intercalating agent capable of preventing the formation of the ROCK/PDK1 protein kinase complex, binding in the zone of interaction between the ROCK and PDK1 protein kinases, said interaction zone being different from the active sites of the ROCK and PDK1 protein kinases.
  • the dissociating agent By binding to the zone of interaction between the ROCK and PDK1 protein kinases, the dissociating agent causes a steric clash in the immune cell, separating the ROCK protein kinase from the PDK1 protein kinase or preventing the interaction of the ROCK protein kinase with PDK1 protein kinase.
  • the compounds of formula (I) according to the invention are inhibitors of the interaction between the protein kinases ROCK and PDK1, in particular the compounds of formula (I) according to the invention are agents dissociating the complex of protein kinases ROCK/PDK1.
  • the inventors have shown that the selective inhibition of the interaction between the protein kinases ROCK and PDK1 with one of the compounds of formula (I) according to the invention, makes it possible to block the secretion of inflammatory cytokines, such as tumor necrosis factor alpha (TNFa), the interleukins IL-1 p, IL-6, IL-10, IL-12p70, IL-18, IL-23, IL-33 but also the different subtypes of interferons (IFN ), such as interferon alpha-2 (IFNa2), interferon gamma (IFNy) and the MCP1 protein by immune cells, showing a beneficial effect of the compounds of formula (I) according to the invention with respect to against inflammatory stress without impacting the viability of said immune cells.
  • TNFa tumor necrosis factor alpha
  • IFNa2 interferon alpha-2
  • IFNy interferon gamma
  • the compounds of formula (I) according to the invention inhibit the secretion of inflammatory cytokines and interferons by an immune cell activated in vitro and ex-vivo, in particular when the compounds of formula (I) according to the invention come into contact with immune cells.
  • immune cell or “cell of the immune system” or “immune cell” means any cell of the immune system which originates from a hematopoietic stem cell in the bone marrow.
  • the immunity cells according to the invention are peripheral blood mononuclear cells (PBMC).
  • PBMC peripheral blood mononuclear cells
  • the term “peripheral blood mononuclear cells (PBMC)” refers to peripheral blood cells having a round nucleus. These mononuclear blood cells recirculate between tissues and blood and are an essential part of the immune system to fight infections and adapt to intruders.
  • lymphocyte cells There are two main types of mononuclear cells: lymphocyte cells and myeloid cells.
  • the lymphocyte population of PBMCs generally consists of T cells, B cells, and NK cells.
  • the myeloid population of PBMCs consists of dendritic cells (myeloid and plasmacytoid) and monocytes/macrophages.
  • PBMCs can be isolated from whole blood samples by methods well known in the art (eg, Ficoll gradient).
  • the immunity cell is a T lymphocyte.
  • the immunity cell is a B lymphocyte.
  • T lymphocyte and “T cell” are used interchangeably and refer to a major type of white blood cell, which completes its maturation in the thymus and plays various roles in the immune system. , including the identification of specific foreign antigens in the body and the activation and/or deactivation of other immune cells.
  • the T lymphocyte can be any T cell chosen from: a cultured T cell, for example, a primary T cell, or a T cell of a cultured T cell line, for example Jurkat, SupTI, etc., or a T cell obtained from a mammal.
  • T cells can be CD3+ cells.
  • the T cell can be any type of T cell and can be at any stage of development, including but not limited to CD4+/CD8+ double-positive T cells, helper T cells CD4+ (eg, Th1 and Th2 cells), CD8+ T cells (eg, cytotoxic T cells), a T cell present among peripheral blood mononuclear cells (PBMC), peripheral blood leukocytes (PBL) , a T cell that is part of the tumour-infiltrating lymphocytes (TIL), memory T cells, naive T cells, regulatory T cells, gamma delta T cells (Tyo cells). Additional types of T helper cells include cells such as Th3, Thl7, Th9 or Tfh cells.
  • helper T cells CD4+ (eg, Th1 and Th2 cells), CD8+ T cells (eg, cytotoxic T cells), a T cell present among peripheral blood mononuclear cells (PBMC), peripheral blood leukocytes (PBL) , a T cell that is part of the tumour-infiltra
  • T cell can also refer to a genetically modified T cell, such as a modified T cell to express a T cell receptor (TCR) or a chimeric antigen receptor (CAR).
  • T cell can also be differentiated from a stem cell or a progenitor cell.
  • B cell or "B lymphocyte cell” or “B lymphocyte” means a lymphocyte cell which is produced in the bone marrow, produces immunoglobulins and is involved in the production of antibodies during the humoral immune response.
  • the B lymphocyte can be any B cell, selected from a B stem cell, a pro-B cell, a pre-B cell, a naive B cell, an activated B cell, a memory GC B cell, a plasmablastic cell late and a plasma cell.
  • the term "contacting”, when used in reference to an action performed on an immune cell, is used interchangeably to designate the culture, incubation or exposure of an immune cell with one or more of the inhibitors of the interaction between the ROCK and PDK1 protein kinases according to the invention.
  • Cells contacted with a stimulating agent, such as R848, CpG-A, or contacted with another vehicle are examples of cells contacted
  • an "uncontacted” or “untreated” cell is a cell which has not been treated, for example, cultured, brought into contact or incubated with one or more of the inhibitors of interaction between the ROCK and PDK1 protein kinases according to the invention.
  • the term "synthesis of inflammatory cytokines” or “production of inflammatory cytokines” or “secretion of inflammatory cytokines” means the release into the external environment of inflammatory cytokines by a cell, advantageously a cell of the immunity.
  • interferon synthesis or “interferon production” or “interferon secretion” is understood to mean the release into the external environment of interferon by a cell, advantageously a cell of the immunity.
  • the “ROCK protein kinase” is a serine/threonine kinase, also called RhoA-associated coiled-coil containing kinase or RhoA-Rho-associated kinase.
  • the ROCK protein kinase can be isoform 1, called ROCK1 or isoform 2, called ROCK2.
  • the ROCK protein kinase is the ROCK1 protein kinase.
  • zone of interaction between the ROCK and PDK1 protein kinases means a binding zone, different from the catalytic site (also called active site) of each of the ROCK and PDK1 protein kinases, which allows to combine the ROCK and PDK1 kinases in the same protein complex.
  • Four interaction sites between the protein kinases ROCK1 and PDK1 have been defined by modeling.
  • the interaction between ROCK1 and PDK1 is based on weak bonds such as hydrogen, electrostatics, etc.
  • it may be an allosteric site of the ROCK1 protein kinase and/or of the PDK1 protein kinase.
  • the site of interaction between the ROCK and PDK1 protein kinases targeted by the compounds of formula (I) according to the present invention relates to the following amino acids of the ROCK1 protein kinase: residues proline 21 to glutamate 24 (P21-E24), tryptophan 122 with valine 136 (W122-V136), alanine 188 with phenylalanine 194 (A188-F194), lysine 222 (K222) and arginine 404 with tyrosine 405 (R404-Y405), the positions of the amino acids being established with regard to the sequences of amino acids of ROCK1 protein kinase (SEQ ID No.11).
  • the compounds of formula (I) according to the present invention interact with the following amino acids: proline 21 to glutamate 24 (P21-E24), tryptophan 122 to valine 136 (W122-V136), alanine 188 to phenylalanine 194 (A188-F194), lysine 222 (K222) and arginine 404 to tyrosine 405 (R404-Y405) of the ROCK1 protein kinase, the amino acid positions being established with regard to the amino acid sequences of the ROCK1 protein kinase (SEQ ID No.11).
  • - m is chosen from 0, 1 and 2
  • - n is chosen from 0, 1 and 2
  • - Ri represents a group -COR2, where R2 is selected from the group consisting of a group - OH, an -NH2 group, an alkoxy group, an alkylamine group, an arylalkylamine group, an -NH-NH2 group, and a -CH2-Ar group substituted or unsubstituted by at least one halogen atom, where Ar represents a aryl group,
  • R3 represents a nitrogen atom, a group -NHCOR7, a group -NHCOORs, or a group -COSRg, where R7, Rs and Rg are C1 to C6 alkyl groups substituted or unsubstituted by at least one atom of halogen,
  • - R4 represents a nitrogen atom or an -NH2 group
  • - R5 and Re are chosen independently of one another from the group consisting of a hydrogen atom, an -OH group, an -NH2 group, an alkoxy group, a thiol group, a group sulfonamide, and an alkylamine group and an aryl group substituted or unsubstituted by at least one halogen atom, and zz in which the identical or different lines and zz represent independently of each other a single covalent bond or a triple covalent bond, or a pharmaceutically acceptable salt thereof.
  • pharmaceutically acceptable means that which is useful in the preparation of a generally safe, non-toxic, and neither biologically nor otherwise undesirable pharmaceutical composition and includes that which is acceptable for veterinary and human pharmaceutical use.
  • the compounds of formula (I) according to the invention can be used in the form of a pharmaceutically acceptable salt and can comprise salts, hydrates and solvates prepared according to conventional methods, well known to those skilled in the art.
  • salts derived from carboxylic acids such as carboxylates (COO-), but also sulfonates (-SO), phosphonates (POs 2- ), quaternary ammoniums (NR4 + ) or sulfonamines (SO2-NHs + ).
  • suitable salts include pharmaceutically or physiologically acceptable acid addition salts.
  • suitable salts include acid addition salts formed with various pharmaceutically or physiologically acceptable free acids.
  • acids may include, but are not limited to, hydrochloric acid, bromic acid, sulfuric acid, phosphoric acid, citric acid, acetic acid, lactic acid, tartaric acid, fumaric acid, formic acid, propionic acid, oxalic acid, trifluoroacetic acid, methanesulfonic acid, benzenesulfonic acid, maleic acid, benzoic acid, gluconic acid, glycolic acid, succinic acid, 4-morpholineethanesulfonic acid, camphorsulfonic acid, nitrobenzenesulfonic acid, hydroxy-O-sulfonic acid, 4- toluenesulfonic acid, ruktu knife acid, EMBO acid, glutamic acid, aspartic acid, etc.
  • hydrochloric acid bromic acid, sulfuric acid, phosphoric acid, citric acid, acetic acid, lactic acid, tartaric acid, fumaric acid, formic acid, propionic acid, ox
  • metal salts can be prepared using bases.
  • alkali metal or alkaline earth metal salts can be obtained by dissolving the compound in an excess of an alkali metal hydroxide or alkaline earth metal hydroxide solution, filtering the compound salts undissolved and evaporating and drying the filtrate.
  • sodium, potassium, lithium, cesium, magnesium or calcium salts are pharmaceutically suitable metal salts, but not limited to these.
  • silver salts corresponding to metal salts can be obtained by reacting alkali metals or alkaline earth metals with appropriate silver salts (eg nitrates). Mention may also be made of ammoniums (NH4+) or amines in ammonium form such as diethylamine (EDTA), pyrrolidine, piperidine and pyridine.
  • a halogen atom means a fluorine, chlorine, bromine or iodine atom.
  • the halogen atoms can more particularly be fluorine atoms.
  • Ct -C z means a carbon chain optionally containing from t to z carbon atoms in which t and z can take values from 1 to 10; for example, Ci-Ce is a carbon chain possibly containing from 1 to 6 carbon atoms.
  • alkyl means a linear or branched saturated aliphatic group, comprising in particular from 1 to 6 carbon atoms.
  • alkyl may or may not be substituted by at least one halogen atom, advantageously at least two halogen atoms, advantageously at least three halogen atoms, advantageously at least four halogen atoms.
  • the alkyl can be substituted by at least one fluorine atom, advantageously at least two fluorine atoms, advantageously at least three fluorine atoms, advantageously at least four fluorine atoms.
  • alkoxy means a linear or branched hydrocarbon chain comprising the specified number of carbon atoms, advantageously between 1 and 6 carbon atoms, and an oxygen atom.
  • alkylamine means a linear or branched hydrocarbon chain comprising the specified number of carbon atoms, advantageously between 1 and 6 carbon atoms, and a primary amine.
  • arylalkylamine means an alkylamine group substituted by one or more aryl groups, in which the aryl group and the alkylamine group may or may not be carried by the same carbon atom.
  • aryl group include phenylmethylamine, phenylethylamine, phenylpropylamine, (p-tolyl)methylamine, and the like.
  • aryl is understood to mean a monocyclic or bicyclic aromatic group containing between 5 and 10 carbon atoms, in particular between 6 and 10 carbon atoms.
  • an aryl group mention may be made of the phenyl, tolyl, xylyl, mesityl or naphthyl group.
  • the aryl group is phenyl.
  • the aryl may or may not be substituted by at least one halogen atom, advantageously at least two halogen atoms, advantageously at least three halogen atoms, advantageously at least four halogen atoms.
  • the aryl can be substituted by at least one fluorine atom, advantageously at least two fluorine atoms, advantageously at least three fluorine atoms, advantageously at least four fluorine atoms.
  • the aryl groups can comprise one or more heteroatoms, chosen from N, O and/or S, advantageously 1 to 4 heteroatoms.
  • an aryl group comprising one or more heteroatoms mention may in particular be made of pyridine, furan, thiophene, pyrrole, pyrrazole, imidazole, thiazole, isoxazole, isothiazole, pyridazine , pyrimidine, pyrazine, triazines, indolizine, indole, isoindole, benzofuran, benzothiophene, indazole, benzimidazole, benzothiazole, purine, quinoline, isoquinoline, cinnoline , phthalazine, quinazoline, quinoxaline, pteridine, naphthyridines, carbazole, phenothiazine, phenoxazine, acridine, phenazine, oxazole, pyrazole, oxadiazole, triazole, thiadiazole and their unsatur
  • R1 represents a group -COR2, where R2is selected from the group consisting of a -OH group, a -NH2 group, an alkoxy group, an alkylamine group, an arylalkylamine group, a -NH-NH2 group, and a substituted or unsubstituted -CH2-Ar group by at least one halogen atom, where Ar represents an aryl group.
  • the aryl group is a phenyl group.
  • R1 is chosen from: in which W is the same or different halogen atom, advantageously chosen from a fluorine, chlorine, bromine or iodine atom, advantageously a fluorine atom, or a C1 to C6 alkyl, in which p is 0 , 1 , 2, 3, 4 or 5, and wherein q is 0, 1, 2, 3, 4, 5, 6 or 7.
  • W is the same or different halogen atom, advantageously chosen from a fluorine, chlorine, bromine or iodine atom, advantageously a fluorine atom, or a C1 to C6 alkyl, in which p is 0 , 1 , 2, 3, 4 or 5, and wherein q is 0, 1, 2, 3, 4, 5, 6 or 7.
  • R1 is: , where p is 0.
  • R1 is:
  • R1 is:
  • R3 represents a nitrogen atom, a group -NHCOR7, a group -NHCOORs, or a group -COSRg, where R7, Rs and Rg are C1 to C6 alkyl groups substituted or unsubstituted by at minus one halogen atom.
  • R3 represents a nitrogen atom.
  • R3 represents a group -NHCOR7, where R7 is a C1 to C6 alkyl group substituted or unsubstituted by at least one halogen atom.
  • R3 represents a nitrogen atom, zz when the bond zz represents a triple covalent bond.
  • R3 when the zz bond represents a single covalent bond, R3 can be chosen from a nitrogen atom, a -NHCOR7 group, a -NHCOORs group, or a -COSRg group, where R7 , Rs and Rg are C1-C6 alkyl groups substituted or unsubstituted by at least one halogen atom.
  • the -NHCOR7 group is chosen from: in which Z is a halogen atom, selected from a fluorine, chlorine, bromine or iodine atom, advantageously a fluorine atom, or a C1 to C6 alkyl group.
  • R4 represents a nitrogen atom or a -NH2 group.
  • R4 represents a nitrogen atom, when the bond represents a triple covalent bond.
  • R4 represents an -NH2 group, when the bond represents a single covalent bond.
  • R5 is selected from the group consisting of a hydrogen atom, an -OH group, an -NH2 group, an alkoxy group, a thiol group, a sulfonamide group, an alkylamine group, and a substituted aryl group. or unsubstituted by at least one halogen atom.
  • R5 is an aryl group substituted or unsubstituted by at least one halogen atom, advantageously a phenyl group substituted or unsubstituted by at least one halogen atom, advantageously an unsubstituted phenyl group.
  • Re is selected from the group consisting of a hydrogen atom, an -OH group, an -NH2 group, an alkoxy group, a thiol group, a sulfonamide group, an alkylamine group, and a substituted aryl group. or unsubstituted by at least one halogen atom.
  • Advantageously Re is an alkoxy group, even more advantageously Re is a methoxy group.
  • the Re group can be in position 3, 4 or 5 on the ring.
  • the compounds of formula (I) according to the invention or a pharmaceutically acceptable salt thereof comprise ZZ compounds, in which m is 0 and n is 0 and in which the bonds and zz represent a triple covalent bond.
  • the compounds of formula (I) according to the invention or a pharmaceutically acceptable salt thereof comprise zz ⁇ compounds in which m is 1 and n is 1 and in which the bonds and zz represent a single covalent bond.
  • the compounds of general formula (I) in which m is 1 and n is 1 and zz ⁇ in which the bonds and zz represent a single covalent bond are represented by the subgroup of compounds of formula (III) or a pharmaceutically acceptable salt thereof, wherein R3, R4, Rs and Re are as defined in formula (I).
  • the compounds of general formula (I) in which m is 0 and n is 1 and in which the bonds and zz represent a single covalent bond are represented by the subgroup of compounds of formula (IV) or a pharmaceutically acceptable salt thereof,
  • the compounds of general formula (I) are chosen from:
  • the inventors have shown that the incubation of human peripheral blood mononuclear cells with a compound of formula (I) and in particular with the compound of formula (V), before being stimulated with an agonist (R848) of the receptors Toll-Like (TLR) 7/8 to mimic single-stranded RNA virus infection, inhibits production of pro-inflammatory cytokines, such as IL-1p, IL-6, IL-10, IL-12p70, IL -18, IL-23, IL-33, TNF ⁇ and the NF- ⁇ B protein, but also the various interferon (IFN) subtypes, such as interferon alpha-2 (IFNa2), interferon gamma (IFNy), as well as the MCP1 protein, induced by TLR7/8 stimulation.
  • IFN interferon alpha-2
  • IFNy interferon gamma
  • the inventors have also shown that the incubation of human peripheral blood mononuclear cells with a compound of formula (I) and in particular with the compound of formula (VI), before being stimulated with an agonist (R848) of Toll-Like receptors (TLR) 7/8 to mimic single-stranded RNA virus infection, inhibits the production of pro-inflammatory cytokines, such as IL-1 p, IL-6, IL-10, IL- 12p70, IL-18, IL-23, IL-33, TNF ⁇ and the NF- ⁇ B protein, but also the different subtypes of interferons (IFN), such as interferon alpha-2 (IFNa2), from interferon gamma (IFNy), as well as the MCP1 protein, induced by TLR7/8 stimulation.
  • IFN interferon alpha-2
  • IFNy interferon gamma
  • the inventors have also shown that the incubation of human peripheral blood mononuclear cells with a compound of formula (I) and in particular with the compounds of formula (VII), of formula (VIII) and of formula (IX), before being stimulated with a Toll-Like receptor (TLR) 7/8 agonist (R848) to mimic single-stranded RNA virus infection, inhibits interferon (IFN) production, induced by TLR7/ 8.
  • TLR Toll-Like receptor
  • the inventors have also shown that the incubation of human peripheral blood mononuclear cells with a compound of formula (I) and in particular with the compound of formula (V) or the compound of formula (VI), before being stimulated with a Toll-Like Receptor (TLR) 4 agonist (LPS) to mimic a bacterial infection, inhibits the production of TNFa induced by TLR4 stimulation, but also the secretion of pro-inflammatory cytokines on peripheral blood mononuclear cells human, such as IL-6, IL-1 p, IL18, IL23, MCP1 and interferons, in particular interferon gamma (IFNy) induced by stimulation of TLR4 by lipopolysaccharide (LPS), LPS being an agent bacterial inducer of an inflammatory response.
  • TLR Toll-Like Receptor
  • LPS lipopolysaccharide
  • the inventors have also shown that the compounds of formula (V) to (VIII) are capable of blocking the activation of B lymphocytes from healthy donors in response to stimulation by Toll-like TLR 9 receptors.
  • TNF ⁇ monocytes isolated from peripheral blood mononuclear cells (PBMC) of healthy donors, to be stimulated with an agonist (R848) of the Toll-Like receptors (TLR) 7 /8 to mimic an infection with a single-stranded RNA virus;
  • PBMC peripheral blood mononuclear cells
  • R848 an agonist of the Toll-Like receptors (TLR) 7 /8 to mimic an infection with a single-stranded RNA virus
  • TNF ⁇ monocytes isolated from peripheral blood mononuclear cells (PBMC) of healthy donors, to be stimulated with an agonist (LPS) of the Toll-Like receptors (TLR) 4 to mimic a gram-negative bacterial infection;
  • PBMC peripheral blood mononuclear cells
  • LPS peripheral blood mononuclear cells
  • TLR Toll-Like receptors
  • TNFa monocytes isolated from peripheral blood mononuclear cells (PBMC) of healthy donors, to be stimulated with an agonist (LTA: lipoteichoic acid) of the Toll-Like receptors ( TLR) 2 to mimic gram-positive bacterial infection;
  • PBMC peripheral blood mononuclear cells
  • LTA lipoteichoic acid
  • TLR Toll-Like receptors
  • TNF ⁇ plasmacytoid dendritic cells isolated from peripheral blood mononuclear cells (PBMC) of healthy donors, to be stimulated with an activator (R848) of Toll-Like receptors (TLR ) 7/8 to mimic single-stranded RNA virus infection;
  • PBMC peripheral blood mononuclear cells
  • TNF ⁇ plasmacytoid dendritic cells isolated from peripheral blood mononuclear cells (PBMC) of healthy donors, to be stimulated with a Toll-Like receptor agonist (CpG-A) (TLR) 9 capable of recognizing viral or bacterial DNA rich in the CpG motif.
  • PBMC peripheral blood mononuclear cells
  • TLR Toll-Like receptor agonist
  • a compound of formula (I) has a preventive effect on the inhibition of the production of inflammatory cytokines induced by the stimulation of TLR2 or TLR4 or TLR7 / 8 or TRL9 regardless of the immunity cell.
  • the preferred compound of formula (I) is one of the compounds mentioned in Table 1 below.
  • the compound of formula (I) is chosen from: 2-[(3-methoxyphenyl)hydrazinylidene]propanedinitrile; 2-[(4-methoxyphenyl)hydrazinylidene]propanedinitrile; 7-Amino-N-benzyl-2-(3-methoxyphenyl)-5-phenyl-2H-pyrazolo[4,3-b]pyridine-3-carboxamide; 7-amino-2-(3-methoxyphenyl)-5-phenyl-2H-pyrazolo[4,3-b]pyridine-3-carbohydrazide and methyl 3-cyano-1-(3-methoxyphenyl)-4-(2, 2,2-trifluoroacetamido)-1H-pyrazole-5-carboxylate
  • Another aspect of the present invention relates to a compound of formula (I) for its use as a medicament, in particular a medicament intended to block and/or inhibit the interaction between the protein kinases ROCK and PDK1.
  • the compound of formula (I) is capable of intercalating at the level of the zone of interaction between the two protein kinases ROCK and PDK1, thus causing either dissociation of the complex of protein kinases ROCK/PDK1, or preventing the formation of the protein kinase complex ROCK and PDK1.
  • the compounds of formula (I) according to the invention are agents dissociating the complex of protein kinases ROCK and PDK1.
  • the compounds of formula (I) according to the invention are agents preventing the formation of the complex of protein kinases ROCK and PDK1.
  • the compounds of formula (I) according to the invention are anti-inflammatory and anti-interferon agents.
  • anti-inflammatory and anti-interferon agent means an agent capable of preventing and/or blocking and/or inhibiting the synthesis of inflammatory cytokines and interferons and in particular a agent capable of preventing and/or blocking and/or inhibiting the secretion of at least one inflammatory cytokine, such as tumor necrosis factor alpha (TNFa), interleukins I L-1 p, IL-6, IL-10, I L-12p70, IL-18, IL-23, IL-33 and the MCP1 protein, but also at least one interferon (IFN) subtype, such as interferon alpha-2 (IFNa2), interferon gamma (IFNy) by an immunity cell, when said agent is brought into contact with an immunity cell.
  • TNFa tumor necrosis factor alpha
  • IFNa2 interferon alpha-2
  • IFNy interferon gamma
  • the compounds of formula (I) can be used in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the protein kinase ROCK and the protein kinase PDK1.
  • the present invention relates to the use of a compound of formula (I) for the preparation of a drug, in particular a drug intended to block and/or inhibit the interaction between the protein kinases ROCK and PDK1.
  • the present invention relates to the preparation of a medicament comprising a compound of formula (I) for blocking and/or inhibiting the interaction between the protein kinases ROCK and PDK1.
  • said medicinal product can be used in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the ROCK protein kinase and the PDK1 protein kinase.
  • the compound of formula (I) is particularly effective in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the protein kinase ROCK and the protein kinase PDK1.
  • the compound of formula (I) is particularly effective in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the protein kinase ROCK and the protein kinase PDK1 chosen from the diseases inflammation, viral infections, bacterial infections and autoimmune diseases.
  • Another aspect of the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising at least one compound of formula (I) as described above or an acceptable pharmaceutical salt thereof, as active ingredient and at least one pharmaceutically acceptable excipient and / or a carrier and/or a pharmaceutically acceptable diluent and/or carrier.
  • at least one compound of formula (I) is an agent dissociating the ROCK/PDK1 protein kinase complex.
  • the pharmaceutical composition comprising at least one compound of formula (I) as described above or an acceptable pharmaceutical salt thereof, as active principle and at least one pharmaceutically acceptable excipient and/or a carrier and/or a diluent and / or a pharmaceutically acceptable vehicle, is particularly effective in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the protein kinase ROCK and the protein kinase PDK1.
  • said pharmaceutical composition is particularly effective in the prevention and/or treatment of a pathology requiring the use of an inhibitor of the interaction between the ROCK protein kinase and the PDK1 protein kinase chosen from inflammatory diseases, infections viral, bacterial infections and autoimmune diseases.
  • the pharmaceutical composition comprises at least one compound of formula (I) as described above or an acceptable pharmaceutical salt thereof, as active principle and at least one pharmaceutically acceptable excipient and/or a carrier and /or a diluent and/or a pharmaceutically acceptable vehicle.
  • the pharmaceutical composition according to the invention may comprise a combination of at least two different compounds of formula (I), advantageously at least three different compounds of formula (I), advantageously at least four different compounds of formula (I), advantageously at least five different compounds of formula (I), advantageously at least six different compounds of formula (I), or more.
  • the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a pharmaceutically active amount of at least one compound of formula (I) or a pharmaceutically acceptable salt thereof as described above and at least one pharmaceutically acceptable excipient and/or a pharmaceutically acceptable carrier and/or diluent and/or vehicle.
  • the pharmaceutical composition according to the invention may comprise a combination of at least two different compounds of formula (I), advantageously at least three different compounds of formula (I), advantageously at least four different compounds of formula (I), advantageously at least five different compounds of formula (I), advantageously at least six different compounds of formula (I), or more.
  • the patient may be a human.
  • the patient can be a non-human animal, in particular a dog, a cat, a horse, a cow, a pig, a sheep, a goat, a deer or a primate.
  • a therapeutically effective amount of at least one compound of formula (I) or a pharmaceutically acceptable salt thereof according to the invention means the amount of a compound of formula (I) or a pharmaceutically acceptable salt thereof or of a composition necessary to inhibit or reverse a disease (by example, to treat inflammation, viral infections and autoimmune diseases). Determining a therapeutically effective amount specifically depends on factors such as drug toxicity and efficacy. These factors will differ based on other factors such as potency, relative bioavailability, patient body weight, severity of adverse effects, and preferred route of administration.
  • Toxicity can be determined using methods well known in the art. Efficacy can be determined using the same indications. Efficacy can be measured by a decrease in inflammation or infection, for example in a model of juvenile idiopathic arthritis. A pharmaceutically effective amount is therefore an amount that the clinician considers to be toxicologically tolerable, but effective.
  • the dosage can be adjusted as appropriate to obtain the desired drug (e.g., an inhibitor of the interaction between ROCK and PDK1 protein kinases of the invention) at local or systemic levels, depending on the mode of administration. In the event that a patient's response is insufficient at such doses, even higher doses (or higher effective doses by a different, more localized route of administration) may be used as patient tolerance allows. permits. Multiple doses per day may also be used to achieve appropriate systemic levels of the compound of formula (I) or a pharmaceutically acceptable salt thereof according to the invention. Appropriate systemic levels can be determined, for example, by measuring the patient's peak or prolonged plasma level. "Dose" and “dosage” are used interchangeably herein.
  • the quantity of compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention or of pharmaceutical composition comprising at least one compound of formula (I) or a salt Acceptable pharmaceutical dosage of it as an active ingredient administered to a patient is 0.5 mg to 30 mg per kg of body weight, depending on the intensity of the inflammation.
  • the quantity of compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention or of pharmaceutical composition comprising at least one compound of formula (I) or an acceptable pharmaceutical salt thereof as active ingredient administered to a patient is 1.0 mg, advantageously 1.5 mg, advantageously 2.0 mg, advantageously 2.5 mg, advantageously 3.0 mg, advantageously 3.5 mg, advantageously 4.0 mg, preferably 4.5 mg, preferably 5.0 mg, preferably 5.5 mg, preferably 6.0 mg, preferably 6.5 mg, preferably 7.0 mg, preferably 7 .5 mg, advantageously 8.0 mg, advantageously 8.5 mg, advantageously 9.0 mg, advantageously 9.5 mg, advantageously 10.0 mg, advantageously 10.5 mg, advantageously 11, 0mg, advantageously 11.5 mg, advantageously 12.0 mg, advantageously 12.5 mg, advantageously 13.0 mg, advantageously 13.5 mg, advantageously 14.0 mg, advantageously 14.5 mg, advantageously 15.0 mg, advantageously 15.5 mg, advantageously 16.0 mg, advantageously 16.5 mg, advantageously 17.0 mg, advantageously 17.5 mg,
  • the quantity of compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention or of pharmaceutical composition comprising at least one compound of formula (I) or an acceptable pharmaceutical salt thereof as active principle administered to a patient is between 0.5 mg to 30.0 mg per kg of body weight, advantageously between 0.5 mg and 29.0 mg per kg of body weight, advantageously between 0.5 mg and 28, 0 mg per kg body weight, preferably between 0.5 mg and 27.0 mg per kg body weight, preferably between 0.5 mg and 26.0 mg per kg body weight, preferably between 0.5 mg and 25 0.0 mg per kg body weight, preferably between 0.5 mg and 24.0 mg per kg body weight, preferably between 0.5 mg and 23.0 mg per kg body weight, preferably between 0.5 mg and 22.0 mg per kg body weight, preferably between 0.5 mg and 21 mg per kg body weight, preferably between 0.5 mg and 20.0 mg per kg of body weight, advantageously between 0.5 mg and 19.0 mg per kg of body weight, advantageously between 0.5 mg and 18.0 mg per kg of body weight, advantageously
  • the quantity of compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention or of pharmaceutical composition comprising at least one compound of formula (I) or a salt Acceptable pharmaceutical dosage of it as an active ingredient administered to a patient is 0.5 mg to 30 mg per kg of body weight, depending on the intensity of the infection.
  • the quantity of compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention or of pharmaceutical composition comprising at least one compound of formula (I) or an acceptable pharmaceutical salt thereof as active ingredient administered to a patient is 1.0 mg, advantageously 1.5 mg, advantageously 2.0 mg, advantageously 2.5 mg, advantageously 3.0 mg, advantageously 3.5 mg, advantageously 4.0 mg, preferably 4.5 mg, preferably 5.0 mg, preferably 5.5 mg, preferably 6.0 mg, preferably 6.5 mg, preferably 7.0 mg, preferably 7 .5 mg, advantageously 8.0 mg, advantageously 8.5 mg, advantageously 9.0 mg, advantageously 9.5 mg, advantageously 10.0 mg, advantageously 10.5 mg, advantageously 11, 0 mg, advantageously 11.5 mg, advantageously 12.0 mg, advantageously 12.5 mg, advantageously 13.0 mg, advantageously 13.5 mg, a advantageously 14.0 mg, advantageously 14.5 mg, advantageously 15.0 mg, advantageously 15.5 mg, advantageously 16.0 mg, advantageously 16.5 mg, advantageously 17.0 mg, advantageously 17.5 mg,
  • the quantity of compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention or of pharmaceutical composition comprising at least one compound of formula (I) or an acceptable pharmaceutical salt thereof as active principle administered to a patient is between 0.5 mg and 30.0 mg per kg of body weight, advantageously between 0.5 mg and 29.0 mg per kg of body weight, advantageously between 0.5 mg and 28 0.0 mg per kg body weight, preferably between 0.5 mg and 27.0 mg per kg body weight, preferably between 0.5 mg and 26.0 mg per kg body weight, preferably between 0.5 mg and 25.0 mg per kg body weight, preferably between 0.5 mg and 24.0 mg per kg body weight, preferably between 0.5 mg and 23.0 mg per kg body weight, preferably between 0.5 mg and 22.0 mg per kg body weight, preferably between 0.5 mg and 21 mg per kg body weight, preferably between 0.5 mg and 20.0 mg per kg body weight, preferably between 0.5 mg and 19.0 mg per kg body weight, preferably between 0.5 mg and 18.0 mg per kg body weight, preferably between 0.5 mg and 3
  • this unit dose can be repeated if necessary.
  • the pharmaceutical composition according to the invention is administered to the patient at the rate of one, two, three, four, five, six or seven times per week.
  • the pharmaceutical composition according to the invention is administered to the patient at the rate of seven times per week, that is to say one administration per day for seven consecutive days.
  • the pharmaceutical composition according to the invention is administered to the patient six times a week.
  • the pharmaceutical composition according to the invention is administered to the patient five times a week.
  • the pharmaceutical composition according to the invention is administered to the patient four times a week.
  • the pharmaceutical composition according to the invention is administered to the patient three times a week.
  • the pharmaceutical composition according to the invention is administered to the patient twice a week.
  • the pharmaceutical composition according to the invention is administered to the patient once a week.
  • the pharmaceutical compositions provided are used for in vivo applications.
  • the pharmaceutical compositions used may be in solid, semi-solid or liquid dosage form such as, for example, tablets, pills, powders, capsules, gels, ointments, liquids, suspensions.
  • the pharmaceutical compositions are administered in unit dosage forms suitable for single administration of precise doses.
  • Pharmaceutical compositions may also include, depending on the desired formulation, at least one pharmaceutically acceptable carrier or diluent, which are defined as aqueous-based vehicles commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is chosen so as not to affect the biological activity of the compound of formula (I) or an acceptable pharmaceutical salt thereof according to the invention.
  • the pharmaceutical composition may also include other non-toxic, non-therapeutic, non-immunogenic medicinal agents, pharmaceutical agents, carriers, adjuvants, stabilizers, etc. Effective amounts of such diluent or carrier are amounts effective to obtain a pharmaceutically acceptable solution in terms of formulation, component solubility, biological activity, etc.
  • the pharmaceutical compositions provided herein are sterile. It is possible to envisage formulating at least one the compound of formula (I) or an acceptable pharmaceutical salt thereof according to the present invention in a proportion of 0.5 to 98% by weight, expressed by weight, or even more, relative to the total weight of the pharmaceutical composition considered.
  • the pharmaceutical composition according to the invention comprises only at least one the compound of formula (I) or a pharmaceutically acceptable salt thereof, as sole active principle.
  • the compound of general formula (I) of the pharmaceutical composition is chosen from the compounds of formula (V) to (IX):
  • the pharmaceutical composition comprises the compound of formula (I) as defined above, as single active ingredient
  • the pharmaceutical composition comprises the compound of formula (V) as defined previously, as sole active principle
  • the pharmaceutical composition comprises the compound of formula (VI) as defined above, as sole active principle
  • the pharmaceutical composition comprises the compound of formula (VII) as defined above, as sole active principle
  • the pharmaceutical composition comprises the compound of formula (VIII) as defined above, as sole active principle
  • the pharmaceutical composition comprises the compound of formula (IX) as defined above, as sole active principle
  • the pharmaceutical composition according to the invention also comprises at least one second active principle.
  • the at least one second active ingredient can interact synergistically with the compound of formula (I) according to the invention or a salt pharmaceutically acceptable thereof.
  • the second active principle can be a corticosteroid, advantageously prednisone.
  • the pharmaceutical composition when the pharmaceutical composition comprises a second active ingredient, the pharmaceutical composition is suitable for simultaneous administration or sequential administration of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt of the latter and of the second active ingredient.
  • the term "simultaneous administration” means an administration of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and of the second active ingredient at the same time, at the same time, to a patient in therapeutically effective amounts to achieve the synergistic effect of the pharmaceutical composition.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and the second active principle are necessarily administered in the form of a mixture; they can in fact be administered simultaneously but separately, in the form of distinct compositions.
  • compositions By “present in two separate compositions”, it is meant that the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and the second active principle are physically separated. They are then implemented, administered separately in therapeutically effective amounts to allow the synergistic effect of the pharmaceutical composition, without prior mixing, in several (at least two) dosage forms (for example two distinct compositions).
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and the second active ingredient may be present in the same composition in therapeutically effective amounts for allow the synergistic effect of the pharmaceutical composition.
  • the term “present in the same composition” means the physical combination of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and the second active ingredient.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and the second active principle are then necessarily administered simultaneously since they are administered together, in the form of a mixture, in the same dosage form.
  • the expression "sequential administration” means that the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof and the second active ingredient are administered in therapeutically effective amounts for allow the synergistic effect of the pharmaceutical composition, not simultaneously but separately in time, one after the other.
  • the terms “preceding” or “preceding” and “following” or “following” then apply.
  • preceding or “preceding” is used when a compound of the pharmaceutical composition according to the invention is administered a few minutes or several hours, or even several days before the administration of the other compound(s) of the composition pharmaceutical.
  • follow or “following” is used when a compound of the pharmaceutical composition is administered a few minutes or several hours, or even several days after the administration of the other compound(s) of the pharmaceutical composition.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof is administered a few days before the second active principle.
  • the pharmaceutical composition when the pharmaceutical composition comprises a second active ingredient, the pharmaceutical composition is suitable for sequential administration of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof.
  • the second active principle can be a corticosteroid, advantageously prednisone.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof is administered to the patient, then two to three days later, the second active principle is administered to this same patient, for at least one week, advantageously at least two weeks, advantageously at least three weeks, advantageously at least four weeks, advantageously at least five weeks, advantageously at least six weeks, advantageously at least seven weeks.
  • Administration during in vivo treatment can be by any route including oral, parenteral, transdermal, intramuscular, intranasal, sublingual, intratracheal, inhalation, ocular, vaginal and rectal.
  • Intracapsular, intravenous and intraperitoneal routes of administration can also be used.
  • a person skilled in the art will know how to adapt the route of administration according to the disorder to be treated.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or the pharmaceutical composition according to the invention comprising at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof can be administered to a patient by oral, parenteral or topical administration.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or the pharmaceutical composition according to the invention comprising at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof is in a form suitable for oral, parenteral or topical administration.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or the pharmaceutical composition according to the invention comprising at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof, optionally in the form of nanoparticles are administered by intravenous infusion.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or the pharmaceutical composition according to the invention comprising at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof these, when it is desirable to administer them systemically, can be formulated for parenteral administration by injection, for example by bolus injection or continuous infusion. Injection formulations may be presented in unit dosage form, for example in ampoules or in multi-dose containers, with an added preservative. Pharmaceutical compositions can take forms such as suspensions, solutions or emulsions in oily or aqueous vehicles and can contain formulants such as suspending agents, stabilizers and/or dispersants.
  • compositions for parenteral administration include aqueous solutions of active pharmaceutical compositions in water-soluble form. Additionally, suspensions of the active pharmaceutical compositions can be prepared as suitable oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethylcellulose, sorbitol or dextran.
  • the suspension may also contain suitable stabilizers or agents which increase the solubility of the pharmaceutical compositions to allow the preparation of highly concentrated solutions.
  • the active compositions may be in powder form to constitute a suitable vehicle, for example pyrogen-free sterile water, before use.
  • the pharmaceutical compositions may take the form of, for example, tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (eg, pregelatinized corn starch, polyvinylpyrrolidone, methylcellulose or hydroxypropylmethylcellulose); fillers (eg, lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (eg magnesium stearate, talc or silica); disintegrants (eg potato starch or sodium starch glycolate); or wetting agents (eg, sodium lauryl sulfate). Tablets can be coated by methods well known in the art.
  • pharmaceutically acceptable excipients such as binding agents (eg, pregelatinized corn starch, polyvinylpyrrolidone, methylcellulose or hydroxypropylmethylcellulose); fillers (eg, lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (eg magnesium stearate, talc or silica); disintegrants (eg potato
  • Liquid preparations for oral administration may take the form of, for example, solutions, syrups or suspensions, or may be presented as a dry product for reconstitution with water or other suitable vehicle before use.
  • These liquid preparations can be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (eg, sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (eg lecithin or gum arabic); non-aqueous vehicles (eg almond oil, oily esters, ethyl alcohol or fractionated vegetable oils); and preservatives (eg, methyl or propyl-p-hydroxybenzoates or sorbic acid).
  • the preparations may also contain buffering salts, flavorings, colorings and sweeteners, as appropriate.
  • the site of release can be the stomach, the small intestine (duodenum, jejunum or ileum) or the large intestine.
  • compositions which will not dissolve in the stomach, but which will release the material in the duodenum or elsewhere in the intestine. Preferably, the release will avoid the deleterious effects of the stomach environment or by releasing the biologically active material beyond the stomach environment, such as into the intestine.
  • the compositions may take the form of conventionally formulated tablets or lozenges.
  • compositions for use according to the present invention may suitably be delivered as an aerosol spray from pressurized packs or a nebulizer, using a suitable propellant, e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane carbon dioxide or other suitable gas.
  • a suitable propellant e.g. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane carbon dioxide or other suitable gas.
  • the dosage unit can be determined by providing a valve to deliver a metered amount.
  • the compositions according to the invention can be reduced to powder form for administration by inhalation.
  • compositions according to the invention in powder form can be mixed with a second powder, called base powder such as a powder of lactose or starch, the mixture of the two powders being packaged in the form of cartridges or capsules intended for use in an inhaler or insufflator.
  • base powder such as a powder of lactose or starch
  • the present invention also relates to pulmonary administration.
  • the pharmaceutical compositions can be delivered to the lungs of a mammal while inhaling and crossing the epithelial mucosa of the lung into the bloodstream.
  • a wide range of mechanical devices designed for pulmonary delivery of therapeutics including, but not limited to, nebulizers, metered dose inhalers, and powder inhalers, all known to those skilled in the art, are contemplated for use in the present invention.
  • Nasal delivery of a pharmaceutical composition described herein is also contemplated.
  • Nasal delivery allows the passage of a pharmaceutical composition of the present invention to the blood stream directly after administration of the therapeutic product to the nose, without the need to deposit the product in the lungs.
  • Formulations for nasal administration include those with dextran or cyclodextrin, as well as bioadhesive excipients such as, for example, chitosan.
  • compositions can also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, for example containing conventional suppository bases such as cocoa butter or other glycerides.
  • compositions may also include suitable solid or gel phase carriers or excipients.
  • suitable solid or gel phase carriers or excipients include, but are not limited to, calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin and polymers such as polyethylene glycols.
  • Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, notched, applied to microscopic gold particles, contained in liposomes, nebulized, aerosols, pastilles for implantation in the skin .
  • Pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, skin or transdermal patches, drops or preparations Sustained release active compositions and/or auxiliaries such as disintegrants, binders, coating agents, bulking agents, lubricants, flavors, sweeteners or solubilizers are usually used as described above.
  • the pharmaceutical compositions are suitable for use in various drug delivery systems.
  • Another object of the invention relates to a method for the preventive treatment of inflammatory diseases, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or the pharmaceutical composition according to the invention comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or or a pharmaceutically acceptable diluent and/or vehicle as defined above.
  • prevention or “prophylaxis” or “preventive treatment” or “prophylactic treatment” includes a treatment leading to the prevention of a disease as well as a treatment reducing and/or delaying the incidence of a disease or the risk of the disease occurring.
  • the present invention relates to a method for the preventive treatment of inflammatory diseases, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt of that -ci or a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and / or support and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above and a second active ingredient as defined above.
  • the inflammatory disease can be chosen from: amyloid neurodegenerative diseases, such as Alzheimer's disease, prions, Parkinson's disease, Amyotrophic Lateral Sclerosis; inflammatory bowel diseases, such as inflammatory bowel disease (IBD), irritable bowel syndrome (IBS), Crohn's disease, ulcerative colitis, bleeding rectal ulcer, concomitant lesions of Behçet's disease, pouchitis, ulcerative colitis, ileitis and enteritis; acute inflammatory diseases such as gout and septic shock, chronic inflammatory low back pain, inflammatory skin diseases or dermatitis, such as psoriasis, atopic dermatitis, rosacea, rosacea, acne, common warts, bullous skin diseases, contact eczema, skin cancers, redness, erythema, telangiectasia, skin inflammation related to UV exposure, such as photo-irritation, photo-sensitization, photoaging, photocarcinogenesis, lymphatic ,
  • the present invention relates to a method for the preventive treatment of amyloid neurodegenerative diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • amyloid neurodegenerative diseases can be chosen from: Alzheimer's disease, prions, Parkinson's disease, Amyotrophic Lateral Sclerosis, the list not being exhaustive.
  • the present invention relates to a method for the preventive treatment of acute inflammatory diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the acute inflammatory diseases can be chosen from: gout and septic shock, the list not being exhaustive.
  • the present invention relates to the use of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle in the manufacture of a medicament intended to the prevention of inflammatory diseases.
  • the present invention relates to the use of a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof in as an active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above in the manufacture of a medicament intended for the prevention of inflammatory diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof for its use in the prevention of inflammatory diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one pharmaceutically acceptable diluent and/or vehicle as defined above for its use in the prevention of diseases inflammatory.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined previously for its use in the prevention of inflammatory diseases.
  • the present invention relates to a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof.
  • ci chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active principle and at least one pharmaceutically acceptable excipient and/or support and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above for its use in the prevention of inflammatory diseases.
  • Another object of the invention relates to a method for the preventive treatment of autoimmune diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a composition pharmaceutical comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof is particularly effective in preventing the appearance of autoimmune diseases, by inhibiting the production of inflammatory cytokines, thus inducing a protective effect against autoimmune diseases.
  • the present invention relates to a method for the preventive treatment of autoimmune diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt of that -ci or a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and / or carrier and / or a diluent and / or a pharmaceutically acceptable vehicle as defined above and a second active ingredient as defined above.
  • the autoimmune disease can be chosen from: systemic lupus erythematosus, systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, insulin-dependent diabetes, thrombotic thrombocytopenic purpura (ITP), rejection of transplants or organ damage, graft-versus-host disease, different types of sclerosis, primary Sjögren's syndrome (or Gougerot-Sjögren's syndrome), autoimmune polyneuropathies such as multiple sclerosis, type I diabetes, autoimmune hepatitis, ankylosing spondylitis, Reiter's syndrome, gout arthritis, Hashimoto's chronic thyroiditis (hypothyroidism), Addison's disease, autoimmune hepatitis, Graves' disease (hyperthyroidism) , auto-cytopenia immune disorders and other hematological complications in adults and children, such as acute or chronic autoimmune thrombocytopenia, autoimmune hemolytic
  • the present invention relates to a method for the preventive treatment of rheumatoid arthritis, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the present invention relates to a method for the preventive treatment of systemic lupus erythematosus, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the present invention relates to the use of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle in the manufacture of a medicament intended to the prevention of autoimmune diseases.
  • the present invention relates to the use of a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof in as an active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above in the manufacture of a medicament intended for the prevention of autoimmune diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as defined previously for its use in the prevention of autoimmune diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one pharmaceutically acceptable diluent and/or vehicle as defined above for its use in the prevention of diseases autoimmune.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined previously for its use in the prevention of autoimmune diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one pharmaceutically acceptable diluent and/or vehicle as defined above for its use in the prevention of diseases autoimmune.
  • Another object of the invention relates to a method for the preventive treatment of viral and/or bacterial infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of one pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the compounds of formula (I) according to the invention or a pharmaceutically acceptable salt thereof are particularly effective in preventing the appearance, development, amplification, persistence of viral infections and/or bacteria, by inhibiting the production of inflammatory cytokines, thus inducing a protective effect against viral and/or bacterial infections.
  • the compounds of formula (V), (VI), (VIII) and (IX) are capable of blocking the production and/or the secretion of interferons on peripheral blood mononuclear cells (PBMC ) from healthy donors as a preventive measure before stimulation with the influenza virus (influenza virus).
  • PBMC peripheral blood mononuclear cells
  • the compounds of formula (V) and (VI) are capable of blocking the production of TNF ⁇ by plasmacytoid dendritic cells isolated from peripheral blood mononuclear cells (PBMC) of healthy donors in a preventive manner before the stimulation by the flu virus (influenza virus).
  • PBMC peripheral blood mononuclear cells
  • the compounds of formula (V), (VI) and (VIII) are capable of blocking the production and/or the secretion of interferons on peripheral blood mononuclear cells (PBMC) of healthy donors in an preventive before stimulation by the human immunodeficiency virus (HIV).
  • PBMC peripheral blood mononuclear cells
  • a compound of formula (I) has a preventive effect on the inhibition of the production of interferon induced by the flu virus (influenza virus) and human immunodeficiency virus (HIV).
  • the present invention relates to a method for the preventive treatment of viral and/or bacterial infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a salt pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above and a second active ingredient as defined above.
  • the viral infections can be chosen from: infections due to the influenza virus, the Human Immunodeficiency Virus (HIV), to the herpes virus or Herpes Simplex Virus (HSV), to the coronavirus, to COVID- 19, encephalomyocarditis virus, arboviruses, such as, Chikungunya, O'Nyong Nyong, Ross River, Sindbis, Mayaro, yellow fever virus, dengue fever, Japanese encephalitis, West Nile virus, temperate Eurasian tick-borne encephalitis viruses, Kyasianur forest disease viruses, Omsk hemorrhagic fever Bunyaviridae, Bunyamwera virus, Rift Valley fever virus , Crimean Congo hemorrhagic fever virus, hepatitis A, B and C virus and influenza virus, the list not being exhaustive.
  • HCV Human Immunodeficiency Virus
  • HSV Herpes Simplex Virus
  • the bacterial infections can be chosen from: infections due to Gram-positive bacteria, such as bacteria of the Staphylococcus genus, in particular Staphylococcus aureus, and bacteria of the Enterococcus genus, in particular Enterococcus faecalis; infections due to Gram-negative bacteria, such as bacteria of the genus Escherichia, in particular Escherichia coli, bacteria of the genus Pseudomonas, in particular Pseudomonas aeruginosa, and bacteria of the genus Acinetobacter, in particular Acinetobacter baumanii, the list does not being limiting.
  • Gram-positive bacteria such as bacteria of the Staphylococcus genus, in particular Staphylococcus aureus
  • infections due to Gram-negative bacteria such as bacteria of the genus Escherichia, in particular Escherichia coli, bacteria of the genus
  • the present invention relates to a method for the preventive treatment of coronavirus infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof. or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or support and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • the present invention relates to a method for the preventive treatment of infections due to the influenza virus, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically excipient acceptable and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously
  • the present invention relates to a method for the preventive treatment of human immunodeficiency virus infections.
  • HBV human immunodeficiency virus infections.
  • the present invention relates to a method for the preventive treatment of human immunodeficiency virus infections.
  • HAV human immunodeficiency virus infections.
  • the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined above.
  • the present invention relates to the use of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle in the manufacture of a medicament intended prevention of viral and/or bacterial infections.
  • the present invention relates to the use of a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above in the manufacture of a medicament intended for the prevention of viral and/or bacterial infections.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as defined previously for its use in the prevention of viral and/or bacterial infections.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one pharmaceutically acceptable diluent and/or vehicle as defined above for its use in the prevention of infections viral and/or bacterial.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined previously for its use in the prevention of viral and/or bacterial infections.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active principle and at least one pharmaceutically acceptable excipient and/or carrier and / or a diluent and / or a pharmaceutically acceptable vehicle as defined above for its use in the prevention of viral and / or bacterial infections.
  • Another object of the invention relates to a method of curative treatment of inflammatory diseases, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or the pharmaceutical composition according to the invention comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or or a pharmaceutically acceptable diluent and/or vehicle as defined above.
  • treatment or “curative treatment” is defined as a treatment leading to a cure or a treatment which alleviates, improves and/or eliminates, reduces and/or stabilizes the symptoms of a disease or the suffering it causes.
  • the present invention relates to a method of curative treatment of inflammatory diseases, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt of that -ci or a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and / or support and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above and a second active ingredient as defined above.
  • the inflammatory disease can be chosen from: amyloid neurodegenerative diseases, such as Alzheimer's disease, prions, Parkinson's disease, Amyotrophic Lateral Sclerosis; inflammatory bowel diseases, such as inflammatory bowel disease (IBD), irritable bowel syndrome (IBS), Crohn's disease, ulcerative colitis, bleeding rectal ulcer, comorbid lesions Behçet's disease, pouchitis, ulcerative colitis, ileitis and enteritis; acute inflammatory diseases such as gout and septic shock, chronic inflammatory low back pain, inflammatory skin diseases or dermatitis, such as psoriasis, atopic dermatitis, rosacea, rosacea, acne, common warts, bullous skin diseases, contact eczema, skin cancers, redness, erythema, telangiectasia, skin inflammation related to UV exposure, such as photo-irritation, photo -sensitization, photoaging, photocarcinogenesis, lymphatic inflammatory
  • the present invention relates to a method for the curative treatment of amyloid neurodegenerative diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • amyloid neurodegenerative diseases can be chosen from: Alzheimer's disease, prions, Parkinson's disease, Amyotrophic Lateral Sclerosis, the list not being exhaustive.
  • the present invention relates to a method of curative treatment of acute inflammatory diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • the acute inflammatory diseases can be chosen from: gout and septic shock, the list not being exhaustive.
  • the present invention relates to the use of a compound of formula (I) according to the invention or a pharmaceutically acceptable thereof as an active ingredient in the manufacture of a medicament for the treatment of inflammatory diseases.
  • the present invention relates to the use of a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof in as an active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously in the manufacture of a medicament intended for the treatment of inflammatory diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof for its use in the treatment of inflammatory diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously for its use in the treatment of diseases inflammatory.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined previously for its use in the treatment of inflammatory diseases.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as previously defined for its use in the treatment of inflammatory diseases.
  • Another object of the invention relates to a method of curative treatment of autoimmune diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof is particularly effective in preventing the appearance of autoimmune diseases, by inhibiting the production of inflammatory cytokines, thus inducing a protective effect against autoimmune diseases.
  • the present invention relates to a method for the curative treatment of autoimmune diseases, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt of that -ci or a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and / or carrier and / or a diluent and / or a pharmaceutically acceptable vehicle as defined above and a second active ingredient as defined above.
  • the autoimmune disease can be chosen from: systemic lupus erythematosus, systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, insulin-dependent diabetes, thrombotic thrombocytopenic purpura (ITP), rejection of transplants or organ damage, graft-versus-host disease, different types of sclerosis, primary Sjögren's syndrome (or Gougerot-Sjögren's syndrome), autoimmune polyneuropathies such as multiple sclerosis, type I diabetes, autoimmune hepatitis, ankylosing spondylitis, Reiter's syndrome, gout arthritis, Hashimoto's chronic thyroiditis (hypothyroidism), Addison's disease, autoimmune hepatitis, Graves' disease (hyperthyroidism) , autoimmune cytopenias and other hematological complications in adults and children, such as acute or chronic autoimmune thrombocytopenia, autoimmune hemolytic
  • the present invention relates to a method of curative treatment of rheumatoid arthritis, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • the present invention relates to a method for the curative treatment of systemic lupus erythematosus, comprising the administration to the patient of the compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and /or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • the present invention relates to the use of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle in the manufacture of a medicament intended in the treatment of autoimmune diseases.
  • the present invention relates to the use of a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof in as an active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above in the manufacture of a medicament intended for the treatment of autoimmune diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as defined previously for its use in the treatment of autoimmune diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously for its use in the treatment of diseases autoimmune.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined previously for its use in the treatment of autoimmune diseases.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously for its use in the treatment of diseases autoimmune.
  • Another object of the invention relates to a method of curative treatment of viral and/or bacterial infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • the compounds of formula (I) according to the invention or a pharmaceutically acceptable salt thereof are particularly effective in preventing the appearance, development, amplification, persistence of viral infections and/or bacteria, by inhibiting the production of inflammatory cytokines, thus inducing a protective effect against viral and/or bacterial infections.
  • the compounds of formula (V), (VI), (VIII) and (IX) are capable of blocking the production of interferons on peripheral blood mononuclear cells (PBMC) from healthy donors of preventively before stimulation by the influenza virus (influenza virus).
  • PBMC peripheral blood mononuclear cells
  • the compounds of formula (V) and (VI) are capable of blocking the production of TNF ⁇ by plasmacytoid dendritic cells isolated from peripheral blood mononuclear cells (PBMC) of healthy donors in a preventive manner before the stimulation by the flu virus (influenza virus).
  • PBMC peripheral blood mononuclear cells
  • the compounds of formula (V), (VI) and (VIII) are capable of blocking the production and/or the secretion of interferons on peripheral blood mononuclear cells (PBMC) of healthy donors in an preventive before stimulation by the human immunodeficiency virus (HIV).
  • PBMC peripheral blood mononuclear cells
  • a compound of formula (I) has a curative effect on the inhibition of the production of interferon induced by the flu virus (influenza virus) and human immunodeficiency virus (HIV).
  • the present invention relates to a method of curative treatment of viral and/or bacterial infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a salt pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above and a second active ingredient as defined above.
  • the viral infections can be chosen from: infections due to the influenza virus, the Human Immunodeficiency Virus (HIV), to the herpes virus or Herpes Simplex Virus (HSV), to the coronavirus, to COVID- 19, encephalomyocarditis virus, arboviruses, such as, Chikungunya, O'Nyong Nyong, Ross River, Sindbis, Mayaro, yellow fever virus, dengue fever, Japanese encephalitis, West Nile virus, temperate Eurasian tick-borne encephalitis viruses, Kyasianur forest disease viruses, Omsk hemorrhagic fever Bunyaviridae, Bunyamwera virus, Rift Valley fever virus , the hemorrhagic fever virus Crimea Congo, the hepatitis A, B and C virus and the influenza virus, the list not being exhaustive.
  • HCV Human Immunodeficiency Virus
  • HSV Herpes Simplex Virus
  • the bacterial infections can be chosen from: infections due to Gram-positive bacteria, such as bacteria of the Staphylococcus genus, in particular Staphylococcus aureus, and bacteria of the Enterococcus genus, in particular Enterococcus faecalis; infections due to Gram-negative bacteria, such as bacteria of the genus Escherichia, in particular Escherichia coli, bacteria of the genus Pseudomonas, in particular Pseudomonas aeruginosa, and bacteria of the genus Acinetobacter, in particular Acinetobacter baumanii, the list does not being limiting.
  • Gram-positive bacteria such as bacteria of the Staphylococcus genus, in particular Staphylococcus aureus
  • infections due to Gram-negative bacteria such as bacteria of the genus Escherichia, in particular Escherichia coli, bacteria of the genus
  • the present invention relates to a method of curative treatment of coronavirus infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof. or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or support and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above.
  • the present invention relates to a method of curative treatment of infections due to the influenza virus, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically excipient acceptable and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously
  • the present invention relates to a method of curative treatment of human immunodeficiency virus (HIV) infections, comprising the administration to the patient of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof or of a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined previously.
  • HAV human immunodeficiency virus
  • the present invention relates to the use of a compound of formula (I) according to the invention or a pharmaceutically acceptable thereof as an active ingredient in the manufacture of a medicament for the treatment of viral and/or bacterial infections.
  • the present invention relates to the use of a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active principle and at least one pharmaceutically acceptable excipient and/or carrier and/or a diluent and/or a pharmaceutically acceptable vehicle as defined above in the manufacture of a medicament intended for the treatment of viral and/or bacterial infections.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as defined previously for its use in the treatment of viral and/or bacterial infections.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one pharmaceutically acceptable diluent and/or vehicle as defined above for its use in the treatment of infections viral and/or bacterial.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a therapeutically effective amount of at least one compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one diluent and/or one pharmaceutically acceptable vehicle as defined previously for its use in the treatment of viral and/or bacterial infections.
  • the present invention relates to a compound of formula (I) according to the invention or a pharmaceutically acceptable salt thereof chosen from: the compounds of formula (V), of formula (VI), of formula (VII), of formula (VIII) and of formula (IX) as active ingredient and at least one pharmaceutically acceptable excipient and/or carrier and/or one pharmaceutically acceptable diluent and/or vehicle as defined above for its use in the treatment of infections viral and/or bacterial.
  • Figure 1 shows the modeling of the ROCK and PDK1 kinase complex made from the crystallographic data deposited in the PDB (2ESM for ROCK-1 and 2R7B for PDK1).
  • the ball structure designates the amino acid side chain of PDK1 phosphorylated by ROCK.
  • FIG. 2 shows the blocking by the compound of formula (V) of the secretion of interferons and inflammatory cytokines on peripheral blood mononuclear cells (PBMC) from healthy donors, in a preventive manner, 1 hour before stimulation by Toll-receptors like TLR 7/8. The results were obtained with the THP1-dual reporter line.
  • PBMC peripheral blood mononuclear cells
  • FIG. 3 shows the blocking by the compound of formula (VI) of the secretion of interferons and inflammatory cytokines on peripheral blood mononuclear cells (PBMC) from healthy donors, in a preventive manner, 1 hour before stimulation by Toll-receptors like TLR 7/8. The results were obtained with the THP1-dual reporter line.
  • PBMC peripheral blood mononuclear cells
  • FIG. 4 shows the blocking by the compound of formula (VII) of the secretion of peripheral blood interferons (PBMC) from healthy donors, in a preventive manner, 1 hour before stimulation by Toll-like TLR 7/8 receptors. The results were obtained with the STING-37 reporter line.
  • PBMC peripheral blood interferons
  • the figure 5 shows the blocking by the compound of formula (VIII) of the secretion of interferons on peripheral blood mononuclear cells (PBMC) of healthy donors, in a preventive manner, 1 hour before stimulation by Toll-like receptors TLR 7 / 8. The results were obtained with the STING-37 reporter line.
  • PBMC peripheral blood mononuclear cells
  • FIG. 6 shows the blocking by the compound of formula (IX) of the secretion of interferons on peripheral blood mononuclear cells (PBMC) of healthy donors, in a preventive manner, 1 hour before stimulation by Toll-like receptors TLR 7 / 8. The results were obtained with the STING-37 reporter line.
  • PBMC peripheral blood mononuclear cells
  • FIG. 7 shows the blocking by the compound of formula (V) of the secretion of inflammatory cytokines and interferons on peripheral blood mononuclear cells (PBMC) from healthy donors in response to stimulation by Toll-like receptors TLR 7 / 8.
  • PBMC peripheral blood mononuclear cells
  • FIG. 8 shows the blocking by the compound of formula (V) of the secretion of inflammatory cytokines and interferons on peripheral blood mononuclear cells (PBMC) from healthy donors in response to stimulation by Toll-like TLR 4 receptors. The results were obtained by LegendPlex.
  • FIG. 9 shows the blocking by the compound of formula (VI) of the secretion of inflammatory cytokines and interferons on peripheral blood mononuclear cells (PBMC) from healthy donors in response to stimulation by Toll-like receptors TLR 7 / 8. The results were obtained by LegendPlex.
  • FIG. 10 shows the blocking by the compound of formula (VI) of the secretion of inflammatory cytokines and interferons on peripheral blood mononuclear cells (PBMC) from healthy donors in response to stimulation by Toll-like TLR 4 receptors.
  • PBMC peripheral blood mononuclear cells
  • Figure 11 shows the blocking by compounds of formula (V) to (VIII) of the activation of B lymphocytes from healthy donors in response to stimulation by Toll-like TLR 9 receptors. Histogram representation of the MFI. Results were obtained by flow cytometry
  • the figure 12 shows the blocking by the compounds of formula (V), (VI), (VIII) and (IX) of the secretion of interferons on peripheral blood mononuclear cells (PBMC) of healthy donors, in a preventive manner, 1h before stimulation with influenza virus (Flu).
  • PBMC peripheral blood mononuclear cells
  • FIG. 13 shows the blocking by the compounds of formula (V), (VI) and (VIII) of the secretion of interferons on peripheral blood mononuclear cells (PBMC) from healthy donors, in a preventive manner, 1 hour before stimulation by the HIV virus. The results were obtained with the TH P1 -dual reporter line.
  • the figure 14 shows the blocking by the compounds of formula (V) and (VI) of the production of TNF ⁇ on monocytes isolated from the peripheral blood mononuclear cells (PBMC) of healthy donors, in a preventive manner, (A) 1 hour before stimulation of TLR7/8, (B) 1h before stimulation of TLR4 and (C) 1h before stimulation of TLR2. Histogram representation of the MFI, The results were obtained by flow cytometry
  • the figure 15 shows the blocking by the compounds of formula (V) and (VI) of the production of TNF ⁇ on plasmacytoid dendritic cells isolated from the peripheral blood mononuclear cells (PBMC) of healthy donors, in a preventive manner, (A) 1h before TLR7 stimulation, (B) 1h before influenza virus (Flu) stimulation and (C) 1h before TLR9 stimulation.
  • PBMC peripheral blood mononuclear cells
  • the figure 16 shows the blocking by the compound of formula (V), according to a dose effect, of the activation of the transcription factor NFkB in the monocyte line THP1-dual, in response to the stimulation of the Toll-like receptors TLR7/8 by R848.
  • the results were obtained by absorptiometry (SEAP test - gray bars).
  • SEAP test - gray bars The results were obtained by absorptiometry with respect to THP-1 cells was measured in parallel (WST-1 test - black bars).
  • the figure 17 shows the blocking by the compound of formula (VI), according to a dose effect, of the activation of the transcription factor NFkB in the monocyte line THP1-dual, in response to the stimulation of the Toll-like receptors TLR7/8 by R848. Results obtained by absorptiometry (SEAP test - gray bars). The toxicity of the compound of formula (VI) with respect to THP-1 cells was measured in parallel (WST-1 test - black bars).
  • the figure 18 shows the blocking by the compound of formula (V), according to a dose effect, of the activation of the transcription factor NFkB in the monocyte line THP1-dual, in response to the stimulation of the Toll-like receptors TLR4 by the LPS.
  • the results were obtained by absorptiometry (SEAP test - gray bars).
  • SEAP test - gray bars The toxicity of the compound of formula
  • the figure 19 shows the blocking by the compound of formula (VI), according to a dose effect, of the activation of the transcription factor NFkB in the monocyte line THP1-dual, in response to the stimulation of the Toll-like receptors TLR4 by the LPS.
  • the results were obtained by absorptiometry (SEAP test - gray bars).
  • SEAP test - gray bars The toxicity of the compound of formula
  • the figure 20 shows the blocking by the compounds of formula (V), (VI), (VIII) and (IX) of the activation of the transcription factors IRF in the monocyte line TH P1 -dual, in response to the stimulation of the STING interferon pathway through cGAMP.
  • the results were obtained by luminometry (shaded bars).
  • the toxicity of the compounds of formula (V), (VI), (VIII) and (IX) with respect to THP-1 cells was measured in parallel (WST-1 test - black bars).
  • Figure 21 shows that the compounds of formula (V) and (VI) have no impact on the enzymatic activity of pyruvate kinase (PK).
  • the figure 22 shows the blocking by the compounds of formula (V) and (VI), according to a dose effect, of the transcription of the pro-inflammatory genes IL1 p, TNF ⁇ , IL6 and MCP1 in the monocyte line THP1, in response to the stimulation of Toll-like TLR7/8 receptors by R848.
  • the results were obtained by RT-qPCR.
  • FIG. 23 shows the blocking by the compounds of formula (V) and (VI), according to a dose effect, of the transcription of the pro-inflammatory genes I L1 p and TNF ⁇ in the monocyte line THP1, in response to the stimulation of Toll -like TLR4 receptors by LPS.
  • the results were obtained by RT-qPCR.
  • FIG. 24 represents the modeling of the ROCK-1 kinase in complex with the compound of formula (V), produced from the crystallographic data deposited in the Protein Data Bank (reference 2ESM for ROCK-1). Indicated are the amino acids of ROCK-1 involved in the interaction with the compound of formula (V).
  • Figure 25 shows that the anti-inflammatory properties of the compounds of formula (V) and (VI) are dependent on the kinase PDK1.
  • the expression of the PDK1 kinase was repressed by a specific siRNA (siPDKI) in monocytes from healthy donors.
  • a control siRNA (siCTL) was used as a negative control for the experiment.
  • the monocytes were then treated with the compounds of formulas (V) or (VI) and stimulated with the TLR7/8 agonist, compound R848. Intracellular production of TNF ⁇ was measured by flow cytometry.
  • A Dot plot representation.
  • B Histogram representation of the MFI (TNFa).
  • the compounds of formulas can be obtained according to the synthetic process described in the publication by Le Corre et al., Microwave-assisted preparation of 4-amino-3-cyano-5-methoxycarbonyl-N-arylpyrazoles as building blocks for the diversity- oriented synthesis of pyrazole-based polycyclic scaffolds, Organic & Biomolecular Chemistry, 2015, vol 13, pages 409-423.
  • PBMC peripheral blood mononuclear cells
  • the PBMCs were cultured at 2.10 6 cells/ml. The cells were then incubated with the compounds of the invention at the concentrations indicated for 1 h before stimulation. The PBMCs were then stimulated for 24 h with the TLR7/8 agonist Resiquimod (R848) at 5 pg/ml. Supernatants were collected for cytokine detection.
  • the activity of the NF-kB transcription factor and the induction of the Interferon (IFN) pathway via Interferon Regulatory Factors (IRF) were measured using the THP1 dual reporter line from Invivogen.
  • the PBMC culture supernatants were added to the THP1-Dual cultures at a rate of 0.4 ⁇ 10 6 cells/ml for 24 h.
  • NF-kb transcription factor activity was measured with QUANTI-Blue, a SEAP detection agent following the supplier's recommendations.
  • IRF activity was measured with QUANTI-Luc, a luciferase detection reagent following the supplier's recommendations.
  • the IC 50 values are reproduced in Table 2 below.
  • the compounds of formula (V) and (VI) are capable of blocking the secretion of interferons and inflammatory cytokines on peripheral blood mononuclear cells (PBMC) from healthy donors, preventively, 1 hour before stimulation by Toll-like TLR 7/8 receptors ( Figures 2 to 3).
  • the compounds of formula (VII), (VIII) and (IX) are capable of blocking the secretion of interferons on peripheral blood mononuclear cells (PBMC) from healthy donors, preventively, 1 hour before stimulation by Toll- receptors like TLR 7/8 ( Figures 4 to 6).
  • the compounds of the invention have a high affinity for the ROCK1 protein kinase (virtual score greater than 30).
  • Example 2 Effect of the compound of formula (V) and (VI) on the production of interferon and inflammatory cytokines on human peripheral blood mononuclear cells after stimulation with R848 and LPS
  • PBMC peripheral blood mononuclear cells
  • the PBMCs were cultured at 2.10 6 cells/ml. The cells were then incubated with the compounds of formula (V) and (VI) at the concentrations indicated for 1 hour before stimulation. The PBMCs were then stimulated for 24 h with the TLR7/8 agonist Resiquimod - R848 at 5 pg/ml and the TLR4 Lipopolysaccharide - LPS agonist at 100 ng/ml. Supernatants were collected for cytokine detection. Cytokine detection
  • the compounds of formula (V) and (VI) are respectively capable of blocking the secretion of the cytokines TNF ⁇ , 111 p, IL6, IL10, I L12p70, IL18, IL23 and IL33, as well as the interferons IFNa2 and IFN ⁇ , and the MCPI protein on peripheral blood mononuclear cells (PBMC) from healthy donors, in response to stimulation by Toll-like TLR 7/8 receptors.
  • PBMC peripheral blood mononuclear cells
  • the compounds of formula (V) and (VI) are respectively capable of blocking the secretion of the cytokines TNF ⁇ , 111b, IL6, IL18 and IL23, as well as the interferon IFNy, and the protein MCPI on peripheral blood mononuclear cells (PBMC) from healthy donors, in response to stimulation by Toll-like TLR 4 receptors.
  • PBMC peripheral blood mononuclear cells
  • Example 3 Effect of compounds of formula (V), (VI), (VII) and (VIII) on the activation of B lymphocytes from healthy donors in response to stimulation by Toll-like TLR9 receptors.
  • PBMC peripheral blood mononuclear cells isolated by density with centrifugation through peripheral blood leukocyte separation medium (STEMCELL Technologies). Blood from healthy donors was obtained at the “Etableau für du Sang” (convention # 07/CABANEL/106; Paris, France). Studies on patient material have been approved by the personal protection committee (ID-RCB/EUDRACT: 2014-A01017-40 and 2018-A01358-47).
  • the B lymphocytes were purified by negative selection with the “B Cell Isolation Kit” (Miltenyi). B lymphocytes were cultured in RPMI 1640 (Sigma) containing 10% inactivated fetal bovine serum and 1 mM glutamine (Hyclone, Logan, UT).
  • the B lymphocytes were cultured at 1.10 6 /ml. The cells were then incubated respectively with the compounds of formula (V) to (VIII) at 20 ⁇ M for 1 h before stimulation. They were stimulated for 16 h (flow cytometry) with the agonist TLR9 CpG-A at 5 mM. Cells were collected for flow cytometry.
  • the cells were resuspended in PBS containing 2% FCS and 2 mM EDTA then labeled with an anti-CD69 antibody (clone REA824) from Miltenyi Biotec, used at 1/100° for 30 min at 4 °C.
  • the cells were washed twice and then passed through flow cytometry. Data acquisition was performed on the Canto II flow cytometer using Diva software (BD Biosciences, San Jose, CA). FlowJo software was used to analyze the data.
  • Example 4 Effect of compounds of formula (V), (VI), (VIII) and (IX) on the secretion of interferons by peripheral blood mononuclear cells (PBMC) from healthy donors, preventively, 1 hour before stimulation by the influenza virus.
  • PBMC peripheral blood mononuclear cells
  • PBMC peripheral blood mononuclear cells
  • the PBMCs were cultured at 2.10 6 cells/ml. The cells were then incubated with the compounds of formula (V), (VI), (VIII) and (IX) at 20 ⁇ M for 1 hour before stimulation. PBMCs were then stimulated for 24 hours with the flu virus (Flu). Supernatants were collected for cytokine detection.
  • PBMC Peripheral Blood Mononuclear Cell
  • IFN Interferon pathway via IRFs
  • THP1 dual reporter line from invivogen.
  • the culture supernatants of the PBMCs were added to the cultures of THP1-Dual at 0.4 ⁇ 106 cells/ml for 24 h.
  • IRF activity was measured with QUANTI-Luc, a luciferase detection reagent following the supplier's recommendations.
  • Example 5 Effect of the compounds of formula (V), (VI) and (VIII) on the secretion of interferons by peripheral blood mononuclear cells (PBMC) of healthy donors, in a preventive manner, 1 hour before stimulation by the HIV virus .
  • PBMC peripheral blood mononuclear cells
  • PBMC peripheral blood mononuclear cells
  • the PBMCs were cultured at 2.10 6 cells/ml. The cells were then incubated with the compounds of formula (V), (VI) and (VIII) at 20 ⁇ M for 1 hour before stimulation. The PBMCs were then stimulated for 24 h with the human immunodeficiency virus (HIV). Supernatants were collected for cytokine detection.
  • PBMC Peripheral Blood Mononuclear Cell
  • IFN Interferon pathway via IRFs
  • THP1 dual reporter line from invivogen.
  • the culture supernatants of the PBMCs were added to the cultures of THP1-Dual at 0.4 ⁇ 106 cells/ml for 24 h.
  • IRF activity was measured with QUANTI-Luc, a luciferase detection reagent following the supplier's recommendations.
  • Example 6 Effect of the compounds of formula (V) and (VI) on the production of TNF ⁇ on monocytes isolated from peripheral blood mononuclear cells (PBMC) of healthy donors.
  • PBMC peripheral blood mononuclear cells
  • PBMC peripheral blood mononuclear cells isolated by density with centrifugation through peripheral blood leukocyte separation medium (STEMCELL Technologies). Blood from healthy donors was obtained at the “Etableau für du Sang” (convention # 07/CABANEL/106; Paris, France). Studies on patient material have been approved by the personal protection committee (ID-RCB/EUDRACT: 2014-A01017-40 and 2018-A01358-47). Human monocytes were purified by positive selection with human CD14 microbeads (Miltenyi). Monocytes were cultured in RPMI 1640 (Sigma) containing 10% inactivated fetal calf serum and 1 mM glutamine (Hyclone, Logan, UT).
  • the monocytes were cultured at 1.10 6 /ml. The cells were then incubated with the compounds of formula (V) and (VI) at 20 ⁇ M for 1 hour before stimulation.
  • the monocytes were stimulated respectively for 16 hours with:
  • condition B the TLR4 Lipopolysaccharide - LPS agonist at 100 ng/ml
  • condition C the TLR2 agonist lipoteichoic acid - LTA at 1 pg/ml.
  • BFA Brefeldin A
  • the cells were rinsed in PBS then incubated with a viability marker (Zombie Aqua, Biolegend) for 30 min at room temperature. After washing, the cells were resuspended in PBS containing 2% FCS and 2 mM EDTA and then labeled with the anti-CD14 antibody (clone REA599) from Miltenyi Biotec, used at 1/100°.
  • the “Inside Stain” kit (Miltenyi Biotec) was used according to the manufacturer's protocol.
  • the cells were fixed for 20 min at room temperature with 250 pL of the Inside Fix solution then labeled in 100 pL of the Inside Perm solution containing the anti-TNFa antibody (clone cA2, Milteniy Bioec) at 1/50° for 30 min at room temperature.
  • Data acquisition was performed on the Canto II flow cytometer using Diva software (BD Biosciences, San Jose, CA). FlowJo software was used to analyze the data.
  • Example 7 Effect of compounds of formula (V) and (VI) on the production of TNF ⁇ on plasmacytoid dendritic cells isolated from peripheral blood mononuclear cells (PBMC) from healthy donors.
  • PBMC peripheral blood mononuclear cells
  • Plasmacytoid dendritic cells were purified by negative selection with the “EasySep Human Plasmacytoid DC” Enrichment Kit (STEMCELL Technologies). Plasmacytoid dendritic cells (pDC) were cultured in RPMI 1640 (Sigma) containing 10% inactivated fetal bovine serum and 1 mM glutamine (Hyclone, Logan, UT).
  • the plasmacytoid dendritic cells were cultured at 1.10 6 /ml. The cells were then incubated with the compounds of formula (V) and (VI) at 20 ⁇ M for 1 hour before stimulation.
  • the plasmacytoid dendritic cells were stimulated respectively for 16 hours with:
  • condition C the TLR9 CpG-A agonist at 5 mM.
  • BFA Brefeldin A
  • the cells were rinsed in PBS then incubated with a viability marker (Zombie Aqua, Biolegend) for 30 min at room temperature. After washing, the cells were resuspended in PBS containing 2% FCS and 2 mM EDTA and then labeled with the anti-CD14 antibody (clone REA599) from Miltenyi Biotec, used at 1/100°.
  • the “Inside Stain” kit (Miltenyi Biotec) was used according to the manufacturer's protocol.
  • the cells were fixed for 20 min at room temperature with 250 ⁇ L of the Inside Fix solution then labeled in 100 ⁇ L of the Inside Perm solution containing the anti-TNFa antibody (clone cA2, Milteniy Bioec) at 1/50° for 30 min at room temperature.
  • Data acquisition was performed on the Canto II flow cytometer using Diva software (BD Biosciences, San Jose, CA). FlowJo software was used to analyze the data.
  • Example 8 Effect of the compounds of formula (V) and (VI) according to a dose effect, of the activation of the transcription factor NFkB in the monocyte line THP1-dual.
  • the THP1-Dual reporter line was cultured at 5.10 5 /ml.
  • the cells were then incubated either with the compound of formula (V) or with the compound of formula (VI) at the concentrations indicated for 1 hour before stimulation.
  • the THP1-Dual were stimulated for 24 hours with:
  • THP1-Dual cells express the secreted embryonic alkaline phosphatase (SEAP) reporter gene under a promoter containing 5 copies of the consensus transcriptional response element NF- ⁇ B. THP1-Dual cells allow the study of the NF-kB pathway by monitoring SEAP activity. SEAP alkaline phosphatase activity is determined using the Quanti-Blue colorimetric enzymatic test (InvivoGen). The THP1-Dual cells are cultured in a 96-well plate (200 ⁇ l/well). After LPS or R848 treatment, for each well, 20 pL of culture medium are added to 180 pL of Quanti-Blue solution and incubated at 37°C for 2 hours. The absorbance (measurement at 655 nm with a spectrophotometer (Model 680 Microplate Reader; Biorad) is proportional to the SEAP activity.
  • SEAP embryonic alkaline phosphatase
  • the cells are cultured in a 96-well plate (200 ⁇ l/well). After LPS or R848 treatment, for each well, 80 or 90 pL of culture medium are removed and 10 pL of a solution of tetrazolium salt WST-1 (4-(3-(4-iodophenyl)-2-(4 -nitrophenyl)-2H-5-tetrazolio)-1,3-benzene disulphonate) (Merck) are added to the remaining 100 ⁇ L of medium.
  • WST-1 is cleaved by mitochondrial respiratory chain reductases of living cells to yield purple-colored, water-soluble formazan which acts as an indicator of cell viability. After 2 hours of incubation at 37°C, the absorbance (measurement at 450 and 655 nm with a spectrophotometer (Model 680 Microplate Reader; Biorad) is proportional to the number of viable cells.
  • Example 9 Effect of the compounds of formula (V), (VI), (VIII) and (IX) according to a dose effect, of the activation of the transcription factor IRF in the monocyte line THP1-dual.
  • the THP1-Dual reporter line was cultured at 5.10 5 /ml. The cells were then incubated with the compounds of formula (V), (VI), (VIII) and (IX) at the concentrations indicated for 1 hour before stimulation. The THP1-Duals were stimulated for 24 hours with the STING pathway agonist, cGAMP. Luciferase test (luminometry)
  • THP1-Dual cells express the Lucia luciferase reporter gene under a promoter containing 5 IFN response elements. THP1-Dual cells allow the study of the IRF pathway by measuring Lucia luciferase activity. The Lucia luciferase activity is determined using the Quanti-Luc GOLD test (InvivoGen). The THP1-Dual cells are cultured in a 96-well plate (200 ⁇ l/well). After LPS or R848 treatment, for each wells, 10 ⁇ L of culture medium are added to 50 ⁇ L of Quanti-Luc GOLD solution and the light signal produced is measured using a luminometer.
  • the cells are cultured in a 96-well plate (200 ⁇ l/well). After LPS or R848 treatment, for each well, 80 or 90 pL of culture medium are removed and 10 pL of a solution of tetrazolium salt WST-1 (4-(3-(4-iodophenyl)-2-(4 -nitrophenyl)-2H-5-tetrazolio)-1,3-benzene disulphonate) (Merck) are added to the remaining 100 ⁇ L of medium.
  • WST-1 is cleaved by mitochondrial respiratory chain reductases of living cells to yield purple-colored, water-soluble formazan which acts as an indicator of cell viability. After 2 hours of incubation at 37°C, the absorbance (measured at 450 and 655 nm with a spectrophotometer (Model 680 Microplate Reader; Biorad) is proportional to the number of viable cells.
  • ADP Adenosine 5'-Diphosphate
  • B-NADH B-Nicotinamide Adenine Dinucleotide
  • the inhibitors (2 ⁇ L) are added to 193 ⁇ L of a mixture containing PEP, ADP, MgSO4, B-NADH and L-Lactic Dehydrogenase. After reading at 340 nm, 7 pL of Pyruvate Kinase are added to the mixture. Samples are read at 340 nm every 1-2 min for 20 min. The results are shown in Figure 21.
  • Example 11 Specific anti-inflammatory effect of compounds of formula (V) and (VI) on immune cells
  • the THP1-dual lines were cultured at 1.10 6 cells/ml. The cells were then incubated with the compound of formula (V) or the compound of formula (VI) at the concentrations indicated for 1 hour before stimulation.
  • THP1-dual (invivogen) were stimulated respectively for 16 h with the TLR7/8 agonist (R848) at 5 pg/ml or for 1 h with the TLR4 agonist (LPS) at 100 ng.ml.
  • Cells were washed in PBS and lysed to prepare mRNAs for analysis by RT-qPCR.
  • Total RNAs are extracted from cells with the E.Z.N.A. Total RNA Kit 1 (Omega Biotek) according to supplier's instructions. The RNA concentration is measured using a spectrophotometer (Nanodrop ND-1000). Total RNAs are reverse-transcribed into cDNA using the Prime Script RT Master Mix kit (Takara RR036A). The cDNA synthesis is carried out according to the following protocol: 300-500 ng of RNA in 8 pL of RNase-free water, supplemented with 2 pL of the reaction buffer (containing the prime script reverse transcriptase, RNase inhibitors , oligodT primers, random 6mers and the mix of dNTPs). The enzymatic reverse transcription reaction is carried out at 37°C for 15 min. The enzyme is inactivated by incubating the sample at 85°C for 15 sec.
  • the real-time quantitative PCR is carried out according to the following conditions: the cDNA diluted to 1/ 10th is added to the following mixture: 3.8 pL of FW, 0, pL sense and antisense primers (10 pM) (Table 3), 5 pL of Absolute qPCR SYBR green mix containing DNA polymerase thermostart, MgCh, SYBR green and dNTPs (Eurogentec). The tests are carried out in triplicate in a 384-well plate (ThermoScientific).
  • DNA amplification by PCR quantitative is carried out in the CFX384 device (BioRad) with the following program: 3 min at 95°C / 5 sec at 95°C and 30 sec at 60°C repeated 40 cycles / 2 min at 72°C and 30 sec at 95° C. followed by a dissociation step which makes it possible to verify the specificity of the amplification product.
  • DNA amplification data is analyzed with Bio-Rad CFX Manager software.
  • THP1 human monocyte cell line THP1 (FIGS. 22 and 23). These cells were stimulated with a TLR7/8 agonist (R848), an agent that mimics single-stranded RNA virus infection.
  • the compound of formula (V) reduces the transcription of the gene encoding TNF ⁇ , IL6, MCP1 and IL1 p induced by R848, according to a dose effect, from 5 pM for TNF ⁇ , IL6, MCP1 and I L1 in THP1-dual monocytes .
  • the compound of formula (VI) reduces the transcription of the gene encoding TNF ⁇ , IL6, MCP1 and I L1 p induced by R848, according to a dose effect, from 2 pM for TNF ⁇ , IL6, MCP1 and I L1 p in THP1 monocytes -dual.
  • the compound of formula (V) reduces the transcription of the gene encoding TNF ⁇ and I L1 induced by LPS, according to a dose effect, from 5 pM for TNF ⁇ and I L1 p in THP1-dual monocytes.
  • the compound of formula (VI) reduces the transcription of the gene encoding TNF ⁇ and I L1 p induced by LPS, according to a dose effect, from 1 pM for TNF ⁇ and I L1 b in THP1-dual monocytes.
  • PBMC peripheral blood mononuclear cells isolated by density with centrifugation through peripheral blood leukocyte separation medium (STEMCELL Technologies). Blood from healthy donors was obtained at the “Etableau für du Sang” (convention # 07/CABANEL/106; Paris, France). Human monocytes were purified by positive selection with human CD14 microbeads (Miltenyi). Monocytes were cultured in RPMI 1640 (Sigma) containing 10% inactivated fetal bovine serum and 1 mM glutamine (Hyclone, Logan, UT).
  • the monocytes were cultured at 1.10 6 /ml then treated with siRNAs at 160nM, which target the mRNA coding for the PDK1 kinase (siPDKI) (Dharmacon), or with control siRNAs (siCTL) at 160nM (Qiagen) coupled to a transfection agent for 24 h.
  • siRNAs at 160nM, which target the mRNA coding for the PDK1 kinase (siPDKI) (Dharmacon), or with control siRNAs (siCTL) at 160nM (Qiagen) coupled to a transfection agent for 24 h.
  • the cells were incubated with the compounds of formula (V) and (VI) at 20 ⁇ M for 1 hour before stimulation with the TLR7/8 agonist, R848 at 1 ⁇ g/ml.
  • the monocytes were analyzed by flow cytometry.
  • Brefeldin A (BFA) was added to cells 30 minutes after R848 stimulation.
  • Flow cytometry For intracellular labeling of TNF ⁇ , Brefeldin A (BFA) was added to cells 30 minutes after R848 stimulation.
  • the cells were rinsed in PBS then incubated with a viability marker (Zombie Aqua, Biolegend) for 30 min at room temperature. After washing, the cells were resuspended in PBS containing 2% FCS and 2 mM EDTA and then labeled with the anti-CD14 antibody (clone REA599) from Miltenyi Biotec, used at 1/100°.
  • the “Inside Stain” kit (Miltenyi Biotec) was used according to the manufacturer's protocol.
  • the cells were fixed for 20 min at room temperature with 250 pL of the Inside Fix solution then labeled in 100 pL of the Inside Perm solution containing the anti-TNFa antibody (clone cA2, Milteniy Bioec) at 1/50° for 30 min at room temperature.
  • Data acquisition was performed on the Canto II flow cytometer using Diva software (BD Biosciences, San Jose, CA). FlowJo software was used to analyze the data.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

La présente invention concerne un inhibiteur de l'interaction entre les protéines kinases ROCK et PDK1. La présente invention concerne également une composition pharmaceutique comprenant au moins un inhibiteur de l'interaction entre les protéines kinases ROCK et PDK1 comme principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable. La présente invention concerne également l'utilisation de ladite une composition pharmaceutique dans la prévention et/ou le traitement des maladies inflammatoires, des infections virales et/ou bactériennes et des maladies auto-immunes.

Description

DESCRIPTION
TITRE : Inhibiteurs de l’interaction entre les protéines kinases ROCK et PDK1
Domaine technique
La présente invention concerne des inhibiteurs de l’interaction entre les protéines kinases ROCK et PDK1 et leurs utilisations en tant qu’agents anti-inflammatoire et anti-interféron. La présente invention concerne également une composition pharmaceutique comprenant un inhibiteur de l’interaction entre les protéines kinases ROCK et PDK1 et son utilisation dans la prévention et/ou le traitement des maladies inflammatoires, des infections virales et/ou bactériennes et des maladies auto-immunes.
Art antérieur
L’inflammation est un processus physiologique bénéfique pour l’organisme dans la mesure où elle est transitoire. Elle permet par exemple de lutter contre les infections bactériennes ou virales. Néanmoins, de nombreuses pathologies affectant plusieurs organes tels que l’intestin, le système nerveux central, l’appareil ostéo-articulaire, la peau, les poumons... sont associées à une inflammation chronique des tissus. L’inflammation chronique altère l’homéostasie des tissus, conduisant à des anomalies fonctionnelles comme des troubles de la digestion, l’amplification de maladies neurologiques ou neurodégénératives, un handicap moteur, des lésions cutanées, une insuffisance respiratoire... L’inflammation chronique des tissus résulte de la production continue de cytokines inflammatoires (TNFa, interleukines, interférons) par les cellules de l’immunité ou cellules apparentées (cellules de la microglie dans le système nerveux central) qui mène à la détérioration des cellules sensibles aux facteurs inflammatoires. Très peu de médicaments (stéroïdiens et non-stéroïdiens) permettent actuellement de contenir la réponse inflammatoire (aspirine, ibuprofène, paracétamol, corticoïdes) dont certains génèrent des effets secondaires non négligeables chez l’homme.
Par conséquent, il apparaît nécessaire de disposer de nouveaux composés capables de contenir la réponse inflammatoire, notamment en empêchant ou bloquant la synthèse des cytokines inflammatoires, directement dans les cellules immunitaires, afin de prévenir et /ou traiter les maladies inflammatoires, les infections virales et/ou bactériennes et les maladies auto-immunes, tout en diminuant les risques d’effets secondaires, lorsqu'elles sont administrées au patient.
Résumé de l’invention La présente invention a pour objet un composé de formule (I) : ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1 , dans lequel :
- m est choisi parmi 0, 1 et 2,
- n est choisi parmi 0, 1 et 2,
- Ri représente un groupe -COR2, où R2 est choisi dans le groupe constitué par un groupe - OH, un groupe -NH2, un groupe alcoxy, un groupe alkylamine, un groupe arylalkylamine, un groupe -NH-NH2, et un groupe -CH2-Ar substitué ou non substitué par au moins un atome d’halogène, où Ar représente un groupe aryle,
- R3 représente un atome d’azote, un groupe -NHCOR7, un groupe -NHCOORs, ou un groupe -COSRg, où R7, Rs et Rg sont des groupes alkyle en Ci à Ce substitués ou non substitués par au moins un atome d’halogène,
- R4 représente un atome d’azote ou un groupe -NH2,
- R5 et Re, identiques ou différents, sont choisi indépendamment l’un de l’autre dans le groupe constitué par un hydrogène, un groupe -OH, un groupe -NH, un groupe -NH2, un groupe alcoxy, un groupe thiol, un groupe sulfonamide, un groupe alkylamine et un groupe aryle substitué ou non substitué par au moins par un halogène, et dans lequel : z
- les lignes -= et identiques ou différents, représentent indépendamment l’une de l’autre, une liaison covalente simple ou une liaison covalente triple.
De manière tout à fait surprenante, les inventeurs ont montré que les composés de formule (I) sont capables de se lier à la zone d’interaction entre les protéines kinases ROCK et PDK1, en particulier sur un domaine protéique spécifique de la protéine kinase ROCK, avantageusement sur un domaine protéique spécifique de la protéine kinase ROCK1. En se liant à cette zone d’interaction spécifique, les composés de formule (I) selon la présente invention sont capables d’empêcher et/ou d’inhiber et/ou de bloquer la production et/ou la sécrétion par les cellules immunitaires des cytokines inflammatoires, tels que le facteur de nécrose tumoral alpha (TNFa), les interleukines IL-ip, IL-6, IL-10, IL-12p70, IL-18, IL-23, IL- 33 mais également les différents sous types d’interférons (IFN), tels que l’interféron alpha-2 (IFNa2), de l’interféron gamma (IFNy) et la protéine MCP1 , sans produire d’effets secondaires.
Le zone d’interaction spécifique entre les protéines kinases ROCK et PDK1 ciblée par les composés de formule (I) selon la présente invention concerne les acides aminés de la protéine kinase ROCK1 suivants : proline 21 à glutamate 24 (P21-E24), tryptophane 122 à valine 136 (W122-V136), alanine 188 à phénylalanine 194 (A188-F194), lysine 222 (K222) et arginine 404 à tyrosine 405 (R404-Y405), les positions des acides aminés étant établies au regard de la séquences d’acides aminés de la protéine kinase ROCK1 (SEQ ID No.11).
Les acides aminés suivants : lysine 222 (K222), phénylalanine 130 (F130), asparagine 132 (N 132), sérine 133 (S133), méthionine 192 (M192) et arginine 404 (R404) sont indispensables pour l’interaction avec les composés de formule (I) selon la présente invention sur le plan biologique, les positions des acides aminés étant établies au regard de la séquences d’acides aminés de la protéine kinase ROCK1 (SEQ ID No.11).
Séquence d’acides aminés de la protéine kinase ROCK1 : GSLHMSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDT INKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEE RDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVL ALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEV LKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDI SKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPWPDLSSDIDTSN FDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNR (SEQ ID No.11).
Ainsi, les inventeurs ont montrés que les composés de formule (I) de l’invention agissent comme des agents dissociant le complexe protéique ROCK /PDK1 ou empêchant sa formation dans les cellules immunitaires, en s’intercalant entre les protéines kinases ROCK et PDK1 au niveau de la surface de contact entre les deux protéines kinases, bloquant ainsi l’interaction entre les deux protéines kinases ROCK et PDK1. Les composés de formule (I) ont une action immunosuppressive à large spectre dans les cellules immunitaires, agissant à la fois comme un agent anti-inflammatoire et comme un agent anti-interféron, comme le montre les exemples de la présente demande.
La présente invention concerne également un composé de formule (I) pour son utilisation dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1 , ladite pathologie étant choisie parmi : les maladies inflammatoires, les infections virales, les infections bactériennes et les maladies auto-immunes.
La présente invention concerne également une composition pharmaceutique comprenant l’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable.
Avantageusement, la composition pharmaceutique comprend en outre au moins un second principe actif. Avantageusement, la composition pharmaceutique est adaptée pour une administration simultanée ou une administration séquentielle. Avantageusement, la composition pharmaceutique est sous une forme adaptée pour son administration par voie orale, parentérale ou topique.
La présente invention concerne également une composition pharmaceutique comprenant l’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable pour son utilisation dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’enzyme ROCK et/ou de l’enzyme PDK1.
La présente invention concerne également une composition pharmaceutique comprenant l’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable pour son utilisation dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1, ladite pathologie étant choisie parmi : les maladies inflammatoires, les infections virales, les infections bactériennes et les maladies auto-immunes.
Description détaillée
Au sens de la présente, on entend par «inhibiteur», un composé capable d’inhiber ou de bloquer ou de neutraliser l'expression de l'activité métabolique ciblée ; l'activité métabolique étant plus faible, voire nulle en présence de l’inhibiteur. Avantageusement, l’inhibiteur de l’interaction entre les protéines kinases ROCK et PDK1 est capable de bloquer l’interaction entre les deux protéines, soit en entrant en compétition avec l’une des protéines kinases, soit en bloquant l’une des protéines kinases, entrainant ainsi une diminution de l'expression de l'activité des protéines kinases ROCK et PDK1. Avantageusement, l’inhibiteur de l’interaction entre les protéines kinases ROCK et PDK1 est neutralisant. En particulier, il inhibe ou neutralise la fonction biologique d’une des protéines kinases ROCK ou PDK1 , ce qui a pour conséquence de protéger les cellules du stress inflammatoire. La capacité de neutralisation de l’inhibiteur peut être testée par un test standard, notamment en mesurant la capacité de l’inhibiteur à bloquer l’interaction entre les protéines kinases ROCK et PDK1 et réduire l’activité enzymatique des kinases ROCK et PDK1 (IC50). Avantageusement, l’inhibiteur présente une IC50 comprise entre 11nM et 30nM.
Avantageusement, l’inhibiteur de l’interaction entre les protéines kinases ROCK et PDK1 est un agent dissociant le complexe de protéines kinases ROCK-PDK1 ou empêchant la formation du complexe de protéines kinases ROCK-PDK1.
Au sens de la présente, on entend par «agent dissociant le complexe de protéines kinases ROCK/PDK1 ou empêchant sa formation», un agent intercalant capable de dissocier le complexe de protéines kinases ROCK-PDK1 ou un agent intercalant capable d’empêcher la formation du complexe de protéines kinases ROCK/PDK1 , se fixant dans la zone d’interaction entre les protéines kinases ROCK et PDK1, ladite zone d’interaction étant différentes des sites actifs des protéines kinases ROCK et PDK1. En se fixant dans la zone d’interaction entre les protéines kinases ROCK et PDK1, l’agent dissociant provoque un clash stérique dans la cellule de l’immunité, séparant la protéine kinase ROCK de la protéine kinase PDK1 ou empêchant l’interaction de la protéine kinase ROCK avec la protéine kinase PDK1. Avantageusement, les composés de formule (I) selon l’invention sont des inhibiteurs de l’interaction entre les protéines kinases ROCK et PDK1 , en particulier les composés de formule (I) selon l’invention sont des agents dissociant le complexe de protéines kinases ROCK/PDK1.
Avantageusement, les inventeurs ont montré que l’inhibition de manière sélective de l’interaction entre les protéines kinases ROCK et PDK1 avec un des composés de formule (I) selon l’invention, permet de bloquer la sécrétion des cytokines inflammatoires, tels que le facteur de nécrose tumoral alpha (TNFa), les interleukines IL-1 p, IL-6, IL-10, IL-12p70, IL-18, IL-23, IL-33 mais également les différents sous types d’interférons (IFN), tels que l’interféron alpha-2 (IFNa2), de l’interféron gamma (IFNy) et la protéine MCP1 par les cellules immunitaires, montrant un effet bénéfique des composés de formule (I) selon l’invention vis- à-vis du stress inflammatoire sans impact sur la viabilité desdites cellules de l’immunité. Avantageusement, les composés de formule (I) selon l’invention inhibent la sécrétion de cytokines inflammatoires et des interférons par une cellule de l’immunité activée in vitro et ex-vivo, notamment lorsque les composés de formule (I) selon l’invention sont mis en contact avec des cellules de l’immunité. Au sens de la présente invention, on entend par « cellule de l’immunité » ou « cellule du système immunitaire » ou « cellule immunitaire », toute cellule du système immunitaire qui provient d'une cellule souche hématopoïétique dans la moelle osseuse.
Avantageusement, les cellules de l’immunité selon l’invention sont des cellules mononucléées du sang périphérique (PBMC). Le terme «cellules mononucléées du sang périphérique (PBMC)» se réfère à des cellules sanguines périphériques ayant un noyau rond. Ces cellules sanguines mononucléées recirculent entre les tissus et le sang et sont un élément essentiel du système immunitaire pour lutter contre les infections et s'adapter aux intrus. Il existe deux principaux types de cellules mononucléées : les cellules lymphocytaires et les cellules myéloïdes. La population lymphocytaire des PBMC se compose généralement de cellules T, de cellules B et de cellules NK. La population myéloïde des PBMC se compose de cellules dendritiques (myéloïdes et plasmacytoïdes) et de monocytes/macrophages. Les PBMC peuvent être isolées à partir d'échantillons de sang total par des procédés bien connus dans l'art (par exemple, gradient de Ficoll).
Avantageusement, la cellule de l’immunité est un lymphocyte T. Avantageusement, la cellule de l’immunité est un lymphocyte B.
Au sens de la présente invention, les termes «lymphocyte T» et «cellule T» sont utilisés de manière interchangeable et se réfèrent à un type principal de globules blancs, qui achève sa maturation dans le thymus et qui joue divers rôles dans le système immunitaire, y compris l'identification antigènes étrangers spécifiques dans le corps et l'activation et/ou la désactivation d'autres cellules immunitaires. Le lymphocyte T peut être n'importe quelle cellule T choisie parmi : une cellule T cultivée, par exemple, une cellule T primaire, ou une cellule T d'une lignée cellulaire T cultivée, par exemple Jurkat, SupTI, etc., ou une cellule T obtenue à partir d'un mammifère. Les cellules T peuvent être des cellules CD3 +. La cellule T peut être n'importe quel type de cellule T et peut être à n'importe quel stade de développement, y compris, mais sans s'y limiter, les cellules T CD4 +/CD8 + doublement positives, les cellules T auxiliaires CD4 + (par exemple, les cellules Thl et Th2), les cellules T CD8 + (par exemple , cellules T cytotoxiques), une cellule T présente parmi les cellules mononucléées du sang périphérique (PBMC), les leucocytes du sang périphérique (PBL), une cellule T faisant partie des lymphocytes infiltrant la tumeur (TIL), les cellules T mémoire, les cellules T naïves, les cellules T régulatrices, les cellules T gamma delta (cellules Tyô). Des types supplémentaires de cellules T auxiliaires comprennent des cellules telles que les cellules Th3, Thl7, Th9 ou Tfh. Des types supplémentaires de cellules T à mémoire comprennent des cellules telles que les cellules T à mémoire centrale (cellules Tcm), les cellules T à mémoire effectrice (cellules Tem et cellules TEMRA). La cellule T peut également désigner une cellule T génétiquement modifiée, telle qu'une cellule T modifiée pour exprimer un récepteur de cellule T (TCR) ou un récepteur d'antigène chimérique (CAR). La cellule T peut également être différenciée d'une cellule souche ou d'une cellule progénitrice.
Au sens de la présente invention, on entend par « cellule B » ou « cellule lymphocytaire B » ou « lymphocyte B », une cellule lymphocytaire qui est produite dans la moelle osseuse, produit des immunoglobulines et est impliquée dans la production d'anticorps lors la réponse immunitaire humorale. Le lymphocyte B peut être n’importe quelle cellule B, choisie parmi une cellule souche B, une cellule pro-B, une cellule pré-B, une cellule B naïve, une cellule B activée, une cellule GC B mémoire, une cellule plasmablastique tardive et une cellule à plasma.
Au sens de la présente invention, le terme «mise en contact», lorsqu’il est utilisé en référence à une action effectuée sur une cellule immunitaire, est utilisé de manière interchangeable pour désigner la culture, l'incubation ou l'exposition d'une cellule immunitaire avec un ou plusieurs des inhibiteurs de l’interaction entre les protéines kinases ROCK et PDK1 selon l’invention. Les cellules mises en contact avec un agent de stimulation, tel que le R848, le CpG-A, ou mises en contact avec un autre véhicule sont des exemples de cellules mise en contact
Au sens de la présente invention, une cellule «non mise en contact» ou « non traitée » est une cellule qui n'a pas été traitée, par exemple, cultivée, mise en contact ou incubée avec un ou plusieurs des inhibiteurs de l’interaction entre les protéines kinases ROCK et PDK1 selon l’invention.
Au sens de la présente invention, on entend par « synthèse de cytokines inflammatoires» ou « production de cytokines inflammatoires» ou « sécrétion de cytokines inflammatoires», la libération dans le milieu extérieur de cytokines inflammatoires par une cellule, avantageusement une cellule de l’immunité.
Au sens de la présente invention, on entend par «synthèse d’interféron» ou « production d’interféron» ou «sécrétion d’interféron», la libération dans le milieu extérieur d’interféron par une cellule, avantageusement une cellule de l’immunité.
Au sens de la présente invention, la « protéine kinase ROCK » est une sérine/thréonine kinase, appelée également RhoA-associated coiled-coil containing kinase or RhoA-Rho- associated kinase. Au sens de la présente invention, la protéine kinase ROCK peut être l’isoforme 1 , appelée ROCK1 ou l’isoforme 2, appelée ROCK2. Dans un mode de réalisation particulièrement avantageux de l’invention, la protéine kinase ROCK est la protéine kinase ROCK1. Au sens de la présente invention, on entend par « zone d’interaction entre les protéines kinases ROCK et PDK1 », une zone de liaison, différente du site catalytique (également appelé site actif) de chacune des protéines kinases ROCK et PDK1 , qui permet d’associer les kinases ROCK et PDK1 dans un même complexe protéique. Quatre sites d’interaction entre les protéines kinases ROCK1 et PDK1 ont été définis par modélisation. L’interaction entre ROCK1 et PDK1 repose sur des liaisons faibles de type hydrogène, électrostatique, etc. Avantageusement, il peut s’agir d’un site allostérique de la protéine kinase ROCK1 et/ou de la protéine kinase PDK1.
Le site d’interaction entre les protéines kinases ROCK et PDK1 ciblé par les composés de formule (I) selon la présente invention concerne les acides aminés de la protéine kinase ROCK1 suivants : résidus proline 21 à glutamate 24 (P21-E24), tryptophane 122 à valine 136 (W122-V136), alanine 188 à phénylalanine 194 (A188-F194), lysine 222 (K222) et arginine 404 à tyrosine 405 (R404-Y405), les positions des acides aminés étant établies au regard de la séquences d’acides aminés de la protéine kinase ROCK1 (SEQ ID No.11).
En d’autres termes, les composés de formule (I) selon la présente invention interagissent avec les acides aminés suivants : proline 21 à glutamate 24 (P21-E24), tryptophane 122 à valine 136 (W122-V136), alanine 188 à phénylalanine 194 (A188-F194), lysine 222 (K222) et arginine 404 à tyrosine 405 (R404-Y405) de la protéine kinase ROCK1 , les positions des acides aminés étant établies au regard de la séquences d’acides aminés de la protéine kinase ROCK1 (SEQ ID No.11).
Comme décrit ci-dessus, les composés selon l’invention correspondent à la formule générale (I) : dans lequel :
- m est choisi parmi 0, 1 et 2,
- n est choisi parmi 0, 1 et 2,
- Ri représente un groupe -COR2, où R2 est choisi dans le groupe constitué par un groupe - OH, un groupe -NH2, un groupe alcoxy, un groupe alkylamine, un groupe arylalkylamine, un groupe -NH-NH2, et un groupe -CH2-Ar substitué ou non substitué par au moins un atome d’halogène, où Ar représente un groupe aryle,
- R3 représente un atome d’azote, un groupe -NHCOR7, un groupe -NHCOORs, ou un groupe -COSRg, où R7, Rs et Rg sont des groupes alkyle en Ci à Ce substitués ou non substitués par au moins un atome d’halogène,
- R4 représente un atome d’azote ou un groupe -NH2,
- R5 et Re, identiques ou différents, sont choisi indépendamment l’un de l’autre dans le groupe constitué par un atome d’hydrogène, un groupe -OH, un groupe -NH2, un groupe alcoxy, un groupe thiol, un groupe sulfonamide, et un groupe alkylamine et un groupe aryle substitué ou non substitué par au moins par un atome d’halogène, et zz dans lequel les lignes et zz identiques ou différents, représentent indépendamment l’une de l’autre, une liaison covalente simple ou une liaison covalente triple, ou un sel pharmaceutiquement acceptable de celui-ci.
Le terme « pharmaceutiquement acceptable » signifie ce qui est utile dans la préparation d'une composition pharmaceutique généralement sûre, non toxique et ni biologiquement ni autrement indésirable et comprend ce qui est acceptable pour un usage pharmaceutique vétérinaire et humain.
Les composés de formule (I) selon l’invention peuvent être utilisés sous la forme d’un sel pharmaceutiquement acceptable et peuvent comprendre des sels, des hydrates et des solvates préparés selon des procédés classiques, bien connus de l’homme du métier. À titre d’exemples, on peut notamment citer les sels dérivés d’acides carboxyliques, tels que les carboxylate (COO-), mais également les sulfonates (-SO ), les phosphonates (POs2-), les ammoniums quaternaires (NR4+) ou les sulfonamines (SO2-NHs+). Avantageusement, les sels appropriés comprennent les sels d'addition d'acide pharmaceutiquement ou physiologiquement acceptables. Avantageusement, les sels appropriés comprennent des sels d’addition d’acide formés avec divers acides libres pharmaceutiquement ou physiologiquement acceptables. Des exemples d’acides peuvent comprendre, sans s'y limiter, l'acide chlorhydrique, l'acide bromique, l'acide sulfurique, l'acide phosphorique, l'acide citrique, l'acide acétique, l'acide lactique, l’acide tartrique, l’acide fumarique, l’acide formique, l’acide propionique, l’acide oxalique, l’acide trifluoroacétique, l’acide méthanesulfonique, l’acide benzènesulfonique, l’acide maléique, l’acide benzoïque, l’acide gluconique, l’acide glycolique, l’acide succinique, l’acide 4-morpholineéthanesulfonique, l’acide camphorsulfonique, l'acide nitrobenzènesulfonique, l'acide hydroxy-O-sulfonique, l'acide 4- toluènesulfonique, l'acide couteau ruktu, l'acide EMBO, l'acide glutamique, l'acide aspartique, etc.
De plus, des sels métalliques pharmaceutiquement acceptables peuvent être préparés en utilisant des bases. Par exemple, des sels de métaux alcalins ou de métaux alcalino-terreux peuvent être obtenus en dissolvant le composé dans un excès d'une solution d'hydroxyde de métal alcalin ou d'hydroxyde de métal alcalino-terreux, en filtrant les sels de composé non dissous et en évaporant et en séchant le filtrat. Ici, les sels de sodium, de potassium, de lithium, de césium, de magnésium ou de calcium sont des sels métalliques pharmaceutiquement appropriés, mais non limités à ceux-ci. De plus, des sels d'argent correspondant aux sels métalliques peuvent être obtenus en faisant réagir des métaux alcalins ou des métaux alcalino-terreux avec des sels d'argent appropriés (par exemple des nitrates). On peut également citer les ammoniums (NH4+) ou des amines sous forme ammonium telles que la diéthylamine (EDTA), la pyrrolidine, la pipéridine et la pyridine.
Au sens de la présente invention, on entend par « un atome d'halogène », un atome de fluor, de chlore, de brome ou d'iode. Les atomes d'halogène peuvent être plus particulièrement des atomes de fluor.
Au sens de la présente invention, on entend par « Ct -Cz », une chaîne carbonée contenant éventuellement de t à z atomes de carbone dans laquelle t et z peuvent prendre des valeurs de 1 à 10 ; par exemple, Ci-Ce est une chaîne carbonée contenant éventuellement de 1 à 6 atomes de carbone.
Au sens de la présente invention, on entend par « alkyle », un groupe aliphatique saturé linéaire ou ramifié, comprenant notamment de 1 à 6 atomes de carbone. A titre d'exemples, on peut citer le méthyle, l'éthyle, le n-propyle, l'isopropyle, le butyle, l'isobutyle, le tert-butyle, le pentyle, le néopentyle etc... Avantageusement, l’alkyle peut être substitué ou non par au moins un atome d’halogène, avantageusement au moins deux atomes d’halogène, avantageusement au moins trois atomes d’halogène, avantageusement au moins quatre atomes d’halogène. Dans un mode de réalisation particulier de l’invention, l’alkyle peut être substitué par au moins un atome de fluor, avantageusement au moins deux atomes de fluor, avantageusement au moins trois atomes de fluor, avantageusement au moins quatre atomes de fluor.
Au sens de la présente invention, on entend par « alcoxy », une chaîne hydrocarbonée linéaire ou ramifiée comprenant le nombre spécifié d'atomes de carbone, avantageusement entre 1 et 6 atomes de carbones, et un atome d'oxygène. A titre d’exemples, on peut notamment citer un groupe méthoxy, ou un groupe éthoxy, ou un groupe propoxy ou un groupe butoxy. Au sens de la présente invention, on entend par « alkylamine », une chaîne hydrocarbonée linéaire ou ramifiée comprenant le nombre spécifié d'atomes de carbone, avantageusement entre 1 et 6 atomes de carbones, et une amine primaire. A titre d’exemples, on peut notamment citer un groupe méthylamine, ou un groupe éthylamine, ou un groupe propylamine ou un groupe butylamine.
Au sens de la présente invention, on entend par « arylalkylamine » un groupe alkylamine substitué par un ou plusieurs groupes aryle, dans lequel le groupe aryle et le groupe alkylamine peuvent ou non être portés par le même atome de carbone. A titre d'exemples de groupe aryle, on peut citer le groupe le phénylméthylamine le phényléthylamine, le phénylpropylamine, le (p-tolyl)méthylamine, et similaires.
Au sens de la présente invention, on entend par «aryle », un groupe aromatique monocyclique ou bicyclique contenant entre 5 et 10 atomes de carbone, notamment entre 6 et 10 atomes de carbone. A titre d'exemples de groupe aryle, on peut citer le groupe phényle, tolyle, xylyle, mésityle ou naphtyle. Avantageusement, le groupe aryle est le phényle. Avantageusement, l’aryle peut être substitué ou non par au moins un atome d’halogène, avantageusement au moins deux atomes d’halogène, avantageusement au moins trois atomes d’halogène, avantageusement au moins quatre atomes d’halogène. Dans un mode de réalisation particulier de l’invention, l’aryle peut être substitué par au moins un atome de fluor, avantageusement au moins deux atomes de fluor, avantageusement au moins trois atomes de fluor, avantageusement au moins quatre atomes de fluor. Dans un autre mode de réalisation, les groupes aryles peuvent comprendre un ou plusieurs hétéroatomes, choisis parmi N, O et/ou S, avantageusement 1 à 4 hétéroatomes. A titre d'exemple de groupe aryle comprenant un ou plusieurs hétéroatomes, on peut notamment citer la pyridine, le furane, le thiophène, le pyrrole, le pyrrazole, l'imidazole, le thiazole, l'isoxazole, l'isothiazole, la pyridazine, la pyrimidine, la pyrazine, les triazines, l'indolizine, l'indole, l'isoindole, le benzofurane, le benzothiophène, l'indazole, le benzimidazole, le benzothiazole, la purine, la quinoline, l'isoquinoline, la cinnoline, la phtalazine, la quinazoline, la quinoxaline, la ptéridine, les naphthyridines, le carbazole, la phénothiazine, la phénoxazine, l'acridine, la phénazine, l'oxazole, le pyrazole, l'oxadiazole, le triazole, le thiadiazole et leurs dérivés insaturés. D'autres exemples sont les dérivés insaturés de la pyrrolidine, du dioxolane, de l'imidazolidine, de la pyrazolidine, de la pipéridine, du dioxane, de la morpholine, du dithiane, de la thiomorpholine, de la pipérazine et du trithiane.
Selon la présente invention, Ri représente un groupe -COR2, où R2est choisi dans le groupe constitué par un groupe -OH, un groupe -NH2, un groupe alcoxy, un groupe alkylamine, un groupe arylalkylamine, un groupe -NH-NH2, et un groupe -CH2-Ar substitué ou non substitué par au moins un atome d’halogène, où Ar représente un groupe aryle. Avantageusement le groupe aryle est un groupe phényle.
Avantageusement, R1 est choisi parmi : dans lequel W est un atome d’halogène identique ou différent, avantageusement choisi parmi un atome de fluor, de chlore, de brome ou d'iode, avantageusement un atome de fluor, ou un alkyle en Ci à Ce, dans lequel p est 0, 1 , 2, 3, 4 ou 5, et dans lequel q est 0, 1, 2, 3, 4, 5, 6 ou 7. Avantageusement, R1 est : , dans lequel p est 0.
Avantageusement, R1 est :
Avantageusement, R1 est :
Selon la présente invention, R3 représente un atome d’azote, un groupe -NHCOR7, , un groupe -NHCOORs, ou un groupe -COSRg, où R7, Rs et Rg sont des groupes alkyle en Ci à Ce substitués ou non substitués par au moins un atome d’halogène. Avantageusement, R3 représente un atome d’azote. Avantageusement, R3 représente un groupe -NHCOR7, où R7 est un groupe alkyle en Ci à Ce substitué ou non substitué par au moins un atome d’halogène.
Selon un mode de réalisation particulier de l’invention, R3 représente un atome d’azote, zz lorsque la liaison zz représente une liaison covalente triple. zz
Selon un mode de réalisation particulier de l’invention, lorsque la liaison zz représente une liaison covalente simple, R3 peut être choisi parmi un atome d’azote, un groupe -NHCOR7, un groupe -NHCOORs, ou un groupe -COSRg, où R7, Rs et Rg sont des groupes alkyle en Ci à Ce substitués ou non substitués par au moins un atome d’halogène. Avantageusement, le groupe -NHCOR7 est choisi parmi : dans lequel Z est un atome d’halogène, choisi parmi un atome de fluor, de chlore, de brome ou d'iode, avantageusement un atome de fluor, ou un groupe alkyle en Ci à Ce.
Selon la présente invention, R4 représente un atome d’azote ou un groupe -NH2.
Avantageusement, R4 représente un atome d’azote, lorsque la liaison représente une liaison covalente triple.
Avantageusement, R4 représente un groupe -NH2, lorsque la liaison représente une liaison covalente simple.
Selon la présente invention, R5 est choisi dans le groupe constitué par un atome d’hydrogène, un groupe -OH, un groupe -NH2, un groupe alcoxy, un groupe thiol, un groupe sulfonamide, un groupe alkylamine, et un groupe aryle substitué ou non substitué par au moins par un atome d’halogène. . Avantageusement, R5 est un groupe aryle substitué ou non substitué par au moins par un atome d’halogène, avantageusement un groupe phényle substitué ou non substitué par au moins par un atome d’halogène, avantageusement un groupe phényle non substitué.
Selon la présente invention, Re est choisi dans le groupe constitué par un atome d’hydrogène, un groupe -OH, un groupe -NH2, un groupe alcoxy, un groupe thiol, un groupe sulfonamide, un groupe alkylamine, et un groupe aryle substitué ou non substitué par au moins par un atome d’halogène. Avantageusement, Re est un groupe alcoxy, de manière encore plus avantageuse, Re est un groupe méthoxy. Dans un mode de réalisation particulier de l’invention, le groupe Re peut être en position 3, 4 ou 5 sur le cycle.
Dans un mode de réalisation particulier de l’invention, les composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci, comprennent des ZZ composés, dans lequel m est 0 et n est 0 et dans lequel les liaisons et zz représentent une liaison covalente triple. Avantageusement, les composés de formule z générale (I) dans lequel m est 0 et n est 0 et dans lequel les liaisons -= et zz représentent une liaison covalente triple sont représentés par le sous-groupe de composés de formule (II) ou un sel pharmaceutiquement acceptable de celui-ci, dans lequel R3, R4 et Re sont tels que défini dans la formule (I).
A titre d’exemples de composés de formule (II), on peut notamment citer les composés :
(VI).
Dans un autre mode de réalisation particulier de l’invention, les composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci, comprennent des zz ✓✓ composés dans lequel m est 1 et n est 1 et dans lequel les liaisons et zz représentent une liaison covalente simple.
Avantageusement, les composés de formule générale (I) dans lequel m est 1 et n est 1 et zz ✓✓ dans lequel les liaisons et zz représentent une liaison covalente simple sont représentés par le sous-groupe de composés de formule (III) ou un sel pharmaceutiquement acceptable de celui-ci, dans lequel R3, R4, Rs et Re sont tels que défini dans la formule (I).
A titre d’exemples de composés de formule (III), on peut notamment citer les composés :
(VII) et
Dans un autre mode de réalisation particulier de l’invention, les composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci, comprennent des Z zz composes dans lequel m est 1 et n est 1 et dans lequel les liaisons -= et zz représentent une liaison covalente simple.
Avantageusement, les composés de formule générale (I) dans lequel m est 0 et n est 1 et dans lequel les liaisons et zz représentent une liaison covalente simple sont représentés par le sous-groupe de composés de formule (IV) ou un sel pharmaceutiquement acceptable de celui-ci,
(IV), dans lequel Ri, R3, R4 et Re sont tels que défini dans la formule (I). A titre d’exemples de composés de formule (IV), on peut notamment citer les composés :
Dans un mode de réalisation particulièrement avantageux de l’invention, les composés de formule générale (I) sont choisis parmi :
(VI) ;
(IX).
Avantageusement, les inventeurs ont montré que l’incubation de cellules mononucléées du sang périphérique humain avec un composé de formule (I) et en particulier avec le composé de formule (V), avant d’être stimulées avec un agoniste (R848) des récepteurs Toll-Like (TLR) 7/8 pour mimer une infection par un virus à ARN simple brin, inhibe la production de cytokines pro-inflammatoire, telles que IL-1 p, IL-6, IL-10, IL-12p70, IL-18, IL-23, IL-33, TNFa et la protéine NF-KB , mais également les différents sous types d’interférons (IFN), tels que l’interféron alpha-2 (IFNa2), de l’interféron gamma (IFNy), ainsi que la protéine MCP1, induite par la stimulation TLR7/8.
Avantageusement, les inventeurs ont également montré que l’incubation de cellules mononucléées du sang périphérique humain avec un composé de formule (I) et en particulier avec le composé de formule (VI), avant d’être stimulées avec un agoniste (R848) des récepteurs Toll-Like (TLR) 7/8 pour mimer une infection par un virus à ARN simple brin, inhibe la production de cytokines pro-inflammatoire, telles que I L-1 p, IL-6, IL-10, I L-12p70, IL-18, IL-23, IL-33, TNFa et la protéine NF-KB , mais également les différents sous types d’interférons (IFN), tels que l’interféron alpha-2 (IFNa2), de l’interféron gamma (IFNy), ainsi que la protéine MCP1 , induite par la stimulation TLR7/8.
Avantageusement, les inventeurs ont également montré que l’incubation de cellules mononucléées du sang périphérique humain avec un composé de formule (I) et en particulier avec les composés de formule (VII), de formule (VIII) et de formule (IX), avant d’être stimulées avec un agoniste (R848) des récepteurs Toll-Like (TLR) 7/8 pour mimer une infection par un virus à ARN simple brin, inhibe la production d’interférons (IFN), induite par la stimulation TLR7/8.
Avantageusement, les inventeurs ont également montré que l’incubation de cellules mononucléées du sang périphérique humain avec un composé de formule (I) et en particulier avec le composé de formule (V) ou le composé de formule (VI), avant d’être stimulées avec un agoniste (LPS) des récepteurs Toll-Like Récepteurs (TLR) 4 pour mimer une infection bactérienne, inhibe la production de TNFa induite par la stimulation TLR4, mais également la sécrétion de cytokines pro-inflammatoires sur des cellules mononuclées du sang périphérique humain, telles que IL-6, I L-1 p, IL18, IL23, MCP1 et les interférons , en particulier l’interféron gamma (IFNy ) induite par la stimulation des TLR4 par le lipopolysaccharide (LPS), le LPS étant un agent bactérien inducteur d’une réponse inflammatoire.
Avantageusement, les inventeurs ont également montré que les composés de formule (V) à (VIII) sont capables de bloquer l’activation des lymphocytes B de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR 9.
Avantageusement, les inventeurs ont également montré que les composés de formule (V) et (VI) sont capables :
- de bloquer, de manière préventive, la production de TNFa sur des monocytes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, d’être stimulées avec un agoniste (R848) des récepteurs Toll-Like (TLR) 7/8 pour mimer une infection par un virus à ARN simple brin;
- de bloquer, de manière préventive, la production de TNFa sur des monocytes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, d’être stimulées avec un agoniste (LPS) des récepteurs Toll-Like (TLR) 4 pour mimer une infection bactérienne à gram négatif;
- de bloquer, de manière préventive, la production de TNFa sur des monocytes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, d’être stimulées avec un agoniste (LTA : acide lipotéichoïque ) des récepteurs Toll-Like (TLR) 2 pour mimer une infection bactérienne à gram positif ;
- de bloquer, de manière préventive, la production de TNFa sur des cellules dentritiques plasmacytoïdes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, d’être stimulées avec un activateur (R848) des récepteurs Toll-Like (TLR) 7/8 pour mimer une infection par un virus à ARN simple brin;
- de bloquer, de manière préventive, la production de TNFa sur des cellules dentritiques plasmacytoïdes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, d’être stimulées avec un agoniste (CpG-A) des récepteurs Toll-Like (TLR) 9 capables de reconnaître de l’ADN viral ou bactérien riche en motif CpG.
Ainsi, les inventeurs ont montré de manière tout à fait surprenante que l’utilisation d’un composé de formule (I) a un effet préventif sur l’inhibition de la production de cytokines inflammatoires induite par la stimulation de TLR2 ou TLR4 ou TLR7/8 ou TRL9 quel que soit la cellule de l’immunité.
Ainsi, les inventeurs ont montré de manière tout à fait surprenante que l’utilisation d’un composé de formule (I) a un effet curatif sur la production d’interféron induite par la stimulation de TLR2 ou TLR4 ou TLR7/8 ou TRL9 quel que soit la cellule de l’immunité.
Le composé de formule (I) préféré est l’un des composés mentionnés dans le tableau 1 ci- dessous.
Tableau 1 :
Avantageusement, le composé de formule (I) est choisi parmi : 2-[(3- methoxyphenyl)hydrazinylidene]propanedinitrile ; 2-[(4- methoxyphenyl)hydrazinylidene]propanedinitrile ; 7-amino-N-benzyl-2-(3-methoxyphenyl) -5- phenyl -2H-pyrazolo[4,3-b]pyridine-3-carboxamide ; 7-amino-2-(3-methoxyphenyl)-5-phenyl- 2H-pyrazolo[4,3-b]pyridine-3-carbohydrazide et methyl 3-cyano-1-(3-methoxyphenyl)-4- (2,2,2-trifluoroacetamido)-1 H-pyrazole-5-carboxylate
Un autre aspect de la présente invention concerne un composé de formule (I) pour son utilisation en tant que médicament, en particulier un médicament destiné à bloquer et/ou inhiber l’interaction entre les protéines kinases ROCK et PDK1. Avantageusement, le composé de formule (I) est capable de s’intercaler au niveau de la zone d’interaction entre les deux protéines kinases ROCK et PDK1 , entrainant ainsi soit une dissociation du complexe de protéines kinases ROCK/PDK1, soit empêchant la-formation du complexe de protéines kinases ROCK et PDK1. Avantageusement, les composés de formule (I) selon l’invention sont des agents dissociant le complexe de protéines kinases ROCK et PDK1. Avantageusement, les composés de formule (I) selon l’invention sont des agents empêchant la formation du complexe de protéines kinases ROCK et PDK1.
Selon un mode de réalisation particulier, les composés de formule (I) selon l’invention sont des agents anti-inflammatoires et anti-interférons.
Au sens de la présente invention, on entend par « agent anti-inflammatoire et anti-interféron », un agent capable d’empêcher et/ou de bloquer et/ou d’inhiber la synthèse des cytokines inflammatoires et des interférons et en particulier un agent capable d’empêcher et/ou de bloquer et/ou d’inhiber la sécrétion d’au moins une cytokine inflammatoire, tels que le facteur de nécrose tumoral alpha (TNFa), les interleukines I L-1 p, IL-6, IL-10, I L-12p70, IL-18, IL-23, IL-33 et la protéine MCP1, mais également au moins un sous types d’interférons (IFN), tels que l’interféron alpha-2 (IFNa2), de l’interféron gamma (IFNy) par une cellule de l’immunité, lorsque ledit agent est mis en contact avec une cellule de l’immunité.
Avantageusement, les composés de formule (I) peuvent être utilisés dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1.
En d’autres termes, la présente invention concerne l’utilisation d’un composé de formule (I) pour la préparation d’un médicament, en particulier un médicament destiné à bloquer et/ou inhiber l’interaction entre les protéines kinases ROCK et PDK1.
En d’autres termes, la présente invention concerne la préparation d’un médicament comprenant un composé de formule (I) pour bloquer et/ou inhiber l’interaction entre les protéines kinases ROCK et PDK1.
Avantageusement, ledit médicament peut être utilisé dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1.
Avantageusement, le composé de formule (I) est particulièrement efficace dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1. Avantageusement, le composé de formule (I) est particulièrement efficace dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1 choisie parmi les maladies inflammatoires, les infections virales, les infections bactériennes et les maladies auto-immunes.
Un autre aspect de la présente invention concerne une composition pharmaceutique comprenant au moins un composé de formule (I) tel que décrit précédemment ou un sel pharmaceutique acceptable de celui-ci, comme principe actif et au moins un excipient pharmaceutiquement acceptable et/ou un support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable. Avantageusement, au moins un composé de formule (I) est un agent dissociant le complexe de protéines kinases ROCK/PDK1.
Avantageusement, la composition pharmaceutique comprenant au moins un composé de formule (I) tel que décrit précédemment ou un sel pharmaceutique acceptable de celui-ci, comme principe actif et au moins un excipient pharmaceutiquement acceptable et/ou un support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable, est particulièrement efficace dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1. Avantageusement, ladite composition pharmaceutique est particulièrement efficace dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1 choisie parmi les maladies inflammatoires, les infections virales, les infections bactériennes et les maladies auto-immunes.
Dans un mode de réalisation particulier, la composition pharmaceutique comprend au moins un composé de formule (I) tel que décrit précédemment ou un sel pharmaceutique acceptable de celui-ci, comme principe actif et au moins un excipient pharmaceutiquement acceptable et/ou un support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable. Avantageusement, la composition pharmaceutique selon l’invention peut comprendre une combinaison d’au moins deux composés de formule (I) différents, avantageusement au moins trois composés de formule (I) différents, avantageusement au moins quatre composés de formule (I) différents, avantageusement au moins cinq composés de formule (I) différents, avantageusement au moins six composés de formule (I) différents, ou plus.
Dans un mode de réalisation particulier, l’invention concerne une composition pharmaceutique comprenant une quantité pharmaceutiquement active d’au moins un composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci tel que décrit précédemment et au moins un excipient pharmaceutiquement acceptable et/ou un support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable. Avantageusement, la composition pharmaceutique selon l’invention peut comprendre une combinaison d’au moins deux composés de formule (I) différents, avantageusement au moins trois composés de formule (I) différents, avantageusement au moins quatre composés de formule (I) différents, avantageusement au moins cinq composés de formule (I) différents, avantageusement au moins six composés de formule (I) différents, ou plus.
Dans un mode de réalisation selon l’invention, le patient peut être un humain. Dans un autre mode de réalisation de l’invention, le patient peut être un animal non-humain, en particulier un chien, un chat, un cheval, une vache, un cochon, un mouton, une chèvre, un cervidé ou un primate.
Selon des modes de réalisation qui impliquent l'administration à un patient nécessitant un traitement, une quantité thérapeutiquement efficace d’au moins un composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention, telle que définie ici, "thérapeutiquement efficace" ou "une quantité efficace pour traiter" ou "efficace sur le plan pharmaceutique", la quantité composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci ou d'une composition nécessaire pour inhiber ou inverser une maladie (par exemple, pour traiter l’inflammation, des infections virales et des maladies auto-immunes). La détermination d'une quantité thérapeutiquement efficace dépend spécifiquement de facteurs tels que la toxicité et l'efficacité du médicament. Ces facteurs différeront en fonction d'autres facteurs tels que la puissance, la biodisponibilité relative, le poids corporel du patient, la gravité des effets indésirables et le mode d'administration préféré. La toxicité peut être déterminée en utilisant des procédés bien connus dans la technique. L'efficacité peut être déterminée en utilisant les mêmes indications. L'efficacité peut être mesurée par une diminution de l’inflammation ou de l’infection, par exemple dans un modèle d’arthrite juvénile idiopathique. Une quantité pharmaceutiquement efficace est donc une quantité que le clinicien considère comme tolérable sur le plan toxicologique, mais efficace.
Le dosage peut être ajusté de manière appropriée pour obtenir le médicament souhaité (par exemple, un inhibiteur de l’interaction entre les protéines kinases ROCK et PDK1 de l'invention) à des niveaux locaux ou systémiques, en fonction du mode d'administration. Dans le cas où la réponse chez un patient est insuffisante à de telles doses, des doses encore plus élevées (ou des doses efficaces plus élevées par une voie d'administration différente et plus localisée) peuvent être utilisées dans la mesure où la tolérance du patient le permet. Des doses multiples par jour peuvent également être utilisées pour atteindre des taux systémiques appropriés de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention. Des niveaux systémiques appropriés peuvent être déterminés, par exemple, par la mesure du taux plasmatique maximal ou prolongé du patient. "Dose" et "dosage" sont utilisés ici de manière interchangeable.
Dans un mode de réalisation avantageux de l’invention, la quantité de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention ou de composition pharmaceutique comprenant au moins un composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administrée à un patient est de 0,5 mg à 30 mg par kg de poids corporel, en fonction de l'intensité de l’inflammation. Avantageusement, la quantité de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention ou de composition pharmaceutique comprenant au moins un composé de formule (l)ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administrée à un patient est de 1,0 mg, avantageusement de 1,5 mg, avantageusement de 2,0 mg, avantageusement de 2,5 mg, avantageusement de 3,0 mg, avantageusement de 3,5 mg, avantageusement de 4,0 mg, avantageusement de 4,5 mg, avantageusement de 5,0 mg, avantageusement de 5,5 mg, avantageusement de 6,0 mg, avantageusement de 6,5 mg, avantageusement de 7,0 mg, avantageusement de 7,5 mg, avantageusement de 8,0 mg, avantageusement de 8,5 mg, avantageusement de 9,0 mg, avantageusement de 9,5 mg, avantageusement de 10,0 mg, avantageusement de 10,5 mg, avantageusement de 11 ,0 mg, avantageusement de 11,5 mg, avantageusement de 12,0 mg, avantageusement de 12,5 mg, avantageusement de 13,0 mg, avantageusement de 13,5 mg, avantageusement de 14,0 mg, avantageusement de 14,5 mg, avantageusement de 15,0 mg, avantageusement de 15,5 mg, avantageusement de 16,0 mg, avantageusement de 16,5 mg, avantageusement de 17,0 mg, avantageusement de 17,5 mg, avantageusement de 18,0 mg, avantageusement de 18,5 mg, avantageusement de 19,0 mg, avantageusement de 19,5 mg, avantageusement de 20,0 mg, avantageusement de 20,5 mg, avantageusement de 21 ,0 mg, avantageusement de 21 ,5 mg, avantageusement de 22,0 mg, avantageusement de 22,5 mg, avantageusement de 23,0 mg, avantageusement de 23,5 mg, avantageusement de 24,0 mg, avantageusement de 24,5 mg, avantageusement de 25,0 mg, avantageusement de 25,5 mg, avantageusement de 26,0 mg, avantageusement de 26,5 mg, avantageusement de 27,0 mg, avantageusement de 27,5 mg, avantageusement de 28,0 mg, avantageusement de 28,5 mg, avantageusement de 29,0 mg, avantageusement de 29,5 mg, avantageusement de 30,0 mg par kg de poids corporel, en fonction de l'intensité de l’inflammation.
Avantageusement, la quantité de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention ou de composition pharmaceutique comprenant au moins un composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administrée à un patient est comprise entre 0,5 mg à 30,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 29,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 28,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 27,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 26,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 25,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 24,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 23,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 22,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 21 mg par kg de poids corporel, avantageusement entre 0,5 mg et 20,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 19,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 18,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 17,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 16,0 mg par kg de poids corporel avantageusement entre 0,5 mg et 15,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 14,0 mg par kg de poids corporel avantageusement entre 0,5 mg et 13,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 12,0 mg par kg de poids corporel avantageusement entre 0,5 mg et 11 ,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 10,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 9,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 8,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 7,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 6,0 mg par kg de poids corporel, avantageusement entre 1,0 mg et 6,0 mg par kg de poids corporel, avantageusement entre 1,5 mg et 6,0 mg par kg de poids corporel, avantageusement entre 1 ,5 mg et 5,5 mg par kg de poids corporel, avantageusement entre 2,0 mg et 5,0 mg par kg de poids corporel, en fonction de l'intensité de l’inflammation.
Dans un mode de réalisation avantageux de l’invention, la quantité de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention ou de composition pharmaceutique comprenant au moins un composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administrée à un patient est de 0,5 mg à 30 mg par kg de poids corporel, en fonction de l'intensité de l’infection. Avantageusement, la quantité de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention ou de composition pharmaceutique comprenant au moins un composé de formule (l)ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administrée à un patient est de 1,0 mg, avantageusement de 1,5 mg, avantageusement de 2,0 mg, avantageusement de 2,5 mg, avantageusement de 3,0 mg, avantageusement de 3,5 mg, avantageusement de 4,0 mg, avantageusement de 4,5 mg, avantageusement de 5,0 mg, avantageusement de 5,5 mg, avantageusement de 6,0 mg, avantageusement de 6,5 mg, avantageusement de 7,0 mg, avantageusement de 7,5 mg, avantageusement de 8,0 mg, avantageusement de 8,5 mg, avantageusement de 9,0 mg, avantageusement de 9,5 mg, avantageusement de 10,0 mg, avantageusement de 10,5 mg, avantageusement de 11 ,0 mg, avantageusement de 11 ,5 mg, avantageusement de 12,0 mg, avantageusement de 12,5 mg, avantageusement de 13,0 mg, avantageusement de 13,5 mg, avantageusement de 14,0 mg, avantageusement de 14,5 mg, avantageusement de 15,0 mg, avantageusement de 15,5 mg, avantageusement de 16,0 mg, avantageusement de 16,5 mg, avantageusement de 17,0 mg, avantageusement de 17,5 mg, avantageusement de 18,0 mg, avantageusement de 18,5 mg, avantageusement de 19,0 mg, avantageusement de 19,5 mg, avantageusement de 20,0 mg, avantageusement de 20,5 mg, avantageusement de 21 ,0 mg, avantageusement de 21 ,5 mg, avantageusement de 22,0 mg, avantageusement de 22,5 mg, avantageusement de 23,0 mg, avantageusement de 23,5 mg, avantageusement de 24,0 mg, avantageusement de 24,5 mg, avantageusement de 25,0 mg, avantageusement de 25,5 mg, avantageusement de 26,0 mg, avantageusement de 26,5 mg, avantageusement de 27,0 mg, avantageusement de 27,5 mg, avantageusement de 28,0 mg, avantageusement de 28,5 mg, avantageusement de 29,0 mg, avantageusement de 29,5 mg, avantageusement de 30,0 mg par kg de poids corporel, en fonction de l'intensité de l’infection.
Avantageusement, la quantité de composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention ou de composition pharmaceutique comprenant au moins un composé de formule (l)ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administrée à un patient est comprise entre 0,5 mg à 30,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 29,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 28,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 27,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 26,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 25,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 24,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 23,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 22,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 21 mg par kg de poids corporel, avantageusement entre 0,5 mg et 20,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 19,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 18,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 17,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 16,0 mg par kg de poids corporel avantageusement entre 0,5 mg et 15,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 14,0 mg par kg de poids corporel avantageusement entre 0,5 mg et 13,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 12,0 mg par kg de poids corporel avantageusement entre 0,5 mg et 11 ,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 10,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 9,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 8,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 7,0 mg par kg de poids corporel, avantageusement entre 0,5 mg et 6,0 mg par kg de poids corporel, avantageusement entre 1,0 mg et 6,0 mg par kg de poids corporel, avantageusement entre 1 ,5 mg et 6,0 mg par kg de poids corporel, avantageusement entre 1 ,5 mg et 5,5 mg par kg de poids corporel, avantageusement entre 2,0 mg et 5,0 mg par kg de poids corporel, en fonction de l'intensité de l’infection.
Bien entendu, cette dose unitaire peut être répétée si nécessaire.
Dans un mode de réalisation avantageux, le composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administré au patient à raison de 100 mg à 500 mg par jour. Avantageusement, le composé de formule (l)ou un sel pharmaceutique acceptable de celui-ci en tant que principe actif administré au patient à raison de 100 mg à 450 mg par jour, avantageusement à raison de 100 mg à 400 mg par jour, avantageusement à raison de 100 mg à 350 mg par jour, avantageusement à raison de 100 mg à 300 mg par jour, avantageusement à raison de 100 mg à 250 mg par jour, avantageusement à raison de 100 mg à 200 mg par jour, avantageusement à raison de 100 mg à 150 mg par jour, avantageusement à raison de 140 mg par jour. Bien entendu, cette dose unitaire peut être répétée si nécessaire. Dans un mode de réalisation avantageux, la composition pharmaceutique selon l’invention est administrée au patient à raison d’une, deux, trois, quatre, cinq, six ou sept fois par semaine.
Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison de sept fois par semaine, soit une administration par jour pendant sept jours consécutifs. Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison de six fois par semaine. Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison de cinq fois par semaine. Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison de quatre fois par semaine. Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison de trois fois par semaine. Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison de deux fois par semaine. Avantageusement, la composition pharmaceutique selon l’invention est administrée au patient à raison d’une fois par semaine.
Dans un mode de réalisation avantageux de l’invention, les compositions pharmaceutiques fournies sont utilisées pour des applications in vivo. En fonction du mode d'administration prévu in vivo, les compositions pharmaceutiques utilisées peuvent être sous la forme posologique solide, semi-solide ou liquide telle que, par exemple, comprimés, pilules, poudres, capsules, gels, pommades, liquides, suspensions. De préférence, les compositions pharmaceutiques sont administrées sous des formes posologiques unitaires appropriées pour une administration unique de doses précises. Les compositions pharmaceutiques peuvent également comprendre, en fonction de la formulation souhaitée, au moins un support ou diluant pharmaceutiquement acceptable, qui sont définis comme des véhicules à base aqueuse couramment utilisés pour formuler des compositions pharmaceutiques pour une administration animale ou humaine. Le diluant est choisi de manière à ne pas affecter l'activité biologique du composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon l’invention. Des exemples de tels diluants sont l'eau distillée, le sérum physiologique, la solution de Ringer, la solution de dextrose et la solution de Hank. De plus, la composition pharmaceutique peut également comprendre d'autres agents médicinaux, agents pharmaceutiques, supports, adjuvants, stabilisants non toxiques, non thérapeutiques, non immunogènes, etc. Des quantités efficaces d'un tel diluant ou véhicule sont des quantités efficaces pour obtenir une solution pharmaceutiquement acceptable en termes de formulation, solubilité des composants, activité biologique, etc. Dans certains modes de réalisation, les compositions pharmaceutiques fournies ici sont stériles. On peut envisager de formuler au moins un le composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci selon la présente invention à raison de 0,5 à 98% en poids, exprimé en poids, voire plus, par rapport au poids total de la composition pharmaceutique considérée.
Dans un mode de réalisation particulièrement avantageux de la présente invention, la composition pharmaceutique selon l'invention comprend uniquement au moins un le composé de formule (I) ou un sel pharmaceutique acceptable de celui-ci, en tant que principe actif unique.
Dans un mode de réalisation particulier de l’invention, le composé de formule générale (I) de la composition pharmaceutique est choisi parmi les composés de formule (V) à (IX) :
(VI) ;
(IX) ; ou un de leurs sels pharmaceutique acceptables.
Dans un mode de réalisation particulièrement avantageux de l’invention, la composition pharmaceutique comprend le composé de formule (I) tel que défini précédemment, en tant que principe actif unique
(I), dans lequel m , n, Ri, R2, R3, R4, Rs, Re sont tels que défini précédemment, ou un de ses sels pharmaceutiques acceptables et au moins un excipient pharmaceutiquement acceptable et/ou un support ou un diluant ou un véhicule pharmaceutiquement acceptable pharmaceutiquement acceptable.
Dans un mode de réalisation particulièrement avantageux de l’invention, la composition pharmaceutique comprend le composé de formule (V) tel que défini précédemment, en tant que principe actif unique
(V), ou un de ses sels pharmaceutiques acceptables et au moins un excipient pharmaceutiquement acceptable et/ou un support ou un diluant ou un véhicule pharmaceutiquement acceptable pharmaceutiquement acceptable.
Dans un mode de réalisation particulièrement avantageux de l’invention, la composition pharmaceutique comprend le composé de formule (VI) tel que défini précédemment, en tant que principe actif unique
(VI), ou un de ses sels pharmaceutiques acceptables et au moins un excipient pharmaceutiquement acceptable et/ou un support ou un diluant ou un véhicule pharmaceutiquement acceptable pharmaceutiquement acceptable.
Dans un mode de réalisation particulièrement avantageux de l’invention, la composition pharmaceutique comprend le composé de formule (VII) tel que défini précédemment, en tant que principe actif unique
(VII), ou un de ses sels pharmaceutiques acceptables et au moins un excipient pharmaceutiquement acceptable et/ou un support ou un diluant ou un véhicule pharmaceutiquement acceptable pharmaceutiquement acceptable.
Dans un mode de réalisation particulièrement avantageux de l’invention, la composition pharmaceutique comprend le composé de formule (VIII) tel que défini précédemment, en tant que principe actif unique
(VIII), ou un de ses sels pharmaceutiques acceptables et au moins un excipient pharmaceutiquement acceptable et/ou un support ou un diluant ou un véhicule pharmaceutiquement acceptable pharmaceutiquement acceptable.
Dans un mode de réalisation particulièrement avantageux de l’invention, la composition pharmaceutique comprend le composé de formule (IX) tel que défini précédemment, en tant que principe actif unique
(IX), ou un de ses sels pharmaceutiques acceptables et au moins un excipient pharmaceutiquement acceptable et/ou un support ou un diluant ou un véhicule pharmaceutiquement acceptable pharmaceutiquement acceptable.
Dans un mode de réalisation avantageux, la composition pharmaceutique selon l’invention comprend en outre au moins un second principe actif. Dans un mode de réalisation particulièrement avantageux de l’invention, l’au moins un second principe actif peut interagir de manière synergique avec le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci. Avantageux, le second principe actif peut être un corticostéroïde, avantageusement la prednisone.
Dans un mode de réalisation avantageux de l’invention, lorsque la composition pharmaceutique comprend un second principe actif, la composition pharmaceutique est adaptée pour une administration simultanée ou une administration séquentielle du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et du second principe actif.
Au sens de la présente invention, on entend par « administration simultanée », une administration du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et du second principe actif en même temps, au même moment, à un patient en des quantités thérapeutiquement efficaces pour permettre l’effet synergique de la composition pharmaceutique. Cela ne signifie pas pour autant que le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et le second principe actif sont nécessairement administrés sous la forme d'un mélange ; ils peuvent en effet être administrés simultanément mais séparément, sous la forme de compositions distinctes.
Par « présents dans deux compositions distinctes », on entend que le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et le second principe actif sont physiquement séparés. Ils sont alors mis en œuvre, administrés séparément en des quantités thérapeutiquement efficaces pour permettre l’effet synergique de la composition pharmaceutique, sans mélange préalable, dans plusieurs (au moins deux) formes posologiques (par exemple deux compositions distinctes).
Dans un autre mode de réalisation particulier de l’invention, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et le second principe actif peuvent être présents dans une même composition en des quantités thérapeutiquement efficaces pour permettre l’effet synergique de la composition pharmaceutique. Au sens de la présente invention, on entend par « présents dans une même composition », la combinaison physique du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et le second principe actif. Le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et le second principe actif sont alors nécessairement administrés simultanément puisqu'ils sont administrés ensemble, sous la forme d'un mélange, dans une même forme posologique (par exemple dans une seule composition contenant le composé de formule (I) selon l’invention et la prednisone) et en des quantités thérapeutiquement efficaces pour permettre l’effet synergique de la composition pharmaceutique. Au sens de la présente invention, l’expression « administration séquentielle », signifie que le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci et le second principe actif sont administrés en des quantités thérapeutiquement efficaces pour permettre l’effet synergique de la composition pharmaceutique, non pas simultanément mais séparément dans le temps, l'un après l'autre. Les termes « précéder » ou « précédant » et « suivre » ou « suivant » s'appliquent alors. Le terme « précéder » ou « précédant » est utilisé lorsqu'un composé de la composition pharmaceutique selon l'invention est administré quelques minutes ou plusieurs heures, voire plusieurs jours avant l'administration des autre(s) composé(s) de la composition pharmaceutique. À l'inverse, le terme « suivre » ou « suivant » est utilisé lorsqu'un composé de la composition pharmaceutique est administré quelques minutes ou plusieurs heures, voire plusieurs jours après l'administration des autre(s) composé(s) de la composition pharmaceutique. Dans un mode de réalisation particulièrement avantageux de l’invention, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci est administré quelques jours avant le second principe actif.
Dans un mode de réalisation avantageux de l’invention, lorsque la composition pharmaceutique comprend un second principe actif, la composition pharmaceutique est adaptée pour une administration séquentielle du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci et du second principe actif. Avantageusement, le second principe actif peut être un corti costéroïde, avantageusement la prednisone.
Dans un mode de réalisation particulier de l’invention, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci est administré au patient, puis deux à trois jours après, le second principe actif est administré à ce même patient, pendant au moins une semaine, avantageusement au moins deux semaines, avantageusement au moins trois semaines, avantageusement au moins quatre semaines, avantageusement au moins cinq semaines, avantageusement au moins six semaines, avantageusement au moins sept semaines.
L'administration pendant le traitement in vivo peut se faire par n'importe quelle voie, y compris orale, parentérale, transdermique, intramusculaire, intranasale, sublinguale, intratrachéale, par inhalation, oculaire, vaginale et rectale. Des voies d'administration intracapsulaire, intraveineuse et intrapéritonéale peuvent également être utilisées. L'homme du métier saura adapter la voie d'administration en fonction du trouble à traiter. Par exemple, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou la composition pharmaceutique selon l’invention comprenant au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci, peuvent être administrées à un patient par administration orale, parentérale ou topique. Dans un mode de réalisation, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou la composition pharmaceutique selon l’invention comprenant au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci est sous une forme adaptée pour son administration par voie orale, parentérale ou topique. Dans un mode de réalisation, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci ou la composition pharmaceutique selon l’invention comprenant au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci, éventuellement sous la forme de nanoparticules, sont administrées par perfusion intraveineuse.
Le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou la composition pharmaceutique selon l’invention comprenant au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci, lorsqu'il est souhaitable de les administrer par voie systémique, peuvent être formulées pour une administration parentérale par injection, par exemple par injection de bolus ou perfusion continue. Les formulations pour injection peuvent être présentées sous une forme posologique unitaire, par exemple dans des ampoules ou dans des récipients à doses multiples, avec un conservateur ajouté. Les compositions pharmaceutiques peuvent prendre des formes telles que des suspensions, des solutions ou des émulsions dans des véhicules huileux ou aqueux et peuvent contenir des agents de formulation tels que des agents de suspension, des stabilisants et / ou des dispersants.
Les formulations pharmaceutiques pour administration parentérale comprennent les solutions aqueuses des compositions pharmaceutiques actives sous forme soluble dans l'eau. De plus, des suspensions des compositions pharmaceutiques actives peuvent être préparées sous forme de suspensions pour injection huileuse appropriées. Les solvants ou véhicules lipophiles appropriés comprennent les huiles grasses telles que l'huile de sésame, ou les esters d'acides gras synthétiques, tels que l'oléate d'éthyle ou les triglycérides, ou les liposomes. Les suspensions d'injection aqueuses peuvent contenir des substances qui augmentent la viscosité de la suspension, telles que la carboxyméthylcellulose de sodium, le sorbitol ou le dextrane.
De manière optionnelle, la suspension peut également contenir des stabilisants ou agents appropriés qui augmentent la solubilité des compositions pharmaceutiques pour permettre la préparation de solutions hautement concentrées. En variante, les compositions actives peuvent être sous forme de poudre pour constituer un véhicule approprié, par exemple de l'eau stérile apyrogène, avant utilisation.
Pour l'administration orale, les compositions pharmaceutiques peuvent prendre la forme, par exemple, de comprimés ou de capsules préparés par des moyens classiques avec des excipients pharmaceutiquement acceptables tels que des agents liants (par exemple, amidon de maïs prégélatinisé, polyvinylpyrrolidone, méthylcellulose ou hydroxypropylméthylcellulose); des charges (par exemple, du lactose, de la cellulose microcristalline ou de l'hydrogénophosphate de calcium); des lubrifiants (par exemple du stéarate de magnésium, du talc ou de la silice); des délitants (par exemple l'amidon de pomme de terre ou le glycolate d'amidon sodique); ou des agents mouillants (par exemple, le laurylsulfate de sodium). Les comprimés peuvent être enrobés par des procédés bien connus dans la technique. Les préparations liquides pour l'administration orale peuvent prendre la forme, par exemple, de solutions, de sirops ou de suspensions, ou peuvent être présentées sous forme de produit sec pour reconstitution avec de l'eau ou un autre véhicule approprié avant utilisation. Ces préparations liquides peuvent être préparées par des moyens classiques avec des additifs pharmaceutiquement acceptables tels que des agents de suspension (par exemple, sirop de sorbitol, dérivés de cellulose ou graisses comestibles hydrogénées); des agents émulsifiants (par exemple la lécithine ou la gomme arabique); des véhicules non aqueux (par exemple de l'huile d'amande, des esters huileux, de l'alcool éthylique ou des huiles végétales fractionnées); et des conservateurs (par exemple, méthyl ou propyl-p-hydroxybenzoates ou acide sorbique). Les préparations peuvent également contenir des sels tampons, des arômes, des colorants et des édulcorants, selon le cas. On souhaite également augmenter la stabilité globale des composés de formule (I) tels que définis et augmenter le temps de circulation dans le corps. Des exemples de telles molécules comprennent : le polyéthylène glycol, les copolymères d'éthylène glycol et de propylène glycol, la carboxyméthyl cellulose, le dextrane, l'alcool polyvinylique, la polyvinyl pyrrolidone et la polyproline. D'autres polymères pouvant être utilisés sont le poly-1 ,3-dioxolane et le poly-1,3,6-tioxocane. Comme indiqué ci-dessus, les molécules de polyéthylèneglycol sont préférées pour un usage pharmaceutique. Pour les compositions orales, le lieu de libération peut être l'estomac, l'intestin grêle (duodénum, jéjunum ou iléon) ou le gros intestin.
L'homme du métier dispose de formulations qui ne se dissoudront pas dans l'estomac, mais qui libéreront le matériau dans le duodénum ou ailleurs dans l'intestin. De préférence, la libération évitera les effets délétères de l'environnement de l'estomac ou par la libération de la matière biologiquement active au-delà de l'environnement de l'estomac, comme dans l'intestin. Pour l'administration buccale, les compositions peuvent prendre la forme de comprimés ou de pastilles formulés de manière classique.
Pour une administration par inhalation, les compositions à utiliser selon la présente invention peuvent être délivrées de manière appropriée sous la forme d'une pulvérisation aérosol à partir d'emballages sous pression ou d'un nébuliseur, en utilisant un agent propulseur approprié, par exemple dichlorodifluorométhane, trichlorofluorométhane, dichlorotétrafluoroéthane dioxyde de carbone ou autre gaz approprié. Dans le cas d'un aérosol sous pression, l'unité de dosage peut être déterminée en fournissant une valve pour délivrer une quantité mesurée. Les compositions selon l’invention peuvent être réduites sous la forme de poudre en vue d’une administration par inhalation. Dans ce cas, les compositions selon l’invention sous forme de poudre peuvent être mélangées à une seconde poudre, dite poudre de base telle que une poudre de lactose ou d’amidon, le mélange des deux poudres étant conditionné sous formes de cartouches ou de capsules destinées à être utilisées dans un inhalateur ou un insufflateur.
La présente invention concerne également l'administration pulmonaire. Les compositions pharmaceutiques peuvent être délivrées aux poumons d'un mammifère tout en inspirant et traversant la muqueuse épithéliale du poumon jusqu'à la circulation sanguine. Une gamme étendue de dispositifs mécaniques conçus pour la délivrance pulmonaire de produits thérapeutiques, comprenant, mais sans s'y limiter, les nébuliseurs, les inhalateurs-doseurs et les inhalateurs de poudre, tous connus des spécialistes de la technique, sont envisagés pour être utilisés dans la présente invention.
La délivrance nasale d'une composition pharmaceutique décrite ici est également envisagée. La délivrance nasale permet le passage d'une composition pharmaceutique de la présente invention au flux sanguin directement après l'administration du produit thérapeutique au nez, sans qu'il soit nécessaire de déposer le produit dans les poumons. Les formulations pour administration nasale comprennent celles avec du dextran ou de la cyclodextrine, ainsi que des excipients bioadhésifs tels que, par exemple, le chitosan.
Les compositions pharmaceutiques peuvent également être formulées dans des compositions rectales ou vaginales telles que des suppositoires ou des lavements de rétention, par exemple contenant des bases de suppositoires classiques tels que le beurre de cacao ou d'autres glycérides.
Les compositions pharmaceutiques peuvent également comprendre des supports ou excipients solides ou en phase de gel appropriés. Des exemples de tels supports ou excipients comprennent, sans s'y limiter, le carbonate de calcium, le phosphate de calcium, divers sucres, les amidons, les dérivés de la cellulose, la gélatine et les polymères tels que les polyéthylèneglycols.
Des formes de préparation pharmaceutique liquides ou solides convenables sont, par exemple, des solutions aqueuses ou salines pour inhalation, microencapsulées, encochées, appliquées sur des particules d'or microscopiques, contenues dans des liposomes, nébulisées, aérosols, pastilles pour implantation dans la peau. Les compositions pharmaceutiques comprennent également des granules, des poudres, des comprimés, des comprimés enrobés, des (micro)capsules, des suppositoires, des sirops, des émulsions, des suspensions, des crèmes, des timbres cutanés ou transdermiques, des gouttes ou des préparations à libération prolongée de compositions actives et / ou des auxiliaires tels que des délitants, des liants, des agents de revêtement, des agents gonflants, des lubrifiants, des arômes, des édulcorants ou des solubilisants sont habituellement utilisés comme décrit ci- dessus. Les compositions pharmaceutiques conviennent à une utilisation dans divers systèmes d'administration de médicaments.
Un autre objet de l'invention concerne une méthode de traitement préventif des maladies inflammatoires, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou la composition pharmaceutique selon l’invention comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Au sens de la présente invention, le terme « prévention » ou « prophylaxie » ou « traitement préventif » ou « traitement prophylactique » comprend un traitement conduisant à la prévention d’une maladie ainsi qu’un traitement réduisant et/ou retardant l’incidence d’une maladie ou le risque de survenue de la maladie.
Dans un mode de réalisation particulier de l’invention, la présente invention concerne une méthode de traitement préventif des maladies inflammatoires, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment et un second principe actif tel que défini précédemment. Avantageusement, la maladie inflammatoire peut être choisie parmi : les maladies neurodégénratives amyloïdes, telles la maladie d’Alzheimer, les prions, la maladie de Parkinson, la Sclérose Amyotrophique Latérale ; les maladies inflammatoires de l’intestin, telles que la maladie inflammatoire chronique de l'intestin (MICI), le syndrome du côlon irritable (IBS), la maladie de Crohn, la colite ulcéreuse, l’ulcère rectal hémorragique, les lésions concomitantes de la maladie de Behçet, la pouchite, la rectocolite hémorragique, l'iléite et l’entérite ; les maladies inflammatoires aigües telle que la goutte et le choc septique, les lombalgies inflammatoires chroniques, les maladies inflammatoires de la peau ou dermite, telles que le psoriasis, la dermatite atopique, la rosacée, la couperose, l’acné, les verrues vulgaires, les maladies cutanée bulleuses, l’eczéma de contact, les cancers de la peau, les rougeurs, les érythèmes, les télangiectasies, les inflammations de la peau liées à une exposition aux UV, telles que la photo-irritation, la photo-sensibilisation, le photovieillissement, la photo-carcinogénèse, les insuffisances veineuses lymphatiques ou syndrome de jambes lourdes ; l'arthrite, telles que l'ostéoarthrite, l'arthrite rhumatoïde, l’arthrite juvénile idiopathique et l'arthrite psoriasique ; la maladie pulmonaire obstructive chronique (MPOC) ; la maladie cœliaque ; la pancréatite chronique ; la thyroïdite de Hashimoto ; la cirrhose biliaire primitive ; la cholangite sclérosante ; l'hépatite auto-immune ; les vascularites comme les vascularites systémiques associées aux ANCA (anticorps anticytoplasme des neutrophiles) ; les spondylarthropathies ; la polychondrite chronique atrophiante ; les diabètes ; la sclérodermie et le cancer, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif des maladies neurodégénératives amyloïdes, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Avantageusement, les maladies neurodégénératives amyloïdes peuvent être choisies parmi : la maladie d’Alzheimer, les prions, la maladie de Parkinson, la Sclérose Amyotrophique Latérale, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif des maladies inflammatoires aigües, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Avantageusement, les maladies inflammatoires aigües peuvent être choisies parmi : la goutte et le choc septique, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif dans la fabrication d'un médicament destiné à la prévention des maladies inflammatoire.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment dans la fabrication d'un médicament destiné à la prévention des maladies inflammatoires.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci pour son utilisation dans la prévention des maladies inflammatoires. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des maladies inflammatoires.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des maladies inflammatoires. Avantageusement, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des maladies inflammatoires.
Un autre objet de l'invention concerne une méthode de traitement préventif des maladies auto-immunes, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Selon la présente invention, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci est particulièrement efficace pour empêcher l’apparition de maladies auto-immunes, en inhibant la production de cytokines inflammatoires, induisant ainsi un effet protecteur contre les maladies auto-immunes.
Dans un mode de réalisation particulier de l’invention, la présente invention concerne une méthode de traitement préventif des maladies auto-immunes, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment et un second principe actif tel que défini précédemment.
Avantageusement, la maladie auto-immune peut être choisie parmi : le lupus érythémateux disséminé, le lupus érythémateux systémique, la sclérose en plaques, la polyarthrite rhumatoïde, le diabète insulino-dépendant, le purpura thrombotique thrombocytopénique (PTI), le rejet de greffes ou d'organes, la maladie du greffon contre l'hôte, les différents types de sclérose, le syndrome de Sjôgren primitif (ou syndrome de Gougerot-Sjôgren), les polyneuropathies auto-immunes comme la sclérose en plaques, le diabète de type I, les hépatites auto-immunes, la spondylarthrite ankylosante, le syndrome de Reiter, l'arthrite de goutte, la thyroïdite chronique d'Hashimoto (hypothyroïdie), la maladie d'Adisson, les hépatites auto-immunes, la maladie de Basedow (hyperthyroïdie), les cytopénies auto- immunes et autres complications hématologiques de l'adulte et de l'enfant, telles que les thrombopénies autoimmunes aiguës ou chroniques, les anémies hémolytiques autoimmunes, la maladie hémolytique du nouveau-né (MHN), la maladie des agglutinines froides, le purpura thrombotique thrombocytopénique et l'hémophilie acquise auto-immune ; le syndrome de Goodpasture, les néphropathies extra-membraneuses, les affections cutanées bulleuses autoimmunes, la myasthénie réfractaire, les cryoglobulinémies mixtes, les myosites inflammatoires, les dermatomyosites et les affections systémiques auto-immunes de l'enfant incluant le syndrome des antiphospholipides, la maladie des tissus conjonctifs, les différents types de sclérose, l'inflammation auto-immune pulmonaire, le syndrome Guillain- Barre, la polyradiculonévrite inflammatoire demyélisante chronique (PDCI), la thyroïdite autoimmune, le mellitis, le myasthenia gravis, la maladie autoimmune inflammatoire de l'oeil, la neuromyélite optique (maladie de Devic), les sclérodermies, le pemphigus, le diabète par insulinorésistance, la polymyosite, l'anémie de Biermer, la glomérulonéphrite, la maladie de Wegener, la maladie de Horton, la périarthrite noueuse et le syndrome de Churg et Strauss, la maladie de Still, la polychondrite atrophiante, la maladie de Behçet, la gammapathie monoclonale, la granulomatose de Wegener, le lupus, le rhumatisme psoriasique, la sarcoïdose, la colite collagène, la dermatite herpétiforme, la fièvre méditerranéenne familiale, la glomérulonéphrite à dépôts d'IgA, le syndrome myasthénique de Lambert-Eaton, l'ophtalmie sympathique, le syndrome de Fiessinger-Leroy-Reiter et le syndrome uvéo- méningo-encéphalique, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif de la polyarthrite rhumatoïde, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif du lupus érythémateux disséminé, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment. Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d'un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif dans la fabrication d'un médicament destiné à la prévention des maladies auto-immunes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment dans la fabrication d'un médicament destiné à la prévention des maladies auto-immunes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci tel que défini précédemment pour son utilisation dans la prévention des maladies autoimmunes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des maladies auto-immunes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des maladies autoimmunes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des maladies auto-immunes.
Un autre objet de l'invention concerne une méthode de traitement préventif des infections virales et/ou bactériennes, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Selon la présente invention, les composés de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de ceux-ci sont particulièrement efficaces pour empêcher l’apparition, le développement, l’amplification, la persistance d’infections virales et/ou bactériennes, en inhibant la production de cytokines inflammatoires, induisant ainsi un effet protecteur contre les infections virales et/ou bactériennes. Avantageusement, les inventeurs ont également montré que les composés de formule (V), (VI), (VIII) et (IX) sont capables de bloquer la production et/ou la sécrétion d’interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains de manière préventive avant la stimulation par le virus de la grippe (virus influenza). Les inventeurs ont également montré que les composés de formule (V) et (VI) sont capables de bloquer la production de TNFa par des cellules dentritiques plasmacytoïdes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains de manière préventive avant la stimulation par le virus de la grippe (virus influenza).
Les inventeurs ont également montré que les composés de formule (V), (VI) et (VIII) sont capables de bloquer la production et/ou la sécrétion d’interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains de manière préventive avant la stimulation par le virus de l'immunodéficience humaine (VIH).
Ainsi, les inventeurs ont montré de manière tout à fait surprenante que l’utilisation d’un composé de formule (I) a un effet préventif sur l’inhibition de la production d’interféron induite par le virus de la grippe (virus influenza) et le virus de l'immunodéficience humaine (VIH).
Dans un mode de réalisation particulier de l’invention, la présente invention concerne une méthode de traitement préventif des infections virales et/ou bactériennes, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment et un second principe actif tel que défini précédemment. Avantageusement, les infections virales peuvent être choisie parmi : les infections dues au virus de la grippe, le Virus de l’immunodéficience Humaine (VIH), au virus de l’herpès ou Herpès Simplex Virus (HSV), au coronavirus, au COVID-19, au virus de l'encéphalomyocardite, aux arbovirus, tels que , le Chikungunya, l’O'Nyong Nyong, le Ross River, le Sindbis, le Mayaro, le virus de la fièvre jaune, la dengue, l'encéphalite japonaise, le virus West Nile, les virus des encéphalites à tiques d'Eurasie tempérée, les virus de la maladie de la forêt de Kyasianur, la fièvre hémorragique d'Omsk les Bunyaviridae, le virus Bunyamwera, le virus de la Fièvre de la Vallée du Rift, le virus de la fièvre hémorragique de Crimée Congo, au virus des hépatites A, B et C et au virus influenza, la liste n’étant pas limitative.
Avantageusement, les infections bactériennes peuvent être choisie parmi : les infections dues à des bactéries à Gram positif, telles que les bactéries de genre Staphylococcus en particulier Staphylococcus aureus, et les bactéries de genre Enterococcus, en particulier Enterococcus faecalis ; les infections dues à des bactéries à Gram négatif, telles que les bactéries de genre Escherichia, en particulier Escherichia coli, les bactéries de genre Pseudomonas, en particulier Pseudomonas aeruginosa, et les bactéries de genre Acinetobacter, en particulier Acinetobacter baumanii, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif des infections au coronavirus, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif des infections dues au virus de la grippe, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement préventif des infections au virus de l’immunodéficience humaine (VIH), comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif dans la fabrication d'un médicament destiné à la prévention des infections virales et/ou bactériennes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment dans la fabrication d'un médicament destiné à la prévention des infections virales et/ou bactériennes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci tel que défini précédemment pour son utilisation dans la prévention des infections virales et/ou bactériennes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des infections virales et/ou bactériennes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des infections virales et/ou bactériennes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans la prévention des infections virales et/ou bactériennes.
Un autre objet de l'invention concerne une méthode de traitement curatif des maladies inflammatoires, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou la composition pharmaceutique selon l’invention comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Au sens de la présente invention, le terme « traitement » ou « traitement curatif » est défini comme un traitement conduisant à une guérison ou un traitement qui allège, améliore et/ou élimine, réduit et/ou stabilise les symptômes d'une maladie ou la souffrance qu'elle provoque.
Dans un mode de réalisation particulier de l’invention, la présente invention concerne une méthode de traitement curatif des maladies inflammatoires, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment et un second principe actif tel que défini précédemment.
Avantageusement, la maladie inflammatoire peut être choisie parmi : les maladies neurodégénratives amyloïdes, telles la maladie d’Alzheimer, les prions, la maladie de Parkinson, la Sclérose Amyotrophique Latérale ; les maladies inflammatoires de l’intestin, telles que la maladie inflammatoire chronique de l'intestin (M ICI), le syndrome du côlon irritable (IBS), la maladie de Crohn, la colite ulcéreuse, l’ulcère rectal hémorragique, les lésions concomitantes de la maladie de Behçet, la pouchite, la rectocolite hémorragique, l'iléite et l’entérite ; les maladies inflammatoires aigües telle que la goutte et le choc septique, les lombalgies inflammatoires chroniques, les maladies inflammatoires de la peau ou dermite, telles que le psoriasis, la dermatite atopique, la rosacée, la couperose, l’acné, les verrues vulgaires, les maladies cutanée bulleuses, l’eczéma de contact, les cancers de la peau, les rougeurs, les érythèmes, les télangiectasies, les inflammations de la peau liées à une exposition aux UV, telles que la photo-irritation, la photo-sensibilisation, le photovieillissement, la photo-carcinogénèse, les insuffisances veineuses lymphatiques ou syndrome de jambes lourdes ; l'arthrite, telles que l'ostéoarthrite, l'arthrite rhumatoïde, l’arthrite juvénile idiopathique et l'arthrite psoriasique ; la maladie pulmonaire obstructive chronique (MPOC) ; la maladie cœliaque ; la pancréatite chronique ; la thyroïdite de Hashimoto ; la cirrhose biliaire primitive ; la cholangite sclérosante ; l'hépatite auto-immune ; les vascularites comme les vascularites systémiques associées aux ANCA (anticorps anticytoplasme des neutrophiles); les spondylarthropathies ; la polychondrite chronique atrophiante ; les diabètes ; la sclérodermie et le cancer, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif des maladies neurodégénératives amyloïdes, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Avantageusement, les maladies neurodégénératives amyloïdes peuvent être choisies parmi : la maladie d’Alzheimer, les prions, la maladie de Parkinson, la Sclérose Amyotrophique Latérale, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif des maladies inflammatoires aigües, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Avantageusement, les maladies inflammatoires aigües peuvent être choisies parmi : la goutte et le choc septique, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif dans la fabrication d'un médicament destiné au traitement des maladies inflammatoire.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment dans la fabrication d'un médicament destiné au traitement des maladies inflammatoires.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci pour son utilisation dans le traitement des maladies inflammatoires. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des maladies inflammatoires.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des maladies inflammatoires. Avantageusement, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des maladies inflammatoires.
Un autre objet de l'invention concerne une méthode de traitement curatif des maladies autoimmunes, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Selon la présente invention, le composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci est particulièrement efficace pour empêcher l’apparition de maladies auto-immunes, en inhibant la production de cytokines inflammatoires, induisant ainsi un effet protecteur contre les maladies auto-immunes.
Dans un mode de réalisation particulier de l’invention, la présente invention concerne une méthode de traitement curatif des maladies auto-immunes, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment et un second principe actif tel que défini précédemment.
Avantageusement, la maladie auto-immune peut être choisie parmi : le lupus érythémateux disséminé, le lupus érythémateux systémique, la sclérose en plaques, la polyarthrite rhumatoïde, le diabète insulino-dépendant, le purpura thrombotique thrombocytopénique (PTI), le rejet de greffes ou d'organes, la maladie du greffon contre l'hôte, les différents types de sclérose, le syndrome de Sjôgren primitif (ou syndrome de Gougerot-Sjôgren), les polyneuropathies auto-immunes comme la sclérose en plaques, le diabète de type I, les hépatites auto-immunes, la spondylarthrite ankylosante, le syndrome de Reiter, l'arthrite de goutte, la thyroïdite chronique d'Hashimoto (hypothyroïdie), la maladie d'Adisson, les hépatites auto-immunes, la maladie de Basedow (hyperthyroïdie), les cytopénies autoimmunes et autres complications hématologiques de l'adulte et de l'enfant, telles que les thrombopénies autoimmunes aiguës ou chroniques, les anémies hémolytiques autoimmunes, la maladie hémolytique du nouveau-né (MHN), la maladie des agglutinines froides, le purpura thrombotique thrombocytopénique et l'hémophilie acquise auto-immune ; le syndrome de Goodpasture, les néphropathies extra-membraneuses, les affections cutanées bulleuses autoimmunes, la myasthénie réfractaire, les cryoglobulinémies mixtes, les myosites inflammatoires, les dermatomyosites et les affections systémiques auto-immunes de l'enfant incluant le syndrome des antiphospholipides, la maladie des tissus conjonctifs, les différents types de sclérose, l'inflammation auto-immune pulmonaire, le syndrome Guillain- Barre, la polyradiculonévrite inflammatoire demyélisante chronique (PDCI), la thyroïdite autoimmune, le mellitis, le myasthenia gravis, la maladie autoimmune inflammatoire de l'oeil, la neuromyélite optique (maladie de Devic), les sclérodermies, le pemphigus, le diabète par insulinorésistance, la polymyosite, l'anémie de Biermer, la glomérulonéphrite, la maladie de Wegener, la maladie de Horton, la périarthrite noueuse et le syndrome de Churg et Strauss, la maladie de Still, la polychondrite atrophiante, la maladie de Behçet, la gammapathie monoclonale, la granulomatose de Wegener, le lupus, le rhumatisme psoriasique, la sarcoïdose, la colite collagène, la dermatite herpétiforme, la fièvre méditerranéenne familiale, la glomérulonéphrite à dépôts d'IgA, le syndrome myasthénique de Lambert-Eaton, l'ophtalmie sympathique, le syndrome de Fiessinger-Leroy-Reiter et le syndrome uvéo- méningo-encéphalique, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif de la polyarthrite rhumatoïde, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif du lupus érythémateux disséminé, comprenant l'administration au patient du composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d’une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d'un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif dans la fabrication d'un médicament destiné au traitement des maladies auto-immunes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment dans la fabrication d'un médicament destiné au traitement des maladies auto-immunes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci tel que défini précédemment pour son utilisation dans le traitement des maladies autoimmunes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des maladies auto-immunes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des maladies autoimmunes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des maladies auto-immunes.
Un autre objet de l'invention concerne une méthode de traitement curatif des infections virales et/ou bactériennes, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Selon la présente invention, les composés de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de ceux-ci sont particulièrement efficaces pour empêcher l’apparition, le développement, l’amplification, la persistance d’infections virales et/ou bactériennes, en inhibant la production de cytokines inflammatoires, induisant ainsi un effet protecteur contre les infections virales et/ou bactériennes. Avantageusement, les inventeurs ont également montré que les composés de formule (V), (VI), (VIII) et (IX) sont capables de bloquer la production d’interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains de manière préventive avant la stimulation par le virus de la grippe (virus influenza). Les inventeurs ont également montré que les composés de formule (V) et (VI) sont capables de bloquer la production de TNFa par des cellules dentritiques plasmacytoïdes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains de manière préventive avant la stimulation par le virus de la grippe (virus influenza).
Les inventeurs ont également montré que les composés de formule (V), (VI) et (VIII) sont capables de bloquer la production et/ou la sécrétion d’interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains de manière préventive avant la stimulation par le virus de l'immunodéficience humaine (VIH).
Ainsi, les inventeurs ont montré de manière tout à fait surprenante que l’utilisation d’un composé de formule (I) a un effet curatif sur l’inhibition de la production d’interféron induite par le virus de la grippe (virus influenza) et le virus de l'immunodéficience humaine (VIH).
Dans un mode de réalisation particulier de l’invention, la présente invention concerne une méthode de traitement curatif des infections virales et/ou bactériennes, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment et un second principe actif tel que défini précédemment.
Avantageusement, les infections virales peuvent être choisie parmi : les infections dues au virus de la grippe, le Virus de l’immunodéficience Humaine (VIH), au virus de l’herpès ou Herpès Simplex Virus (HSV), au coronavirus, au COVID-19, au virus de l'encéphalomyocardite, aux arbovirus, tels que , le Chikungunya, l’O'Nyong Nyong, le Ross River, le Sindbis, le Mayaro, le virus de la fièvre jaune, la dengue, l'encéphalite japonaise, le virus West Nile, les virus des encéphalites à tiques d'Eurasie tempérée, les virus de la maladie de la forêt de Kyasianur, la fièvre hémorragique d'Omsk les Bunyaviridae, le virus Bunyamwera, le virus de la Fièvre de la Vallée du Rift, le virus de la fièvre hémorragique de Crimée Congo, au virus des hépatites A, B et C et au virus influenza, la liste n’étant pas limitative.
Avantageusement, les infections bactériennes peuvent être choisie parmi : les infections dues à des bactéries à Gram positif, telles que les bactéries de genre Staphylococcus en particulier Staphylococcus aureus, et les bactéries de genre Enterococcus, en particulier Enterococcus faecalis ; les infections dues à des bactéries à Gram négatif, telles que les bactéries de genre Escherichia, en particulier Escherichia coli, les bactéries de genre Pseudomonas, en particulier Pseudomonas aeruginosa, et les bactéries de genre Acinetobacter, en particulier Acinetobacter baumanii, la liste n’étant pas limitative.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif des infections au coronavirus, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif des infections dues au virus de la grippe, comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une méthode de traitement curatif des infections au virus de l’immunodéficience humaine (VIH), comprenant l'administration au patient d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci ou d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif dans la fabrication d'un médicament destiné au traitement des infections virales et/ou bactériennes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne l'utilisation d'une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment dans la fabrication d'un médicament destiné au traitement des infections virales et/ou bactériennes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui- ci tel que défini précédemment pour son utilisation dans le traitement des infections virales et/ou bactériennes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des infections virales et/ou bactériennes.
Dans un mode de réalisation particulièrement avantageux, la présente invention concerne une composition pharmaceutique comprenant une quantité thérapeutiquement efficace d’au moins un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des infections virales et/ou bactériennes. Avantageusement, la présente invention concerne un composé de formule (I) selon l’invention ou un sel pharmaceutiquement acceptable de celui-ci choisi parmi : les composés de formule (V), de formule (VI), de formule (VII), de formule (VIII) et de formule (IX) en tant que principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable tel que défini précédemment pour son utilisation dans le traitement des infections virales et/ou bactériennes.
Figures
La figure 1 montre la modélisation du complexe de kinases ROCK et PDK1 réalisée à partir des données cristallographiques déposées dans la PDB (2ESM pour ROCK-1 et 2R7B pour PDK1). Dans la zone d’interaction ROCK et PDK1 sont modélisés les déterminants chimiques réalisant un clash stérique entre les deux kinases et donc susceptibles d’interférer avec l’assemblage des deux enzymes. La structure en boule désigne la chaine latérale de l’acide aminé de PDK1 phosphorylée par ROCK.
La figure 2 montre le blocage par le composé de formule (V) de la sécrétion des interférons et de cytokines inflammatoires sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll- like TLR 7/8. Les résultats ont été obtenus avec la lignée rapportrice THP1-dual.
La figure 3 montre le blocage par le composé de formule (VI) de la sécrétion des interférons et de cytokines inflammatoires sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll- like TLR 7/8. Les résultats ont été obtenus avec la lignée rapportrice THP1-dual.
La figure 4 montre le blocage par le composé de formule (VII) de la sécrétion des interférons du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll-like TLR 7/8. Les résultats ont été obtenus avec la lignée rapportrice STING-37.
La figure 5 montre le blocage par le composé de formule (VIII) de la sécrétion des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll-like TLR 7/8. Les résultats ont été obtenus avec la lignée rapportrice STING-37.
La figure 6 montre le blocage par le composé de formule (IX) de la sécrétion des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll-like TLR 7/8. Les résultats ont été obtenus avec la lignée rapportrice STING-37.
La figure 7 montre le blocage par le composé de formule (V) de la sécrétion des cytokines inflammatoires et des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR 7/8. Les résultats ont été obtenus par LegendPlex.
La figure 8 montre le blocage par le composé de formule (V) de la sécrétion des cytokines inflammatoires et des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR 4. Les résultats ont été obtenus par LegendPlex. La figure 9 montre le blocage par le composé de formule (VI) de la sécrétion des cytokines inflammatoires et des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR 7/8. Les résultats ont été obtenus par LegendPlex.
La figure 10 montre le blocage par le composé de formule (VI) de la sécrétion des cytokines inflammatoires et des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR 4. Les résultats ont été obtenus par LegendPlex.
La figure 11 montre le blocage par les composés de formule (V) à (VIII) de l’activation des lymphocytes B de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR 9. Représentation en histogramme de la MFI. Les résultats ont été obtenus par Cytométrie en flux
La figure 12 montre le blocage par les composés de formule (V), (VI), (VIII) et (IX) de la sécrétion des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par le virus de la grippe (Flu). Les résultats ont été ont été obtenus avec la lignée rapportrice TH P1 -dual.
La figure 13 montre le blocage par les composés de formule (V), (VI) et (VIII) de la sécrétion des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par le virus du VIH. Les résultats ont été ont été obtenus avec la lignée rapportrice TH P1 -dual.
La figure 14 montre le blocage par les composés de formule (V) et (VI) de la production de TNFa sur monocytes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, (A)1h avant la stimulation des TLR7/8, (B)1h avant la stimulation des TLR4 et (C) 1h avant la stimulation des TLR2. Représentation en histogramme de la MFI, Les résultats ont été ont été obtenus par Cytométrie en flux
La figure 15 montre le blocage par les composés de formule (V) et (VI) de la production de TNFa sur cellules dendritiques plasmacytoides isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, (A) 1h avant la stimulation des TLR7, (B) 1h avant la stimulation le virus de la grippe (Flu)et (C) 1h avant la stimulation par les TLR9. Les résultats ont été ont été obtenus par Cytométrie en flux.
La figure 16 montre le blocage par le composé de formule (V), selon un effet dose, de l’activation du facteur de transcription NFkB dans la lignée monocytaire THP1-dual, en réponse à la stimulation des Toll-like récepteurs TLR7/8 par R848. Les résultats ont été obtenus par absorptiométrie (test SEAP - barres grisées). La toxicité du composé de formule (V) vis-à-vis des cellules THP-1 a été mesurée en parallèle (test WST-1 - barres noires).
La figure 17 montre le blocage par le composé de formule (VI), selon un effet dose, de l’activation du facteur de transcription NFkB dans la lignée monocytaire THP1-dual, en réponse à la stimulation des Toll-like récepteurs TLR7/8 par R848. Résultats obtenus par absorptiométrie (test SEAP - barres grisées). La toxicité du composé de formule (VI) vis-à- vis des cellules THP-1 a été mesurée en parallèle (test WST-1 - barres noires).
La figure 18 montre le blocage par le composé de formule (V), selon un effet dose, de l’activation du facteur de transcription NFkB dans la lignée monocytaire THP1-dual, en réponse à la stimulation des Toll-like récepteurs TLR4 par le LPS. Les résultats ont été obtenus par absorptiométrie (test SEAP - barres grisées). La toxicité du composé de formule
(V) vis-à-vis des cellules THP-1 a été mesurée en parallèle (test WST-1 - barres noires).
La figure 19 montre le blocage par le composé de formule (VI), selon un effet dose, de l’activation du facteur de transcription NFkB dans la lignée monocytaire THP1-dual, en réponse à la stimulation des Toll-like récepteurs TLR4 par le LPS. Les résultats ont été obtenus par absorptiométrie (test SEAP - barres grisées). La toxicité du composé de formule
(VI) vis-à-vis des cellules THP-1 a été mesurée en parallèle (test WST-1 - barres noires).
La figure 20 montre le blocage par les composés de formule (V), (VI), (VIII) et (IX) de l’activation des facteurs de transcription IRF dans la lignée monocytaire TH P1 -dual, en réponse à la stimulation de la voie des interférons STING par le cGAMP. Les résultats ont été obtenus par luminométrie (barres grisées). La toxicité des composés de formule (V), (VI), (VIII) et (IX) vis-à-vis des cellules THP-1 a été mesurée en parallèle (test WST-1 - barres noires).
La figure 21 montre que les composés de formule (V) et (VI) n’ont aucun impact sur l’activité enzymatique de la pyruvate kinase (PK).
La figure 22 montre le blocage par les composés de formule (V) et (VI), selon un effet dose, de la transcription des gènes pro-inflammatoires IL1 p, TNFa, IL6 et MCP1 dans la lignée monocytaire THP1 , en réponse à la stimulation des Toll-like récepteurs TLR7/8 par R848. Les résultats ont été obtenus par RT-qPCR.
La figure 23 montre le blocage par les composés de formule (V) et (VI), selon un effet dose, de la transcription des gènes pro-inflammatoires I L1 p et TNFa dans la lignée monocytaire THP1 , en réponse à la stimulation des Toll-like récepteurs TLR4 par LPS. Les résultats ont été obtenus par RT-qPCR. La figure 24 représente la modélisation de la kinase ROCK-1 en complexe avec le composé de formule (V), réalisée à partir des données cristallographiques déposées dans la Protein Data Bank (référence 2ESM pour ROCK-1). Sont indiqués les acides aminés de ROCK-1 impliqués dans l’interaction avec le composé de formule (V).
La figure 25 montre que les propriétés anti-inflammatoires des composés de formule (V) et (VI) sont dépendantes de la kinase PDK1. L’expression de la kinase PDK1 a été réprimée par un siARN spécifique (siPDKI) dans des monocytes de donneurs sains. Un siARN contrôle (siCTL) a été utilisé comme témoin négatif de l’expérience. Les monocytes ont ensuite été traités avec les composés de formules (V) ou (VI) et stimulés par l’agoniste des TLR7/8, le composé R848. La production intracellulaire de TNFa a été mesurée par cytométrie en flux. (A) Représentation en dot plot. (B) représentation en histogramme de la MFI (TNFa).
Exemples
Exemple 1 : Effet des composés de formule (V) à (IX) sur la production d’interféron et du facteur de transcription NF-kb sur les cellules mononucléaires du sang périphérique humain
Préparation des composés de formule (V), (VI), (VII), (VIII) et (IX)
Les composés de formules peuvent être obtenus selon le procédé de synthèse décrit dans la publication de Le Corre et al., Microwave-assisted preparation of 4-amino-3-cyano-5- methoxycarbonyl-N-arylpyrazoles as building blocks for the diversity-oriented synthesis of pyrazole-based polycyclic scaffolds, Organic & Biomolecular Chemistry, 2015, vol 13, pages 409-423.
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les cellules mononuclées du sang périphérique (PBMC) ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT). Stimulation cellulaire
Les PBMC ont été cultivés à 2.106 cellules/ml. Les cellules ont ensuite été incubées avec les composés de l’invention aux concentrations indiquées pendant 1 h avant stimulation. Les PBMC ont ensuite été stimulées pendant 24h avec l’agoniste TLR7/8 Resiquimod (R848) à 5 pg/ml. Les surnageants ont été collectés pour la détection des cytokines.
Détection des cytokines
L’activité du facteur de transcription NF-kB et l’induction de la voie des Interférons (IFN) via les Interferon Regulatory Factor (IRF) ont été mesurées grâce à la lignée rapportrice THP1 dual de chez Invivogen. Les surnageants de culture des PBMC ont été ajoutés aux cultures de THP1-Dual à raison de 0,4.106 cellules/ml durant 24h. L’activité du facteur de transcription NF-kb a été mesuré avec du QUANTI-Blue, un agent de détection de la SEAP suivant les recommandations du fournisseur. L’activité des IRF a été mesuré avec du QUANTI-Luc, un réactif de détection de la luciférase suivant les recommandations du fournisseur.
Les résultats sont présentés aux Figures 2 à 6.
Les valeurs d’ICso, déterminées par rapport à l’inhibition du facteur de transcription NF-kB et des IRF, sont reproduites dans le tableau 2 ci-dessous. Les scores d’interaction (virtual score) entre les composés de formules V à IX et la kinase ROCK1 , déterminés à partir de la modélisation de la kinase ROCK1 avec les disrupteurs du complexe ROCK/PDK1 , sont reproduites dans le tableau 2 ci-dessous.
Tableau 2 : valeurs d’ICso et scores d’interaction. Conclusion :
Il en ressort que : les composés de formule (V) et (VI) sont capable de bloquer la sécrétion des interférons et de cytokines inflammatoires sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll-like TLR 7/8 (Figures 2 à 3). les composés de formule (VII), (VIII) et (IX) sont capables de bloquer la sécrétion des interférons sur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par des récepteurs Toll-like TLR 7/8 (Figures 4 à 6).
Les composés de l’invention ont une affinité élevée pour la protéine kinase ROCK1 (virtual score supérieur à 30).
Exemple 2 : Effet du composé de formule (V) et (VI) sur la production d’interféron et des cytokines inflammatoires sur les cellules mononucléaires du sang périphérique humain après stimulation au R848 et au LPS
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les cellules mononuclées du sang périphérique (PBMC) ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Stimulation cellulaire
Les PBMC ont été cultivés à 2.106 cellules/ml. Les cellules ont ensuite été incubées avec les composés de formule (V) et (VI) aux concentrations indiquées pendant 1h avant stimulation. Les PBMC ont ensuite été stimulées pendant 24h avec l’agoniste TLR7/8 Resiquimod - R848 à 5 pg/ml et l’agoniste TLR4 Lipopolysaccharide - LPS à 100 ng/ml. Les surnageants ont été collectés pour la détection des cytokines. Détection des cytokines
Un dosage des cytokines dans les surnageants des cultures cellulaires a été réalisé en utilisant le kit « LegenPIex Antivirus Human Panel » ou « legendplex human inflammation panel » (Biolegend, San Diego, USA) selon les instructions du fabricant.
Les résultats sont présentés aux Figures 7 à 10.
Conclusion :
Il en ressort que : les composés de formule (V) et (VI) sont respectivement capables de bloquer la sécrétion des cytokines TNFa, 111 p, IL6, IL10, I L12p70, IL18, IL23 et IL33, ainsi que les interférons IFNa2 et IFNy, et la protéine MCPIsur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, en réponse à une stimulation par des récepteurs Toll-like TLR 7/8. les composés de formule (V) et (VI) sont respectivement capables de bloquer la sécrétion des cytokines TNFa, 111b, IL6, IL18 et IL23, ainsi que l’interféron IFNy, et la protéine MCPIsur des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, en réponse à une stimulation par des récepteurs Toll-like TLR 4.
Exemple 3 : Effet des composés de formule (V), (VI), (VII) et (VIII) sur l’activation des lymphocytes B de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR9.
Isolement et culture de leucocytes sanguins.
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les lymphocytes B ont été purifiés par sélection négative avec le «B Cell Isolation Kit » (Miltenyi). Les lymphocytes B ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Stimulation cellulaire
Les lymphocytes B ont été cultivés à 1 ,106/ml. Les cellules ont ensuite été incubées respectivement avec les composés de formule (V) à (VIII) à 20 iM pendant 1 h avant stimulation. Elles ont été stimulées pendant 16h (cytométrie en flux) avec l’agoniste TLR9 CpG-A à 5 mM. Les cellules ont été récupérées pour la cytométrie en flux.
Cytométrie en flux
Après lavage, les cellules ont été remises en suspension dans du PBS contenant 2% de SVF et 2 mM d'EDTA puis marquées avec un anticorps anti-CD69 (clone REA824) de Miltenyi Biotec, utilisé au 1/100° pendant 30min à 4°C. Les cellules ont été lavées 2 fois puis passé en cytométrie à flux. L'acquisition des données a été réalisée sur le cytomètre en flux Canto II en utilisant le logiciel Diva (BD Biosciences, San José, CA). Le logiciel FlowJo a été utilisé pour analyser les données.
Les résultats sont présentés à la Figure 11.
Conclusion :
Il en ressort que l’ensemble des composés de formule (V), (VI), (VII) et (VIII) sont capables de bloquer l’activation des lymphocytes B illustré par le marqueur d’activation membranaire CD69 de donneurs sains en réponse à une stimulation par des récepteurs Toll-like TLR9.
Exemple 4 : Effet des composés de formule (V), (VI), (VIII) et (IX) sur la sécrétion des interférons par des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par le virus de la grippe.
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les cellules mononuclées du sang périphérique (PBMC) ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Stimulation cellulaire
Les PBMC ont été cultivés à 2.106 cellules/ml. Les cellules ont ensuite été incubées avec les composés de formule (V), (VI), (VIII) et (IX) à 20pM pendant 1h avant stimulation. Les PBMC ont ensuite été stimulées pendant 24h avec le virus de la grippe (Flu). Les surnageants ont été collectés pour la détection des cytokines.
Test de toxicité des composés sur les cellules mononuclées du sang périphérique (PBMC)
Après 24h de culture cellulaire, la viabilité cellulaire a été déterminée sur les PBMC en utilisant le réactif CelITiter-GIo (Promega), qui évalue la quantité d’ATP par luminescence en utilisant l’EnSpire.
Détection des cytokines
L’induction de la voie des Interférons (IFN) via les IRF a été mesurée grâce à la lignée rapportrice THP1 dual de chez invivogen. Les surnageants de culture des PBMC ont rajouté sur des cultures de THP1-Dual à 0,4.106 cellules/ml durant 24h. L’activité des IRF a été mesuré avec du QUANTI-Luc, un réactif de détection de la luciférase suivant les recommandations du fournisseur.
Les résultats sont présentés à la Figure 12.
Conclusion :
Il en ressort que les composés de formule (V), (VI), (VIII) et (IX) inhibent la sécrétion des interférons par des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par le virus de la grippe.
Exemple 5 : Effet des composés de formule (V), (VI) et (VIII) sur la sécrétion des interférons par des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par le virus VIH.
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les cellules mononuclées du sang périphérique (PBMC) ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Stimulation cellulaire Les PBMC ont été cultivés à 2.106 cellules/ml. Les cellules ont ensuite été incubées avec les composés de formule (V), (VI) et (VIII) à 20pM pendant 1h avant stimulation. Les PBMC ont ensuite été stimulées pendant 24h avec le virus de l'immunodéficience humaine (VIH). Les surnageants ont été collectés pour la détection des cytokines.
Test de toxicité des composés sur les cellules mononuclées du sang périphérique (PBMC)
Après 24h de culture cellulaire, la viabilité cellulaire a été déterminée sur les PBMC en utilisant le réactif CelITiter-GIo (Promega), qui évalue la quantité d’ATP par luminescence en utilisant l’EnSpire.
Détection des cytokines
L’induction de la voie des Interférons (IFN) via les IRF a été mesurée grâce à la lignée rapportrice THP1 dual de chez invivogen. Les surnageants de culture des PBMC ont rajouté sur des cultures de THP1-Dual à 0,4.106 cellules/ml durant 24h. L’activité des IRF a été mesuré avec du QUANTI-Luc, un réactif de détection de la luciférase suivant les recommandations du fournisseur.
Les résultats sont présentés à la Figure 13.
Conclusion :
Il en ressort que les composés de formule (V), (VI) et (VIII) inhibent la sécrétion des interférons par des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive, 1h avant la stimulation par le virus VIH.
Exemple 6 : Effet des composés de formule (V) et (VI) sur la production de TNFa sur monocytes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains.
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les monocytes humains ont été purifiés par sélection positive avec des microbilles CD14 humaines (Miltenyi). Les monocytes ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Stimulation cellulaire
Les monocytes ont été cultivés à 1 , 106/ml. Les cellules ont ensuite été incubées avec les composés de formule (V) et (VI) à 20pM pendant 1h avant stimulation.
Les monocytes ont été stimulés respectivement pendant 16h avec :
- condition A : l’agoniste TLR7/8 Resiquimod - R848 à 5 pg/ml,
- condition B : l’agoniste TLR4 Lipopolysaccharide - LPS à 100 ng/ml,
- condition C : l’agoniste TLR2 acide lipotéichoïque - LTA à 1 pg/ml.
Les cellules ont été récupérées pour la cytométrie en flux. Pour le marquage intracellulaire du TNFa, de la Brefeldin A (BFA) a été ajoutée aux cellules 30 minutes après la stimulation.
Cytométrie en flux
Les cellules ont été rincées dans du PBS puis incubées avec un marqueur de viabilité (Zombie Aqua, Biolegend) pendant 30 min à température ambiante. Après lavage, les cellules ont été remises en suspension dans du PBS contenant 2% de SVF et 2 mM d'EDTA puis marquées avec l’anticorps anti-CD14 (clone REA599) de Miltenyi Biotec, utilisé au 1/100°. Pour le marquage intracellulaire du TNFa, le kit « Inside Stain » (Miltenyi Biotec) a été utilisé selon le protocole du fabricant. Les cellules ont été fixées pendant 20 min à température ambiante avec 250 pL de la solution Inside Fix puis marquées dans 100 pL de la solution Inside Perm contenant l’anticorps anti-TNFa (clone cA2, Milteniy Bioec) eu 1/50° pendant 30 min à température ambiante. L'acquisition des données a été réalisée sur le cytomètre en flux Canto II en utilisant le logiciel Diva (BD Biosciences, San José, CA). Le logiciel FlowJo a été utilisé pour analyser les données.
Les résultats sont présentés à la Figure 14.
Conclusion :
Il en ressort que les composés de formule (V) et (VI) inhibent la production de TNFa sur monocytes isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive dans les trois conditions testées, à savoir :
- Condition A : 1h avant la stimulation des TLR7/8,
- Condition B : 1h avant la stimulation des TLR4,
- Condition C : 1h avant la stimulation des TLR2. Exemple 7 : Effet des composés de formule (V) et (VI) sur la production de TNFa sur les cellules dentritiques plasmacytoides isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains.
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les études sur du matériel de patients ont été approuvé par le comité de protection des personnes (ID-RCB/EUDRACT : 2014-A01017-40 and 2018- A01358-47). Les cellules dendritiques plasmacytoides (pDC) ont été purifiés par sélection négative avec le Kit d'enrichissement « EasySep Human Plasmacytoid DC » (STEMCELL Technologies). Les cellules dendritiques plasmacytoides (pDC) ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Stimulation cellulaire
Les cellules dendritiques plasmacytoides (pDC) ont été cultivées à 1 ,106/ml. Les cellules ont ensuite été incubées avec les composés de formule (V) et (VI) à 20|JM pendant 1h avant stimulation.
Les cellules dendritiques plasmacytoides ont été stimulés respectivement pendant 16h avec :
- condition A : l’agoniste TLR7/8 Resiquimod - R848 à 5 pg/ml,
- condition B : le virus de la grippe (Flu),
- condition C : l’agoniste TLR9 CpG-A à 5 mM.
Les cellules ont été récupérées pour la cytométrie en flux. Pour le marquage intracellulaire du TNFa, de la Brefeldin A (BFA) a été ajoutée aux cellules 30 minutes après la stimulation.
Cytométrie en flux
Les cellules ont été rincées dans du PBS puis incubées avec un marqueur de viabilité (Zombie Aqua, Biolegend) pendant 30 min à température ambiante. Après lavage, les cellules ont été remises en suspension dans du PBS contenant 2% de SVF et 2 mM d'EDTA puis marquées avec l’anticorps anti-CD14 (clone REA599) de Miltenyi Biotec, utilisé au 1/100°. Pour le marquage intracellulaire du TNFa, le kit « Inside Stain » (Miltenyi Biotec) a été utilisé selon le protocole du fabricant. Les cellules ont été fixées pendant 20 min à température ambiante avec 250 pL de la solution Inside Fix puis marquées dans 100 pL de la solution Inside Perm contenant l’anticorps anti-TNFa (clone cA2, Milteniy Bioec) eu 1/50° pendant 30 min à température ambiante. L'acquisition des données a été réalisée sur le cytomètre en flux Canto II en utilisant le logiciel Diva (BD Biosciences, San José, CA). Le logiciel FlowJo a été utilisé pour analyser les données.
Les résultats sont présentés à la Figure 15.
Conclusion :
Il en ressort que les composés de formule (V) et (VI) inhibent la production de TNFa sur cellules dendritiques plasmacytoides isolés à partir des cellules mononuclées du sang périphérique (PBMC) de donneurs sains, de manière préventive dans les trois conditions testées, à savoir :
- Condition A : 1h avant la stimulation des TLR7,
-Condition B : 1h avant la stimulation par le virus de la grippe (virus influenza),
- Condition C : 1h avant la stimulation des TLR9.
Exemple 8 : Effet des composés de formule (V) et (VI) selon un effet dose, de l’activation du facteur de transcription NFkB dans la lignée monocytaire THP1-dual.
La lignée rapportrice THP1-Dual a été cultivée à 5.105/ml.
Les cellules ont ensuite été incubées soit avec le composé de formule (V), soit avec le composé de formule (VI) aux concentrations indiquées pendant 1h avant stimulation.
Les THP1-Dual ont été stimulées pendant 24h avec :
- l’agoniste TLR7/8 Résiquimod (R848) à 5 ng.mL (voir Figures 16 et 17),
- l’agoniste TLR4- lipopolysaccharide (LPS) à 100 ng.mL (voir Figures 18 et 19)
Test SEAP
Les cellules THP1-Dual expriment le gène rapporteur de la phosphatase alkaline embryonnaire sécrété (SEAP) sous un promoteur contenant 5 copies de l’élément de réponse transcriptionnelle consensus NF-KB. Les cellules THP1-Dual permettent l’étude de la voie NF-kB en surveillant l’activité SEAP. L’activité phosphatase alkaline SEAP est déterminée à l’aide du test enzymatique colorimétrique Quanti-Blue (InvivoGen). Les cellules THP1-Dual sont cultivées en plaque 96 puits (200 pL/puits). Après traitement LPS ou R848, pour chaque puits, 20 pL de milieu de culture sont ajoutés à 180 pL de solution Quanti-Blue et incubés à 37°C pendant 2h. L'absorbance (mesure à 655 nm avec un spectrophotomètre (Modèle 680 Microplate Reader; Biorad) est proportionnelle à l’activité SEAP.
Les résultats sont présentés aux Figures 16 à 19.
Test WST
Les cellules sont cultivées en plaque 96 puits (200 pL/puits). Après traitement LPS ou R848, pour chaque puits, 80 ou 90 pL de milieu de culture sont retirés et 10 pL d’une solution de sel de tétrazolium WST-1 (4-(3-(4-iodophényl)- 2-(4-nitrophényl)-2H-5-tétrazolio) -1,3- benzène disulfonate) (Merck) sont ajoutés aux 100 pL de milieu restants. Le WST-1 est clivé par les réductases de la chaîne respiratoire des mitochondries des cellules vivantes pour donner du formazan de couleur violette et soluble dans l’eau qui agit comme un indicateur de la viabilité cellulaire. Après 2 h d’incubation à 37°C, l'absorbance (mesure à 450 et 655 nm avec un spectrophotomètre (Modèle 680 Microplate Reader; Biorad) est proportionnelle au nombre de cellules viables.
Les résultats sont présentés aux Figures 16 à 19.
Conclusion :
Il en ressort que les composés de formule (V) et (VI) inhibent l’activation du facteur de transcription NFkB dans la lignée monocytaire THP1-dual, selon un effet dose, en réponse soit à la stimulation des Toll-like récepteurs TLR7/8 par R848, soit à la stimulation des Toll- like récepteurs TLR4 par le LPS.
Exemple 9 : Effet des composés de formule (V), (VI), (VIII) et (IX) selon un effet dose, de l’activation du facteur de transcription IRF dans la lignée monocytaire THP1-dual.
Stimulation cellulaire
La lignée rapportrice THP1-Dual a été cultivée à 5.105/ml. Les cellules ont ensuite été incubées avec les composés de formule (V), (VI), (VIII) et (IX) aux concentrations indiquées pendant 1h avant stimulation. Les THP1-Dual ont été stimulées pendant 24h avec l’agoniste de la voie STING, le cGAMP. Test luciferase (luminométrie)
Les cellules THP1-Dual expriment le gène rapporteur de la Lucia luciférase sous un promoteur contenant 5 éléments de réponse IFN. Les cellules THP1-Dual permettent l’étude de la voie IRF en mesurant l’activité Lucia luciférase. L’activité Lucia luciférase est déterminée à l’aide du test Quanti-Luc GOLD (InvivoGen). Les cellules THP1-Dual sont cultivées en plaque 96 puits (200 pL/puits). Après traitement LPS ou R848, pour chaque puits, 10 pL de milieu de culture sont ajoutés à 50 pL de solution Quanti-Luc GOLD et le signal lumineux produit est mesuré à l’aide d’un luminomètre.
Test WST
Les cellules sont cultivées en plaque 96 puits (200 pL/puits). Après traitement LPS ou R848, pour chaque puits, 80 ou 90 pL de milieu de culture sont retirés et 10 pL d’une solution de sel de tétrazolium WST-1 (4-(3-(4-iodophényl)- 2-(4-nitrophényl)-2H-5-tétrazolio) -1,3- benzène disulfonate) (Merck) sont ajoutés aux 100 pL de milieu restants. Le WST-1 est clivé par les réductases de la chaîne respiratoire des mitochondries des cellules vivantes pour donner du formazan de couleur violette et soluble dans l’eau qui agit comme un indicateur de la viabilité cellulaire. Après 2 h d’incubation à 37°C, l'absorbance (mesure à 450 et 655 nm avec un spectrophotomètre (Modèle 680 Microplate Reader; Biorad) est proportionnelle au nombre de cellules viables.
Les résultats sont présentés à la Figure 20.
Conclusion :
Il en ressort que les composés de formule (V), (VI), (VIII) et (IX) inhibent l’activation du facteur de transcription IRF dans la lignée monocytaire THP1-dual, selon un effet dose, en réponse soit à la stimulation de la voie des interférons STING par le cGAMP.
Exemple 10 : Test activité pyruvate kinase
Pyruvate Kinase
PEP + ADP Pyruvate + ATP
L-Lactic Dehydrogenase
Pyruvate + B-NADH L-Lactate + B-NAD
PEP = Phospho(enol)pyruvate
ADP = Adenosine 5'-Diphosphate
ATP = Adenosine 5'-Triphosphate
B-NADH = B-Nicotinamide Adenine Dinucleotide,
Reduced Form B-NAD = B-Nicotinamide Adenine Dinucleotide, Oxidized Form
Les inhibiteurs (2 pL) sont ajoutés à 193 pL d’un mélange contenant PEP, ADP, MgSO4, B- NADH et L-Lactic Dehydrogenase. Après lecture à 340 nm, 7 pL de Pyruvate Kinase sont ajoutés au mélange. Les échantillons sont lus à 340 nm toutes les 1 à 2 min pendant 20 min. Les résultats sont présentés à la Figure 21.
Conclusion :
Il en ressort que les composés de formule (V) et (VI) n’ont aucun impact sur l’activité enzymatique de la pyruvate kinase (PK).
Exemple 11 : Effet anti-inflammatoire spécifique des composés de formule (V) et (VI) sur les cellules de l’immunité
Culture
Les lignées THP1-dual ont été cultivées à 1.106 cellules/ml. Les cellules ont ensuite été incubées avec le composé de formule (V) ou le composé de formule (VI) aux concentrations indiquées pendant 1h avant stimulation.
Stimulation cellulaire
Les THP1-dual (invivogen) ont été stimulés respectivement pendant 16h avec l’agoniste de TLR7/8 (R848) à 5 pg/ml ou pendant 1h avec l’agoniste TLR4 (LPS) à 100 ng.ml. Les cellules ont été lavées en PBS et lysées pour préparer les ARNm en vue d’une analyse par RT-qPCR.
Détection des ARNm codant TNFa, IL6, I L1 p et MCP1 par RT-qPCR
Les ARN totaux sont extraits des cellules avec le kit E.Z.N.A. Total RNA Kit 1 (Omega Biotek) selon les instructions du fournisseur. La concentration en ARN est mesurée à l’aide d’un spectrophotomètre (Nanodrop ND-1000). Les ARN totaux sont rétro-transcrits en ADNc à l’aide du kit Prime Script RT Master Mix (Takara RR036A). La synthèse d’ADNc s’effectue selon le protocole suivant: 300-500 ng d’ARN dans 8 pL d’eau dépourvue de RNAse, additionné de 2 pL du tampon de réaction (contenant la prime script reverse transcriptase, des inhibiteurs de RNAse, des oligodT primer, des random 6mers et le mix de dNTPs). La réaction enzymatique de transcription inverse s’effectue à 37°C pendant 15 min. L’enzyme est inactivée par incubation de l’échantillon à 85°C pendant 15 sec.
La PCR quantitative en temps réel est réalisée selon les conditions suivantes: l’ADNc dilué au 1/10ème est ajouté au mélange suivant: 3.8 pL d’FW, 0, pL amorces sens et antisens (10 pM) (Tableau 3), 5 pL du mélange Absolute qPCR SYBR green contenant la thermostart ADN polymerase, MgCh, SYBR green et les dNTPs (Eurogentec). Les essais sont réalisés en triplicat dans une plaque 384 puits (ThermoScientific). L’amplification de l’ADN par PCR quantitative est réalisée dans l’appareil CFX384 (BioRad) avec le programme suivant : 3 min à 95°C / 5 sec à 95°C et 30 sec à 60°C répété 40 cycles / 2 min à 72°C et 30 sec à 95°C suivi d'une étape de dissociation qui permet de vérifier la spécificité du produit d’amplification. Les données d’amplification d’ADN sont analysées avec le logiciel Bio-Rad CFX Manager.
Tableau 3
Tableau 3: Séquence des amorces utilisées
Résultats :
Les résultats sont présentés aux Figures 22 et 23.
L’activité anti-inflammatoire des composés de formule (V) et (VI) été testée sur la lignée cellulaire monocytaire humaine THP1 (figures 22 et 23). Ces cellules ont été stimulées par un agoniste des TLR7/8 (R848), un agent mimant une infection par un virus à ARN simple brin.
Le composé de formule (V) réduit la transcription du gène codant TNFa, IL6, MCP1 et IL1 p induite par le R848, selon un effet dose, dès 5 pM pour le TNFa, IL6, MCP1 et I L1 dans les monocytes THP1-dual. Le composé de formule (VI) réduit la transcription du gène codant TNFa, IL6, MCP1 et I L1 p induite par le R848, selon un effet dose, dès 2 pM pour le TNFa, IL6, MCP1 et I L1 p dans les monocytes THP1-dual.
Ces résultats confirment que les composés de formule (V) et (VI) exercent un effet immunosuppresseur, qui, de manière dose dépendante, est spécifique des cellules immunitaires. L’activité anti-inflammatoire des composés de formule (V) et (VI) a été testé sur une lignée cellulaire monocytaire humaine THP1 , activée avec du LPS, ligand des récepteurs Toll-Like de type 4 (TLR4), un agent qui mime une infection bactérienne. L’activation de cette voie induit la production de cytokines pro-inflammatoires dont le TNFa, ILip en conséquence de la stimulation transcriptionnelle du gène codant TNFa et I L1 p.
Le composé de formule (V) réduit la transcription du gène codant TNFa et I L1 induite par le LPS, selon un effet dose, dès 5 pM pour le TNFa et I L1 p dans les monocytes THP1-dual. Le composé de formule (VI) réduit la transcription du gène codant TNFa et I L1 p induite par le LPS, selon un effet dose, dès 1 pM pour le TNFa et I L1 b dans les monocytes THP1-dual.
Ces résultats confirment que les composés de formule (V) et (VI) exercent un effet immunosuppresseur, qui, de manière dose dépendante, est spécifique des cellules immunitaires.
Exemple 12 : Validation de la cible ROCK-PDK1
Isolement et culture de leucocytes sanguins
Les expériences in vitro ont été réalisées en utilisant des cellules mononucléaires du sang périphérique humain (PBMC) isolées par densité avec une centrifugation grâce à un milieu de séparation des leucocytes du sang périphérique (Technologies STEMCELL). Le sang des donneurs sains a été obtenu à l’« Etablissement Français du Sang » (convention # 07/CABANEL/106; Paris, France). Les monocytes humains ont été purifiés par sélection positive avec des microbilles CD14 humaines (Miltenyi). Les monocytes ont été cultivés dans du RPMI 1640 (Sigma) contenant 10% de sérum de veau fœtal inactivé et 1 mM de glutamine (Hyclone, Logan, UT).
Traitement des monocytes avec des siARN
Les monocytes ont été cultivés à 1 ,106/ml puis traités avec des siARN à 160nM, qui ciblent l’ARNm codant la kinase PDK1 (siPDKI) (Dharmacon), ou avec des siARN contrôles (siCTL) à 160nM (Qiagen) couplés à un agent de transfection pendant 24h.
Stimulation cellulaire
Les cellules ont été incubées avec les composés de formule (V) et (VI) à 20pM pendant 1h avant stimulation avec l’agoniste des TLR7/8, le R848 à 1pg/ml. Les monocytes ont été analysés en cytométrie en flux. Pour le marquage intracellulaire du TNFa, de la Brefeldin A (BFA) a été ajoutée aux cellules 30 minutes après la stimulation R848. Cytométrie en flux
Les cellules ont été rincées dans du PBS puis incubées avec un marqueur de viabilité (Zombie Aqua, Biolegend) pendant 30 min à température ambiante. Après lavage, les cellules ont été remises en suspension dans du PBS contenant 2% de SVF et 2 mM d'EDTA puis marquées avec l’anticorps anti-CD14 (clone REA599) de Miltenyi Biotec, utilisé au 1/100°. Pour le marquage intracellulaire du TNFa, le kit « Inside Stain » (Miltenyi Biotec) a été utilisé selon le protocole du fabricant. Les cellules ont été fixées pendant 20 min à température ambiante avec 250 pL de la solution Inside Fix puis marquées dans 100 pL de la solution Inside Perm contenant l’anticorps anti-TNFa (clone cA2, Milteniy Bioec) eu 1/50° pendant 30 min à température ambiante. L'acquisition des données a été réalisée sur le cytomètre en flux Canto II en utilisant le logiciel Diva (BD Biosciences, San José, CA). Le logiciel FlowJo a été utilisé pour analyser les données.
Les résultats sont présentés sur la Figure 25.
Conclusion
Il en ressort que les composés de formule (V) et (VI) inhibent la production de TNFa par les monocytes de donneurs sains, traités avec les siARN contrôles (siCTL) et stimulés avec du R848 (agoniste TLR7/8). En revanche, dans les monocytes traités avec les siARN ciblant la kinase PDK1 (siPDKI), les composés de formule (V) et (VI) n’inhibent plus la production de TNFa induite par R848 (voir Figure 25). Ces résultats démontrent que la kinase PDK1 relaie l’action anti-inflammatoire des composés de formules (V) et (VI) dirigés contre la kinase ROCK, validant le complexe ROCK-PDK1 comme cible douée d’activité anti-inflammatoire.

Claims

REVENDICATIONS
1 . Composé de formule (I) : ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’interaction entre la protéine kinase ROCK et la protéine kinase PDK1 , dans lequel :
- m est choisi parmi 0, 1 et 2,
- n est choisi parmi 0, 1 et 2,
- Ri représente un groupe -COR2, où R2 est choisi dans le groupe constitué par un groupe -OH, un groupe -NH2, un groupe alcoxy, un groupe alkylamine, un groupe arylalkylamine, un groupe -NH-NH2, et un groupe -CH2-Ar substitué ou non substitué par au moins un atome d’halogène, où Ar représente un groupe aryle,
- R3 représente un atome d’azote, un groupe -NHCOR7, un groupe -NHCOORs, ou un groupe -COSRg, où R7, Rs et Rg sont des groupes alkyle en Ci à Ce substitués ou non substitués par au moins un atome d’halogène,
- R4 représente un atome d’azote ou un groupe -NH2,
- R5 et Re, identiques ou différents, sont choisi indépendamment l’un de l’autre dans le groupe constitué par un atome d’hydrogène, un groupe -OH, un groupe -NH2, un groupe alcoxy, un groupe thiol, un groupe sulfonamide, un groupe alkylamine et un groupe aryle substitué ou non substitué par au moins par un atome d’halogène, et dans lequel : zz
- les lignes et ✓✓ identiques ou différents, représentent indépendamment l’une de l’autre, une liaison covalente simple ou une liaison covalente triple.
2. Composé de formule (I) ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation selon la revendication 1 , dans lequel Re peut être en position 3, 4 ou 5 sur le cycle. Composé de formule (I) ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation selon l’une des revendications 1 à 2, dans lequel m est 0 et n est 0 et
✓✓ zz dans lequel les liaisons ■= et zz représentent une liaison covalente triple. Composé de formule (II) ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation selon la revendication 3, dans lequel R3, R4 et R6 sont tels que défini dans la formule (I) de la revendication 1 . Composé de formule (I) ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation selon l’une des revendications 1 à 2, dans lequel m est 1 et n est 1 et
// ZZ dans lequel les liaisons et zz représentent une liaison covalente simple. Composé de formule (III) ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation selon la revendication 5, dans lequel Ri, R3, R4, Rs et Re sont tels que défini dans la formule (I) de la revendication 1 .
79 Composé de formule (I) ou un sel pharmaceutiquement acceptable de celui-ci pour son utilisation selon l’une des revendications 1 à 2, dans lequel m est 0 et n est 1 et ✓✓ zz dans lequel la liaison représente une liaison covalente triple et la liaison zz représente une liaison covalente simple.
Composé de formule (IV) ou un sel pharmaceutiquement acceptable de celui-ci, pour son utilisation selon la revendication 7, dans lequel Ri, R3, R4 et Re sont tels que défini dans la formule (I) de la revendication 1.
Composé pour son utilisation selon l’une quelconque des revendications 1 à 8, choisi parmi :
Composition pharmaceutique comprenant au moins un composé selon l’une des revendications 1 à 9 comme principe actif et au moins un excipient pharmaceutiquement acceptable et/ou support et/ou un diluant et/ou un véhicule pharmaceutiquement acceptable.
81 Composition pharmaceutique selon la revendication 10, caractérisée en ce que la composition pharmaceutique comprend en outre au moins un second principe actif. Composition pharmaceutique selon l’une quelconque des revendications 10 à 11 , pour son utilisation dans la prévention et/ou le traitement d’une pathologie nécessitant l’utilisation d’un inhibiteur de l’enzyme ROCK et/ou de l’enzyme PDK1. Composé pour son utilisation selon l’une quelconque des revendications 1 à 9 ou composition pharmaceutique selon l’une quelconque des revendications 10 à 12, dans laquelle la pathologie nécessitant l’utilisation d’un inhibiteur de l’enzyme ROCK et/ou de l’enzyme PDK1 est choisie parmi : les maladies inflammatoires, les infections virales, les infections bactériennes et les maladies auto-immunes.
82
EP22805778.2A 2021-09-27 2022-09-26 Inhibiteurs de l'interaction entre les protéines kinases rock et pdk1 Pending EP4408410A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR2110136 2021-09-27
PCT/EP2022/076610 WO2023046941A1 (fr) 2021-09-27 2022-09-26 Inhibiteurs de l'interaction entre les protéines kinases rock et pdk1

Publications (1)

Publication Number Publication Date
EP4408410A1 true EP4408410A1 (fr) 2024-08-07

Family

ID=78332944

Family Applications (1)

Application Number Title Priority Date Filing Date
EP22805778.2A Pending EP4408410A1 (fr) 2021-09-27 2022-09-26 Inhibiteurs de l'interaction entre les protéines kinases rock et pdk1

Country Status (3)

Country Link
US (1) US20250108029A1 (fr)
EP (1) EP4408410A1 (fr)
WO (1) WO2023046941A1 (fr)

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3157569A (en) * 1962-11-08 1964-11-17 American Cyanamid Co Method of controlling insects with cyanide hydrazones
WO2000006143A1 (fr) * 1998-07-27 2000-02-10 Texas Pharmaceuticals, Inc. Hyperthermie intracellulaire induite chimiquement

Also Published As

Publication number Publication date
US20250108029A1 (en) 2025-04-03
WO2023046941A1 (fr) 2023-03-30

Similar Documents

Publication Publication Date Title
JP6258266B2 (ja) 障害を処置するための方法および組成物
EP2115140B1 (fr) Promédicaments hydrosolubles à charge positive de 1H-imidazo[4,5-c]quinolin-4-amines et composés associés a taux éléves de pénétration cutanée
EP1255551A1 (fr) Utilisation de derives de paullones pour la fabrication de medicaments
CA3139977A1 (fr) Peptidomimetiques pour le traitement d'infections par coronavirus et picornavirus
EP1663219B1 (fr) Derives d'indole pour le traitement de maladies liees au processus d'epissage
CH685629A5 (fr) Inhibiteurs mixtes de la NO synthase et de la cyclooxygénase, un procédé pour leur préparation et des compositions thérapeutiques les contenant.
JP2022511469A (ja) 環状パンテテイン誘導体及びその使用
Cheng et al. Identification of a novel hybridization from isosorbide 5-mononitrate and bardoxolone methyl with dual activities of pulmonary vasodilation and vascular remodeling inhibition on pulmonary arterial hypertension rats
EP4125889A1 (fr) Nouvelles cibles thérapeutiques à effet anti-inflammatoire et anti-interféron
WO2023046941A1 (fr) Inhibiteurs de l'interaction entre les protéines kinases rock et pdk1
EP3981878A1 (fr) Aptamères agonistes du récepteur fpr2 et utilisations de ces derniers
WO2000059448A2 (fr) Association d'inhibiteur(s) de no synthase et d'antioxydant(s) metabolique(s)
JP2021535180A (ja) パーキンソン病の処置の為のpde11又はpde2阻害剤の使用
US20250034194A1 (en) Inhibitors of abnormal phosphorylation and tau protein aggregation
JP2001500526A (ja) 粘液溶解剤としての2−メチル−チアゾリジン−2,4−ジカルボン酸の使用
US20230381174A1 (en) Thionoester-derivative of rabeximod for the treatment of inflammatory and autoimmune disorders
EP2981521A1 (fr) Nouveaux derives de chalcone presentant une activite anti-allergique
US20160194336A1 (en) P38 mapk inhibitors for the treatment of inflammatory diseases
JP2024517654A (ja) レチノイン酸受容体アルファと阻害剤との相互作用を安定化することによる、シャペロン媒介オートファジーを増加させる方法
EP1446161A2 (fr) Association medicamenteuse d'une biguanine (metformine) et d'arginine
WO2023242070A1 (fr) Composés antimicrobiens
JP2024543981A (ja) 炎症性疾患の処置に使用するためのirapアミノペプチダーゼ阻害剤の使用
WO2021262878A1 (fr) Nouvelle molécule pour la modulation de réponses immunitaires innées régulées par une protéine sting
Johnson Protection against Angiotensin II-induced endothelial dysfunction and hypertension via small molecule inhibitors of signal transducer and activator of transcription 3
JP2019182767A (ja) 脊髄小脳変性症31型抑制剤

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20240429

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20260225