EP4358999A1 - Mva-based vaccine expressing a prefusion-stabilized sars-cov-2 s protein - Google Patents

Mva-based vaccine expressing a prefusion-stabilized sars-cov-2 s protein

Info

Publication number
EP4358999A1
EP4358999A1 EP22737464.2A EP22737464A EP4358999A1 EP 4358999 A1 EP4358999 A1 EP 4358999A1 EP 22737464 A EP22737464 A EP 22737464A EP 4358999 A1 EP4358999 A1 EP 4358999A1
Authority
EP
European Patent Office
Prior art keywords
mva
cov
protein
sars
vaccine
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP22737464.2A
Other languages
German (de)
French (fr)
Inventor
Juan Francisco GARCÍA ARRIAZA
Mariano ESTEBAN RODRÍGUEZ
Patricia PÉREZ RAMÍREZ
Adrian LÁZARO FRÍAS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Consejo Superior de Investigaciones Cientificas CSIC
Original Assignee
Consejo Superior de Investigaciones Cientificas CSIC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP21382557.3A external-priority patent/EP4108257A1/en
Application filed by Consejo Superior de Investigaciones Cientificas CSIC filed Critical Consejo Superior de Investigaciones Cientificas CSIC
Publication of EP4358999A1 publication Critical patent/EP4358999A1/en
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/215Coronaviridae, e.g. avian infectious bronchitis virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/275Poxviridae, e.g. avipoxvirus
    • A61K39/285Vaccinia virus or variola virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/24011Poxviridae
    • C12N2710/24111Orthopoxvirus, e.g. vaccinia virus, variola
    • C12N2710/24141Use of virus, viral particle or viral elements as a vector
    • C12N2710/24143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present invention is directed to a recombinant modified vaccinia virus Ankara (MVA) vector comprising a nucleic acid sequence coding for a prefusion-stabilized full- length spike (S) protein of at least one SARS-CoV-2 variant that is useful for vaccinating against SARS-CoV-2.
  • MVA modified vaccinia virus Ankara
  • the present invention is further directed to a vaccine composition containing said recombinant MVA as well as to a method for generating a protective immune response in a mammal against at least one SARS-CoV-2 variant.
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • SARS-CoV-2 Middle East respiratory syndrome coronaviruses
  • Coronavirus virions are decorated with a spike (S) glycoprotein that binds to host cell receptors and mediates cell entry via fusion of the host and viral membranes.
  • S spike
  • This protein is also the main target of neutralizing antibodies.
  • SARS-CoV-2 S ectodomain is unstable and difficult to produce reliably in mammalian cells, hampering the development of S-based vaccines.
  • Prefusion stabilization techniques are aimed at increasing the recombinant expression of viral fusion glycoproteins, possibly by preventing triggering or misfolding that results from a tendency to adopt the more stable postfusion structure.
  • prefusion-stabilized viral glycoproteins are also superior immunogens to their wild-type counterparts, since they represent the primary target of neutralizing antibodies.
  • FIG. 1 Design, generation, and in vitro characterization of MVA-S(3P) vaccine candidate in permissive DF-1 cells.
  • A Genome map of the vaccine candidate MVA- S(3P) [also termed MVA-CoV2-S(3P)]) expressing a prefusion-stabilized coronavirus SARS-CoV-2 S protein. The different regions of the MVA genome are indicated with capital letters and the central conserved region and the left and right terminal regions are shown. Below the map, the deleted or fragmented MVA genes are depicted as black boxes.
  • the coronavirus SARS-CoV-2 S(3P) gene inserted within the MVA TK viral locus (J2R) of MVA-WT parental virus and driven by the sE/L virus promoter are indicated.
  • TK-L TK left
  • TK-R TK right.
  • An scheme of the prefusion-stabilized full-length S protein inserted in the MVA genome is included.
  • S1 and S2 regions are indicated, together with the amino acid mutations in the furin cleavage site and changes to prolines in the S2 region.
  • NTD N-terminal domain
  • RBD receptor binding domain
  • TM transmembrane
  • CT cytoplasmic tail.
  • B PCR analysis of MVA TK locus.
  • Viral DNA was extracted from DF-1 cells that were not infected (mock) or infected with 5 PFU/cell of vaccine candidates MVA-S and MVA-S(3P), or MVA-WT.
  • Oligonucleotides which hybridize in the flanking regions of the TK locus were used for the PCR analysis of the coronavirus SARS-CoV-2 S gene inserted in the TK locus.
  • a molecular weight marker (1 kb) with the corresponding bp sizes is indicated on the left side of the images, and the amplified DNA products are indicated with arrows on the right side.
  • C Expression of the coronavirus SARS-CoV-2 S-protein.
  • DF-1 cells were infected for 24 hours (in the absence or presence of tunicamycin) at 5 PFU/cell with vaccine candidates MVA-S and MVA-S(3P) and MVA-WT.
  • vaccine candidates MVA-S and MVA-S(3P) and MVA-WT.
  • post-infection cells were lysed in Laemmli 1X + b-mercaptoethanol buffer, fractionated by 7% SDS-PAGE, and the presence of the S protein was analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region).
  • a rabbit anti-VACV E3 protein antibody was used as a loading control for the amount of viral proteins.
  • DF-1 cells were infected with MVA-S and MVA-S(3P) vaccine candidates and at 24 hpi, cells were lysed under nonreducing conditions (Laemmli 1X - b-mercaptoethanol buffer), fractionated by 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). Arrows on the right indicates the SARS-CoV-2 S protein in the form of monomers or oligomers. The sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left.
  • E Kinetics of expression of the coronavirus SARS-CoV-2 S protein in cell extracts (pellet) and supernatants (SN) from cells infected with vaccine candidates MVA-S and MVA-S(3P).
  • DF-1 cells were infected with vaccine candidates MVA-S and MVA-S(3P), and MVA-WT, at 5 PFU/cell.
  • the cell extracts and the supernatants were collected 4, 7 and 24 hours post-infection (the supernatants were first precipitated with 10% TCA), lysed in Laemmli 1X + b-mercaptoethanol buffer, fractioned with 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region).
  • the arrows on the right side indicate the S protein.
  • the sizes of standards in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left.
  • FIG. 1 In vitro characterization of vaccine candidate MVA-S(3P) in nonpermissive human HeLa cells.
  • A Expression of the coronavirus SARS-CoV-2 S- protein. HeLa cells were infected for 24 hours (in the absence or presence of tunicamycin) at 5 PFU/cell with vaccine candidates MVA-S and MVA-S(3P) and MVA- WT. At 24 hours post-infection cells were lysed in Laemmli 1X + b-mercaptoethanol buffer, fractionated by 7% SDS-PAGE, and the presence of the S protein was analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region).
  • the cell extracts and the supernatants were collected 4, 7 and 24 hours post-infection (the supernatants were first precipitated with 10% TCA), lysed in Laemmli 1X + b-mercaptoethanol buffer, fractioned with 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region).
  • the arrows on the right side indicate the S protein.
  • the sizes of standards in kilodaltons [kDa]) (Precision Pius protein standards; Bio-Rad Laboratories) are indicated on the left.
  • C Expression of SARS-CoV-2 S protein under nonreducing conditions.
  • HeLa cells were infected with MVA-S and MVA-S(3P) vaccine candidates and at 4, 7 and 24 hpi, cells were lysed under nonreducing conditions (Laemmli 1X - b-mercaptoethanol buffer), fractionated by 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). Arrows on the right indicates the SARS-CoV-2 S protein in the form of monomers or oligomers. The sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left. Figure 3.
  • MVA-S(3P) is stable, express S in the membrane of infected cells and replicates in permissive DF-1 cells.
  • A Genetic stability of vaccine candidate MVA- S(3P). DF-1 cell monolayers were infected with the P2 stock of MVA-S(3P) at a low MOI for 8 serial passages.
  • chick DF-1 cells were the left uninfected (mock) or infected with vaccine candidate MVA-S(3P) from the different passages, or with MVA-WT, and the cells were lysed at 24 hours post-infection in Laemmli 1X + b-mercaptoethanol buffer, fractionated by 7% SDS-PAGE, and analyzed by Western Blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). A rabbit anti-VACV E3 protein antibody was used as a loading control for the amount of viral proteins.
  • the arrows on the right side indicate the position of the S protein or the VACV E3 protein.
  • DF-1 cell monolayers were infected with MVA-WT, MVA-S, and MVA-S(3P) at 0.01 PFU/cell.
  • Cells were collected at different times post-infection (0, 24, 48, and 72 hours) and the viral titers in the cell lysates were quantified by a plaque immunostaining assay with anti-VACV antibodies. The means and standard deviations of the results obtained from two independent experiments are shown.
  • Figure 4 Expression of the S protein in the cell membrane of HeLa cells infected with MVA-CoV2-S(3P), and analyzed by immunofluorescence. Subcellular distribution of the SARS-CoV-2 S protein in cells infected with MVA-S and MVA-S(3P).
  • mice were sacrificed 10 days after the boost (day 25) and the following was obtained: i) spleens of the mice for studying adaptive T cell-mediated immune responses against SARS-CoV-2 by means of ELISpot and ICS, and ii) serum samples originating from blood for studying adaptive humoral immune responses against SARS- CoV-2, by means of ELISA and a neutralization assay.
  • PFU Plaque forming units; i.m.: intramuscular.
  • B and C Titers of binding IgG antibodies specific for the S and RBD proteins at 10 days post-prime (B) or 10 days post-boost (C).
  • Titers were determined by ELISA in individual mice serum samples collected 10 days post-prime or 10 days postboost immunization, and were calculated as the serum dilution (Y axis) at which the absorbance at 450 nm was three times higher than the naive serum value in each of the indicated immunization regimens, shown in the X axis. Dotted line represented the detection limit.
  • Figure 6 SARS-CoV-2 S-specific and RBD-specific lgG1, lgG2b, lgG2c, and lgG3 antibodies induced by vaccine candidate MVA-S(3P) in C57BL/6 mice immunized.
  • Groups of C57BL/6 mice were immunized as represented in Figure 5A.
  • serum samples were collected, and the levels of total coronavirus SARS-CoV-2 S-specific and RBD-specific lgG1, lgG2b, IgG2c, and igG3 in pooled sera from mice derived from each immunization group were analyzed by ELISA.
  • Mean absorbance values (measured at 450 nm) and standard deviations of duplicate pooled serum dilutions are represented.
  • A retrovirus-based pseudoparticles expressing the SARS-CoV-2 S protein
  • B live-virus microneutralization
  • the ID50 titers in the retrovirus-based pseudoparticle assay were determined as the highest serum dilution which resulted in a 50% reduction of luciferase units compared with pseudotyped viruses not incubated with serum.
  • the ID50 titers in the live-virus microneutralization assay were calculated as the reciprocal dilution resulting in 50% inhibition of cell death. Mean ID50 values and SEM for each immunization group is represented. Dotted line represented the detection limit.
  • the NIBSC 20/136 international standard containing pooled plasma obtained from eleven individuals recovered from SARS-CoV-2 infection is included.
  • FIG. 8 ELISpot analysis of the adaptive SARS-CoV-2 S-specific cell-mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice.
  • Six mice per group were sacrificed at 10 days post-boost, and the splenic SARS-CoV-2- specific cells secreting IFN-y were evaluated by an ELISpot assay, as described in Materials and Methods. Samples from each group of mice were analysed in triplicate, and the bars indicate the mean values and the standard deviation. The responses obtained have been obtained by subtracting the RPMI values for each condition and are represented as IFN-g positive ceils per million of splenocytes. The magnitude of SARS- CoV-2-specific cells secreting IFN-g and directed against SARS-CoV-2 S1 and S2 peptide pools is represented.
  • FIG. 9 SARS-CoV-2 S-specific adaptive CD4+ (left) and CD8+ (right) T cell- mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. CD4+ and CD8+ T cell-mediated responses in the splenocytes of mice
  • FIG. 10 Polyfunctionality of SARS-CoV-2 S-specific adaptive CD4+ and CD8+ T cell-mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. Six mice per group were sacrificed at 10 days post-boost, and the splenic SARS-CoV-2-specific CD4+ and CD8+ T cell immune responses were analysed by ICS, as described in Materials and Methods. Polyfunctional profiles of total SARS- CoV-2-specific CD4+ (A) and CD8+ (B) T cell adaptive immune responses directed against a mixture of S1, and S2 SARS-CoV-2 S peptide pools.
  • MVA-S(3P) homologous prime-boost protocol
  • the y-axis indicates the percentage of SARS-CoV-2 S (S1 +S2)- specific CD4+ and CD8+ central memory T cells (TCM; CD127+, CD62L+), effector memory T cells (TEM; CD127+, CD62L-), and effector T cells (TE; CD127-, CD62L-) expressing CD107a and/or IFN-g and/or TNF-a and/or IL-2 (total response).
  • TCM central memory T cells
  • TEM effector memory T cells
  • TE effector T cells
  • the data is depicted with its corresponding confidence intervals.
  • Figure 12 SARS-CoV-2 S-specific adaptive CD4+ T follicular helper (Tfh) cell- mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice.
  • A Magnitude of total SARS-CoV-2-specific adaptive CD4+ Tfh cell immune responses directed against SARS-CoV-2 S protein plus S1 and S2 peptide pools.
  • Percentages of CD4+ Tfh cells (CXCR5+, PD1+) expressing CD40L and/or producing IFN-g and/or IL- 21 against a mixture of SARS-CoV-2 S protein plus S1 , and S2 SARS-CoV-2 S peptide pools are represented.
  • B Percentages of total SARS-CoV-2-specific CD4+ Tfh cells expressing CD40L or producing IFN-y or IL-21 against a mixture of SARS-CoV-2 S protein plus S1, and S2 SARS-CoV-2 S peptide pools.
  • C Polyfunctionality of total SARS-CoV-2-specific adaptive CD4+ Tfh cells directed against a mixture of SARS-CoV- 2 S protein plus S1 and S2 peptide pools. All of the possible combinations of responses are shown on the x axis, while the percentages of T cells expressing CD40L and/or IFN- Y and/or IL-21 against SARS-CoV-2 S protein plus S1 and S2 peptide pools are shown on the y axis.
  • FIG. 13 One dose of MVA-S(3P) protects transgenic K18-hACE2 mice from SARS-CoV-2 infection.
  • mice per group were sacrificed and lungs and serum samples collected as indicated. Serum was also collected at 14 days after immunization and in mice alive at 15 days postchallenge (groups 1 and 2).
  • B, C The challenged mice were monitored for change of body weights (B) and mortality (C) for 15 days.
  • mice were euthanized due to loss of more than 25% of initial body weight.
  • D Virus replication in lung samples.
  • Subgenomic (E) and genomic (RdRp) SARS-CoV-2 RNA detected by RT-qPCR at 4 days after virus infection (n 6).
  • RNA levels in arbitrary units [A.U.]) and SEM from duplicates of each lung sample; relative values are referred to uninfected mice.
  • E SARS-CoV-2 infectious virus in lung samples. Mean (PFU/g of lung tissue) and SEM from triplicates of each lung sample. Student’s t-test: ** P ⁇ 0.005.
  • Fig. 14 One dose of MVA-S(3P) reduced SARS-CoV-2 lung pathology and diminished levels of pro-inflammatory cytokines in K18-hACE2 transgenic mice.
  • B Representative lung histopathological sections (H&E staining) from K18-hACE2 transgenic mice euthanized at day 4 postchallenge. A general view of the lung area (magnification: 4x) along with histopathological details from selected lung areas (black boxes) have been displayed (magnification: 10x).
  • mice vaccinated with one dose of MVA-S and MVA-WT displayed more extensive and severe lung inflammatory lesions compared to mice immunized with one dose of MVA- S(3P) (c).
  • lung inflammatory lesions were characterized by the presence of moderate diffuse thickening of the alveolar septae, perivascular oedema (white arrowheads), moderate presence of mononuclear cell infiltrates within alveolar spaces (black arrows), hyaline membranes and cell debris within alveoli (black arrowheads) as well as the presence of large multifocal perivascular and peribronchiolar mononuclear infiltrates (red arrows).
  • MVA-S(3P) vaccine candidate induced high levels of humoral responses in vaccinated and challenged K18-hACE2 transgenic mice.
  • B SARS-CoV-2 neutralizing antibody titers.
  • NT50 titers were evaluated in individual mouse serum samples collected at day 14 pi and at days 4 and 15 pc, using a live virus microneutralization assay (MAD6 strain, having D614G mutation). Mean NT50 values and SEM are represented. Upper dotted line represents the levels obtained with the NIBSC 20/136 international standard plasma (containing pooled plasma obtained from 11 individuals recovered from SARS- CoV-2 infection). Bottom dotted line represented the limit of detection. (C) SARS-CoV-2 neutralizing antibody titers against SARS-CoV-2 VoC.
  • NT50 titers were evaluated in pooled mouse serum samples collected at days 14 pi (left) and 15 pc (right), using VSV- based pseudoparticles expressing the SARS-CoV-2 S protein of different VoC. Mean NT50 values and 95% confidence intervals are represented. Dashed line represents the limit of detection. Student’s t-test: ** , P ⁇ 0.005; *** P ⁇ 0.001.
  • FIGURE 16 SARS-CoV-2 S-specific T-cell immune responses elicited in C57BL/6 mice immunized with one intranasal dose of MVA-S(3P).
  • (A) Magnitude of S-specific CD4 + (left) and CD8 + (right) T-cell immune responses evaluated at 14 days post-immunization in spleen, lungs and bronchial lymph nodes (BLN). Percentages of CD4 + or CD8 + T cells expressing CD107a and/or producing IFN-y and/or TNF-a and/or IL-2 against a mixture of S1 and S2 peptide pools in immunized mice. Cell percentages were determined by ICS from pools of cells obtained from the different tissues.
  • FIGURE 18 One intranasal dose of MVA-S(3P) protects transgenic K18-hACE2 mice from SARS-CoV-2 infection.
  • A Efficacy schedule.
  • mice were challenged i.n. with 1 x 10 5 PFUs of SARS-CoV-2 (MAD6 isolate).
  • MVA- WT-inoculated mice were also challenged with SARS-CoV-2 and used as a control.
  • mice per group were sacrificed and lungs, nasal washes and serum samples collected as indicated. Serum was also collected at 14 days after immunization and at 14 days postchallenge (in groups 1 , 2 and 3).
  • B, C The challenged mice were monitored for change of body weights (B) and mortality (C) for 14 days. ⁇ : mice were euthanized due to loss of more than 20% of initial body weight.
  • RNA levels in arbitrary units [A.U.]) and SEM from duplicates of each lung and nasal washes samples; relative values are referred to uninfected mice.
  • F, G SARS-CoV-2 infectious virus in lung samples (F) and nasal washes (G).
  • Mean PFUs/g of lung tissue or PFUs per ml of nasal wash) and SEM from triplicates of each sample. Student’s t-test: * , p ⁇ 0.05; ** , p ⁇ 0.005; *** , p ⁇ 0.001.
  • FIGURE 19 One intranasal dose of MVA-S(3P) reduced SARS-CoV-2 lung pathology in K18-hACE2 transgenic mice.
  • FIG. 1 Representative lung histopathological sections (H&E staining) from K18-hACE2 mice euthanized at day 5 postchallenge (magnification: 10x).
  • mice immunized with MVA-S(3P) (c) only displayed small lung areas with mild inflammatory lesions such as focal thickening of alveolar septae, occasional presence of mononuclear cell infiltrates within alveolar spaces (black arrowheads) and mild perivascular or peribronchiolar mononuclear infiltrates (black arrows).
  • FIGURE 20 One intranasal dose of MVA-S(3P) diminished levels of pro- inflammatory cytokines in lung samples and nasal washes from K18-hACE2 transgenic mice.
  • mRNA levels detected by RT-qPCR in lungs (A) and nasal washes (B) (n 4/group) obtained at 5 days postchallenge.
  • FIGURE 21 One intranasal dose of MVA-S(3P) induced high levels of humoral responses in vaccinated and challenged K18-hACE2 transgenic mice.
  • B SARS-CoV-2 neutralizing antibody titers.
  • NTso titers were evaluated in individual mouse serum samples collected at day 14 pi and at days 5 and 14 pc, using a live virus microneutralization assay (MAD6 strain, having D614G mutation). Mean NTso values and SEM are represented. Dotted line represented the limit of detection.
  • C SARS-CoV-2 neutralizing antibody titers against SARS-CoV-2 VoC. NTso titers were evaluated in pooled mouse serum samples collected at days 14 pi (left) and 14 pc (right), using VSV-based pseudoparticles expressing the SARS-CoV-2 S protein of different VoC. Mean NT50 values and 95% confidence intervals are represented. Dashed line represents the limit of detection. Student’s t-test: * , p ⁇ 0.05;
  • FIGURE 22 MVA-S(3P) protects transgenic K18-hACE2 mice from infection with SARS-CoV-2 B.1.351 variant.
  • A Efficacy schedule.
  • At week 8 (day 56) mice were challenged i.n. with 1 x 10 5 PFUs of SARS-CoV-2 (B.1.351 variant of concern).
  • MVA-S(3P) protects transgenic K18-hACE2 mice from infection with SARS-CoV-2 B.1.351 variant.
  • mice WT-inoculated mice were also challenged with SARS-CoV-2 and used as a control. At day 4 postchallenge 3-6 mice per group were sacrificed and lungs, BAL and serum samples collected as indicated. Serum was also collected at 14 days after prime immunization, 21 days after boost, and at days 4 and 10 days postchallenge.
  • B, C The challenged mice were monitored for change of body weights (B) and mortality (C) for 10 days.
  • mice were euthanized due to loss of more than 20% of initial body weight.
  • D, E Virus replication in lung samples (D) and BAL (E).
  • RNA levels in arbitrary units [A.U.]
  • SEM SARS-CoV-2 infectious virus in lung samples
  • BAL BAL
  • Mean PFUs/g of lung tissue or PFUs per ml of BAL
  • FIGURE 23 MVA-S(3P) diminished levels of pro-inflammatory cytokines in lung samples from K18-hACE2 transgenic mice challenged with SARS-CoV-2 B.1.351 variant.
  • mRNA levels detected by RT-qPCR in lungs (n 3-6/group) obtained at 4 days postchallenge.
  • FIGURE 24 MVA-S(3P) induced high levels of humoral responses in vaccinated K18-hACE2 transgenic mice challenged with SARS-CoV-2 B.1.351 variant.
  • B Titers of IgG antibodies against RBD from different SARS-CoV-2 VoC. Determined by ELISA in pooled sera samples collected at days 14 postprime (left) and 21 postboost (right). FIGURE 25.
  • Monkeypox-specific CD8+ T cell-mediated immune responses induced by MVA-S(3P) vaccine candidate in C57BL/6 mice Monkeypox-specific CD8+ T cell-mediated immune responses induced by MVA-S(3P) vaccine candidate in C57BL/6 mice.
  • the y-axis shows the percentage of monkeypox-specific T cells expressing CD107a and/or producing IFN-y and/or TNF-a and/or IL-2.
  • B Adaptive CD8+ T cell-mediated immune responses shown as the percentage of Monkeypox-specific cells expressing CD107a or producing IFN-g or TNF-a or IL-2.
  • C Phenotype profile of monkeypox-specific adaptive CD8+ T ceils.
  • the y-axis indicates the percentage of monkeypox-specific CD8+ central memory T cells (TCM; CD127+, CD62L+), effector memory T cells (TEM; CD127+, CD62L-), and effector T cells (TE; CD127-, CD62L-) expressing CD107a and/or IFN-g and/or TNF-a and/or IL-2 (total response).
  • TCM central memory T cells
  • TEM effector memory T cells
  • TE effector T cells
  • D Polyfunctional profiles of total monkeypox-specific CD8+ T cell adaptive immune responses.
  • SARS-CoV-2 S(3P) protein is expressed at higher levels than a S(2P) protein.
  • Concentration of S(3P) and S(2P) proteins obtained from transfected HEK-293 cells. Measured by ELISA. Optical density at 490 nm in the ELISA assays were corrected by the background signals determined in wells with untransfected cell supernatants. Average of two independent transfections are shown.
  • the conjunctive term "and/or" between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by "and/or", a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term "and/or" as used herein.
  • the expression “at least” or “at least one of as used herein includes individually each of the recited objects after the expression and the various combinations of two or more of the recited objects unless otherwise understood from the context and use.
  • the term “subject” as used herein is a living multi-cellular vertebrate organism, including, for example, humans, non-human mammals and (non-human) primates. The term “subject” may be used interchangeably with the term “animal” herein.
  • the term "enhanced" when used with respect to an immune response against SARS-CoV-2 refers to an increase in the immune response in an animal administered with recombinant MVA according to the present invention relative to the corresponding immune response observed from the animal administered with a vector that does not express any SARS-CoV-2 proteins, e.g., a MVA-WT vector.
  • Modified vaccinia virus Ankara (MVA) vector as used herein is an attenuated replication-deficient vaccinia virus that has been genetically modified to include in its genome foreign DNA (that is, DNA that does not naturally belong to poxviruses).
  • the MVA vector of the present invention has been genetically modified to express SARS-CoV-2 protein(s).
  • the MVA vector of the present invention refers to viral particles of MVA that comprise inside the viral particle the MVA genome, wherein at least one nucleic acid encoding an antigenic protein of at least one SARS-CoV-2 virus subtype has been introduced in the MVA genome.
  • antigenic protein or "antigenic determinant” refers to any molecule that stimulates a host's immune system to make an antigen-specific immune response, whether a cellular response or a humoral antibody response.
  • Antigenic determinants may include proteins, polypeptides, antigenic protein fragments, antigens, and epitopes which still elicit an immune response in a host and form part of an antigen, homologues or variants of proteins, polypeptides, and antigenic protein fragments, antigens and epitopes including, for example, glycosylated proteins, polypeptides, antigenic protein fragments, antigens and epitopes, and nucleotide sequences encoding such molecules.
  • proteins, polypeptides, antigenic protein fragments, antigens and epitopes are not limited to particular native nucleotide or amino acid sequences but encompass sequences identical to the native sequence as well as modifications to the native sequence, such as deletions, additions, insertions and substitutions.
  • epitope refers to a site on an antigen to which B- and/or T-cells respond, either alone or in conjunction with another protein such as, for example, a major histocompatibility complex ("MHC") protein or a T-cell receptor.
  • MHC major histocompatibility complex
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by secondary and/or tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, while epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 5, 6, 7, 8, 9, 10 or more amino acids - but generally less than 20 amino acids - in a unique spatial conformation.
  • Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., "Epitope Mapping Protocols" in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
  • a homologue or variant has at least about 50%, at least about 60% or 65%, at least about 70% or 75%, at least about 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more typically, at least about 90%, 91 %, 92%, 93%, or 94% and even more typically at least about 95%, 96%, 97%, 98% or 99%, most typically, at least about 99% identity with the referenced protein, polypeptide, antigenic protein fragment, antigen and epitope at the level of nucleotide or amino acid sequence.
  • the reference genome in the context of the present invention is GenBank accession number MN908947.3.
  • the reference protein or polypeptide in the context of the present invention is obtained from the translation of the reference genome (GenBank accession number MN908947.3). More preferably, for the S protein, the reference protein is the amino acid sequence of PDB ID 6VSB.
  • sequence identity between nucleic acids and amino acids are known in the art. Two or more sequences can be compared by determining their "percent identity.” The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
  • Percent (%) amino acid sequence identity with respect to proteins, polypeptides, antigenic protein fragments, antigens and epitopes described herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence (i.e., the protein, polypeptide, antigenic protein fragment, antigen or epitope from which it is derived), after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for example, using publically available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximum alignment over the full-length of the sequences being compared. The same applies to "percent (%) nucleotide sequence identity", mutatis mutandis.
  • nucleic acid sequences For example, an appropriate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, (1981), Advances in Applied Mathematics 2:482-489. This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov (1986), Nucl. Acids Res. 14(6):6745-6763. An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wis.) in the "BestFit" utility application.
  • a preferred method of establishing percent identity in the context of the present invention is to use the MPSRCH package of programs copyrighted by the University of Edinburgh, developed by John F. Collins and Shane S. Sturrok, and distributed by IntelliGenetics, Inc. (Mountain View, California). From this suite of packages, the Smith-Waterman algorithm can be employed where default parameters are used for the scoring table (for example, gap open penalty of 12, gap extension penalty of one, and a gap of six).
  • BLAST BLAST
  • Another alignment program is BLAST, used with default parameters.
  • subtype herein includes strains, isolates, clades, lineages, linages, and/or variants of any severe acute respiratory syndrome coronavirus, namely SARS-CoV-2.
  • strain “clade”, “lineage or linage”, “isolate” and/or “variant” are technical terms, well known to the skilled person, referring to the taxonomy of microorganisms, that is, referring to all characterized microorganisms into the hierarchic order of Families, Genera, Species, Strains.
  • a Genera comprises all members which share common characteristics
  • a Species is defined as a polythetic class that constitutes a replicating lineage and occupies a particular ecological niche.
  • strain or "clade” describes a microorganism, for instance, a virus, which shares common characteristics with other microorganisms, like basic morphology or genome structure and organization, but varies in biological properties, like host range, tissue tropism, geographic distribution, attenuation or pathogenicity.
  • variant describes a microorganism, in the present invention, a virus, which replicates and introduces one or more new mutations into its genome which results in differences from the original virus.
  • the terms “variant” and “subtype” are synonymous and are used interchangeably.
  • the term “lineage” or “linage” describes a cluster of viral sequences derived from a common ancestor, which are associated with an epidemiological event, for instance, an introduction of the virus into a distinct geographic area with evidence of onward spread. Lineages are designed to capture the emerging edge of a pandemic and are at a fine-grain resolution suitable to genomic epidemiological surveillance and outbreak investigation.
  • the SARS-CoV-2 lineage nomenclature is described for example, in Rambaut A. et al. A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology. Nat Microbiol. 2020; 5(11): 1403-1407.
  • At least one variant of severe acute respiratory syndrome coronavirus 2 is meant at least one variant, strain, isolate, lineage or linage, and/or clade of the SARS-CoV-2 virus.
  • SARS-CoV-2 can be found in databases such as Emma B. Hodcroft. 2021. “CoVariants: SARS-CoV-2 Mutations and Variations of Interest” (covariants.org/variants) or O’Toole A. et al., 2020 “A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology”, PANGO lineages (cov-lineages.org/).
  • WHO World Health Organization
  • the term “variant” or “linage” includes all SARS-CoV-2 viral sequences that encode for a S protein with a percentage of amino acid sequence identity of at least 90%, 91%, 92%, 93%, 94%, preferably of at least 95%, 96%, 97%, 98%, or 99% from the reference S protein of the reference strain SARS-CoV-2 Wuhan-Hu-1 (GenBank accession No QHD43416.1 or Uniprot ID: P0DTC2), when both S proteins are locally aligned, for example, by using Basic Local Alignment Search Tool (BLAST).
  • BLAST Basic Local Alignment Search Tool
  • an “homologous prime-boost combination” is referred herein as the administration of at least two doses of a vaccine, wherein the vaccine is the same in every dose.
  • heterologous prime-boost combination is referred herein as the administration of at least two doses of a vaccine, wherein the first dose comprises a vaccine that is different from the vaccine comprised in the second or subsequent doses.
  • different is meant herein that either the immunogen is different (different antigen) or that, even if the antigen is the same, it is carried by a different vector, or both (different vector and different antigen).
  • a heterologous prime-boost combination may be a first dose with a DNA-based vaccine, and a second dose with a MVA-based vaccine.
  • Immunogen is referred herein to a protein or a portion thereof that is capable of inducing an immune response in a mammal, such as a mammal infected or at risk of infection with a pathogen.
  • synthetic early/late promoter is referred herein as a vaccinia virus promoter comprising both early and late regulatory elements, wherein said elements overlap in a region of 5 base pairs.
  • Said promoter is widely known in the field, see e.g., Chakrabarti, S.; Sisler, J.R.; Moss, B. Compact, synthetic, vaccinia virus early/!ate promoter for protein expression. Biotechniques 1997, 23, 1094-1097.
  • the synthetic early/late promoter as referred herein comprises or consists of SEQ ID NO 21 or SEQ ID NO 26.
  • Vaccinia virus is amongst the most extensively evaluated live vectors and has particular features in support of its use as a recombinant vaccine: It is highly stable, cheap to manufacture, easy to administer, and it can accommodate large amounts of foreign DNA. It has the advantage of inducing both antibody and cytotoxic T cell responses and allows presentation of antigens to the immune system in a more natural way, and it was successfully used as vector vaccine protecting against several infectious diseases in a broad variety of animal models. Additionally, vaccinia vectors are extremely valuable research tools to analyse structure-function relationships of recombinant proteins, determine targets of humoral and cell- mediated immune responses, and investigate the type of immune parameters needed to protect against a specific disease.
  • VACV is infectious for humans and its use as expression vector in the laboratory has been affected by safety concerns and regulations. Furthermore, possible future applications of recombinant VACV e.g. to generate recombinant proteins or recombinant viral particles for novel therapeutic or prophylactic approaches in humans, are hindered by the productive replication of the recombinant VACV vector. Most of the recombinant VACVs described in the literature are based on the Western Reserve (WR) strain of VACV. On the other hand, it is known that this strain is highly neurovirulent and is thus poorly suited for use in humans and animals (Morita et al., Vaccine 5, 65-70 [1987]).
  • WR Western Reserve
  • VACV vectors from highly attenuated virus strains which are characterized by their restricted replicative capacity in vitro and their avirulence in vivo. Strains of viruses specially cultured to avoid undesired side effects have been known for a long time. Thus, it has been possible, by long-term serial passages of the chorioallantoic VACV Ankara (CVA) strain on chicken embryo fibroblasts, to culture MVA (for review see Mayr, A., Hochstein-Mintzel, V. and Stickl, H. (1975) Infection 3, 6- 14; Swiss Patent No. 568 392).
  • CVA chorioallantoic VACV Ankara
  • the MVA virus was deposited in compliance with the requirements of the Budapest Treaty at CNCM (Institut Pasteur, Collectione Nationale de Cultures de Microorganisms, 25, rue de Dondel Roux, 75724 Paris Cedex 15) on Dec. 15, 1987 under Depositary No. 1-721.
  • the MVA virus has been analysed to determine alterations in the genome relative to the wild type CVA strain.
  • Six major deletions (deletion I, II, III, IV, V, and VI) have been identified (Meyer, H., Sutter, G. and Mayr A. (1991) J. Gen. Virol. 72, 1031-1038).
  • This MVA has only low virulence, that is to say it is followed by no side effects when used for vaccination. Hence it is particularly suitable for the initial vaccination of immunocompromised subjects.
  • the excellent properties of the MVA strain have been demonstrated in a number of clinical trials (Mayr et al., Zbl. Bakt. Hyg. I, Abt. Org. B 167, 375-390 [1987], Stickl et al., Dtsch. med. Wschr. 99, 2386-2392 [1974]).
  • MVA is a valuable tool as safe viral vector for expression of recombinant genes and can be used for such different purposes as the in vitro study of protein functions or the in vivo induction of antigen-specific cellular or humoral immune responses.
  • a major advantage of MVA is to allow for high level gene expression despite being replication defective in human and most mammalian cells.
  • MVA as a vaccine has an excellent safety track-record, can be handled under biosafety level 1 conditions and has proven to be immunogenic and protective when delivering heterologous antigens in animals, and first human candidate vaccines have proceeded into clinical trials.
  • MVA Although unable to multiply in most mammalian cell lines, MVA retains its genome plasticity that allows the insertion of large amounts of foreign DNA (heterologous genes) (Sutter and Moss, 1992). Absence of pathogenicity for humans, inherent aviru!ence even in immunocompromised hosts, high-level expression of foreign antigens and adjuvant effect for immune responses make recombinant MVA (rMVA), expressing heterologous genes, an ideal vector for both prophylactic and therapeutic vaccination, as demonstrated by the wide use in prime-boost immunization strategies as demonstrated by the wide use in prime-boost immunization strategies
  • recombinant MVA (rMVA)-based vaccines comprising heterologous genes and therefore expressing heterologous proteins are able to elicit both humoral and cell- mediated adaptive immune responses (Ramirez et al., 2000) and have been proved to be protective in animal models of several infectious diseases (Garcia-Arriaza et al., 2014, Journal of Virology (Chikungunya) Perez et al., 2018, Scientific Reports (Zika) Lazaro-Frias et al., 2018 (Ebola) Gomez et al., 2013; Marin et al., 2019, Journal of Virology (Hepatitis C) Garcia.-Arriaza et al., 2021 (SARS-CoV-2)).
  • VACV recombinant VACV
  • Highly immunogenic viral proteins such as the S protein of SARS-CoV-2 virus
  • S protein of SARS-CoV-2 virus are usually elusive and present several mechanisms to mislead the immune system and avoid the straightforward generation of neutralizing antibodies.
  • Some of the mechanisms used to evade the immune system of the host imply conformational changes that may also be important for viral cycle.
  • it is particularly relevant the transition between the prefusion state of the S protein, that is naturally present in the viral particles when they are free in the media, to the postfusion state, that occurs after the binding of the S protein to the host cell receptor.
  • the S protein is first produced as a precursor that trimerizes and is thought to be cleaved by a furin-like protease into two fragments: the receptor-binding fragment S1 and the fusion fragment S2.
  • Binding through the receptor-binding domain (RBD) comprised in the S1 to a host cell and further proteolytic cleavage at a second site in S2 are believed to trigger dissociation of S1 and irreversible refolding of S2 into a postfusion conformation, a trimeric hairpin structure formed by heptad repeat 1 (HR1 ) and heptad repeat 2 (HR2). These large structural rearrangements bring together the viral and cellular membranes, ultimately leading to fusion of the two bilayers.
  • rMVA-based vaccines would or not be capable of generating a strong immunogenic and protective immune response against the prefusion-stabilized S protein from SARS-CoV-2 virus in a subject in need thereof.
  • the authors of the present invention have redesigned the S protein of SARS-CoV-2 virus by introducing modifications into the wildtype S amino acid sequence and they have found and demonstrated that a vaccine comprising an immunologically effective amount of a MVA vector expressing a prefusion-stabilized SARS-CoV-2 S protein (termed MVA-CoV2-S(3P), which will also be referred to as MVA-S(3P) throughout the text and figures) is capable of generating a strong immunogenic and protective immune response against the SARS-CoV-2 virus in a subject in need thereof, remarkably only after one dose of the vaccine.
  • the prefusion- stabilized S protein disclosed herein comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V98
  • mice vaccinated with one intramuscular dose of MVA-S(3P) generated higher neutralizing antibodies and higher anti-S and anti-RBD IgG antibodies than the parental MVA-CoV2-S vector (also termed MVA-S) (Fig. 5, 7, and 15), in which the S protein does not comprise the substitutions R682G, R683S, R685S, A942P, K986P and V987P and therefore the vector MVA- CoV2-S does not produce a prefusion-stabilized S protein.
  • MVA-S(3P) enhances the titers of neutralizing antibodies against parental Wuhan strain and variants of concern (Fig. 15C).
  • mice vaccinated with MVA-S(3P) did not present a reduction in body weight due to the infection, while mice vaccinated with MVA-CoV2-S suffered loss of body weight, indicating that the virus caused an infection in these animals (see Fig. 13B).
  • vaccination with one dose of MVA-S(3P) was highly effective to prevent SARS-CoV-2 replication and virus yields at 4 days postchallenge in lung samples (Fig. 13D and 13E), to reduce lung pathology (Fig.
  • the vector MVA-S(3P) is able to generate higher neutralizing antibody titers than parental MVA-S after one dose (10 days post prime) (Fig. 7A). All these higher humoral immune responses elicited by MVA-S(3P) are in accordance with the findings described above that the vector MVA- S(3P) protects more efficiently and without the course of symptoms than MVA-S after a single dose of the vaccine prior a SARS-CoV-2 challenge.
  • the present invention thus provides a homologous prime/boost vaccine combination comprising:
  • composition comprising an immuno!ogical!y effective amount of the rMVA vector provided herein;
  • compositions comprising an immunologically effective amount of the rMVA vector provided herein; wherein one of the compositions is a priming composition and the other composition is a boosting composition.
  • Such response is particularly strong when the composition comprises the MVA-S(3P) provided herein.
  • Intranasal administration of one dose of MVA-S(3P) of the present invention also prevented morbidity (see Fig. 18B) and mortality (see Fig. 18C) in SARS-CoV-2 challenged K18-hACE2 mice, reducing SARS-CoV-2 virus replication in lungs and nasal washes (see Fig. 18D to 18G), thereby reducing lung pathology (see Fig. 19) and the levels of pro-inflammatory cytokines in lungs and nasal washes (see Fig. 20).
  • MVA-S(3P) of the present invention also prevented morbidity (see Fig. 22B) and mortality (see Fig. 22C) of K18-hACE2 mice challenged with SARS-CoV-2 B.1.351 (beta) variant, reducing SARS-CoV-2 virus beta variant replication in lungs and BAL (see Fig. 22D to 22G), thereby reducing the levels of pro-inflammatory cytokines in lungs (see Fig. 23).
  • high titers of binding IgG antibodies that were directed not only against Wuhan variant, but also against other variants of concerns were induced (see Fig. 24).
  • the present invention also provides a heterologous prime/boost vaccine combination comprising:
  • composition comprising an immunologically effective amount of the rMVA vector provided herein;
  • composition comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant; wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order.
  • a composition comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant; wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order.
  • Such response may be particularly strong when the composition comprising the MVA-S(3P) provided herein is given as a boost.
  • the invention provides, for the first time, enhanced and effective vaccines or vaccine combinations for use in generating a protective immune response against infections by at least one SARS-CoV-2 variant or linage and vaccines or vaccine combinations which can be used for manufacturing of a vaccine against at least one SARS-CoV-2 variant or linage.
  • a first aspect of the present invention provides a vaccine composition
  • a vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid encoding a SARS-CoV-2 spike (S) protein, or an immunogenic fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment comprise amino acid substitutions aimed at enhancing the stability of the prefusion state of the S protein or fragment therefrom, and wherein the MVA vector regulates the expression of the nucleic acid encoding said stabilized prefusion S protein or fragment thereof.
  • MVA modified vaccinia virus Ankara
  • the redesigned S protein encoded by the genome of MVA contains amino acid substitutions that enhance stability of the prefusion S structure. These include mutations that inactivate the S1/S2 cleavage site, and mutations in HR1 that remove any strain in the turn region between HR1 and CH, i.e., to prevent the formation of a straight helix during fusion.
  • the resigned S protein can additionally contain a truncation of the HR2 motif. Truncation of the HR2 domain leads to disruption of the HR1/HR2 fusion core and also stabilizes the prefusion S structure.
  • the S protein or an immunogenic fragment of said S protein comprising at least one epitope comprises at least one, two, preferably three, amino acid substitutions to inactivate the S1/S2 furin cleavage site. Inactivation of this cleavage site can be achieved by a number of sequence alterations (e.g., deletions or substitutions) within or around the site.
  • One mutation that inactivates the cleavage site without otherwise impacting the structure of the protein is substitution of residues 682 RRAR 685.
  • the amino acid numbering used as reference is the one based on cryo-EM model PDB ID 6VSB or GenBank accession number MN908947.3.
  • said inactivation of the S1/S2 cleavage site is achieved by introducing at least one, two, or three of the amino acid substitutions selected from the list consisting of R682G, R683S or R685S. More preferably, the S protein or the immunogenic fragment thereof comprises at least the three amino acid substitutions R682G, R683S and R685S.
  • the soluble SARS-CoV-2 immunogen polypeptides can additionally contain a double mutation in the HR1 region that remove strain in the turn region (between HR1 and CH motifs) during fusion by preventing the formation of a straight helix.
  • the S protein, or an immunogenic fragment thereof, encoded by the nucleic acid comprised in the MVA vector of the present invention further comprises other amino acid substitutions aimed at maintaining the quaternary structure of the S protein in a prefusion state or form.
  • a “prefusion protein” or a “protein in a prefusion state or form” is meant a S protein or a fragment of said protein that are designed to be stabilized in a prefusion conformation, preventing structural rearrangements that usually take place when the protein interacts with its receptor or other protein.
  • a strategy to stabilize the S protein in a prefusion conformation is eliminating the causes of metastability by amino acid substitutions in various regions of S, particularly HR1 and in HR2.
  • amino acid substitutions to proline are performed in the S protein to provide a prefusion S protein.
  • said amino acid substitutions aimed at maintaining the prefusion quaternary structure of the S protein are selected from the group including, but not limited to, T961D, G769E, L938F, F817P, A942P, S884C, A892P, A899P, A893C, T859K, Q957E, Q895P, T912P, K921P, G946P, or S975P, or any combination thereof.
  • additional mutations of the wildtype soluble S sequence can be introduced to destabilize the postfusion S structure.
  • one or more proline and/or glycine substitution can be engineered in the region of HR1 that interacts with HR2 to form the fusion core. These substitutions function to disrupt the six-helix- bundle fusion core.
  • the mutations can include A942P, S943P, A944P, A942G, S943G and A944G.
  • the substitutions function to disrupt the six-helix-bundle fusion core.
  • the mutations can include S924P, T925P, A926P, S924G, T925G, and A926G.
  • one or more extra amino acid residues can be inserted into the region of HR1 that interacts with HR2 to form the fusion core. Similarly, these insertions also function to disrupt helical pattern of the fusion core.
  • the insertions can include insertion of G or GS between any residues in A942-A944.
  • the substitutions may be double amino acid substitutions such as K986G/V987G, K986P/V987P, K986G/V987P or K986PA/987G.
  • the S protein or the immunogenic fragment thereof comprise at least one, two or three of the substitutions A942P, K986P and V987P.
  • the S protein or the immunogenic fragment thereof encoded by the nucleic acid comprised in the MVA vector provided herein comprise at least the three substitutions A942P, K986P and V987P.
  • the S protein or the immunogenic fragment thereof encoded by the nucleic acid comprised in the MVA vector provided herein comprises the above mentioned substitutions to avoid the furin cleavage in combination with the above mentioned substitutions to maintain the S protein in a prefusion state.
  • the vaccine composition according to the first aspect or any of its embodiments comprises an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
  • the S protein encoded by the nucleic acid comprised in the MVA vector comprises, consists or consists essentially of the full-length S protein of at least a SARS-CoV-2 variant or linage.
  • the full-length S protein comprises or consists of amino acids 1 to 1273.
  • the S protein of at least a SARS-CoV-2 virus encoded by the nucleic acid comprised in the MVA-S(3P) vector according to the first aspect of the present invention comprises, consists, or consists essentially of SEQ ID NO: 1 or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 1.
  • nucleic acid of the vaccine composition described herein may also optionally encode antigenic domains or antigenic protein fragments rather than the entire antigenic S protein.
  • These fragments can be of any length sufficient to be antigenic or immunogenic as long as they comprise at least the amino acid substitutions R682G, R683S, R685S, A942P, K986P and V987P. Fragments can be at least 300 amino acids long, but can be longer, such as, e.g., at least 350, 400, 500, 600, 700, 800, 900, 1000, 1200 amino acids long, or any length in between.
  • At least one nucleic acid fragment encoding an antigenic S protein fragment or immunogenic S polypeptide thereof is inserted into the genome of the recombinant viral vector of the invention.
  • about 2-6 different nucleic acids encoding different antigenic proteins are inserted into the genome of the recombinant viral vector.
  • multiple immunogenic fragments or subunits of various proteins can be inserted. For example, several different epitopes from different sites of a single protein or from different proteins of the same SARS-CoV-2 strain, or from a S protein orthologue from different strains can be expressed from the vectors.
  • the S protein consists of a truncated protein lacking at least 5, 10, 15, 20, 15, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, or more than 400 amino acid of the full-length S protein.
  • the S protein consists of a truncated protein where the N-terminal domain has been removed.
  • the S protein consists of a truncated protein where the C-terminal domain has been removed.
  • the S protein consists of a truncated protein consisting of only the S1 and S2 subunits.
  • the S protein consists of a truncated protein where the cytosolic domain has been removed.
  • the S protein consists of a truncated protein where the transmembrane domain has been removed. In some embodiments, the S protein consists of a soluble S protein wherein the transmembrane and the cytosolic domains has been removed.
  • a "fragment" of the S protein of at least a SARS-CoV-2 virus according to the present invention is a partial amino acid sequence of the SARS-CoV-2 S protein or a functional equivalent of such a fragment.
  • a fragment is shorter than the full-length complete SARS-CoV-2 S protein and preferably comprises or consists of the amino acids 682-987 of the full-length S protein.
  • a fragment of the SARS-CoV-2 S protein also includes peptides having at least 15, 20 or 25 contiguous amino acid residues having at least about 70%, at least about 80%, at least about 90%, preferably at least about 95%, more preferably at least 98% sequence identity with at least about 15, 20 or 25 contiguous amino acid residues of SEQ ID NO: 2 having about the same length as said peptides.
  • a fragment that "corresponds substantially to" a fragment of the SARS-CoV-2 S protein is a fragment that has substantially the same amino acid sequence and has substantially the same functionality as the specified fragment of the SARS-CoV-2 S protein.
  • a fragment that has "substantially the same amino acid sequence" as a fragment of the SARS-CoV-2 S protein typically has more than 90% amino acid identity with this fragment. Included in this definition are conservative amino acid substitutions.
  • the antigenic protein is the structural protein S of SARS-CoV-2 resulting in vaccine compositions comprising the MVA-S(3P) vector, preferably the antigenic protein is the protein of SEQ ID NO 2, more preferably the antigenic protein is the protein of SEQ ID NO 2 encoded by the nucleic acid consisting of SEQ ID NO 1, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 1.
  • the S protein of at least a SARS-CoV-2 virus encoded by the nucleic acid comprised in the MVA-S(3P) vector according to the first aspect of the present invention comprises, consists, or consists essentially of SEQ ID NO: 2 or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 2 (amino acids 1 to 1273 encoded by the reference genome of GenBank accession number MN908947.3, or amino acids of the reference S protein PDB ID 6VSB).
  • the nucleic acid encoding the antigenic protein is incorporated or inserted into a non-essential region of the genome of the MVA.
  • the nucleic acid encoding the antigenic protein is incorporated into the MVA by substituting a non-essential region of the genome of the MVA.
  • the nucleic acid encoding the S protein is incorporated or inserted into the MVA thymidine kinase (TK) locus or hemagglutinin (HA) locus.
  • the transfer vector is the pCyA vector.
  • the pCyA vector has been previously described in WO 2014/162031 A1.
  • the vaccine composition comprises an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, wherein the S protein or the fragment thereof are inserted into the TK locus of the MVA genome, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
  • the intermediate MVA recombinant viruses Upon homologous recombination by means of an infection with parental virus followed by a transfection with the plasmid transfer vector, selection and purification of recombinant viruses encoding the antigenic protein is performed.
  • the intermediate MVA recombinant viruses also expresses marker genes that facilitate the tracking and selection of the desired final recombinant viruses.
  • the intermediate recombinant MVA viruses might express b-galactosidase gene, a fluorescent protein such as the green fluorescent protein (GFP), or an antibiotic resistance gene.
  • VACV vectors early expression of antigens by VACV vectors is crucial for efficient antigen-specific CD8 and/or CD4 T cell responses.
  • the specific properties of the early elements poxviral promoters might thus be crucial for induction of an antigen-specific T cell response.
  • the nucleic acid encoding for the S protein, or an immunogenic fragment thereof, comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P and of at least one SARS-CoV-2 variant or linage is operably linked and under the control of a VACV-specific promoter, an orthopox virus- specific promoter, a poxvirus-specific promoter or a synthetic promoter.
  • a number of promoters may be used for the present invention.
  • promoters such as the 30K and 40K promoters (US 5,747,324, A Strong Synthetic Early-Late Promoter (Sutter, et al., Vaccine (1994), 12, 1032-1040)), the P7.5 promoter (Endo et al., J. Gen. Virol. (1991) 72, 699-703), a promoter derived from the cow pox virus type A (inclusion ATI gene) (Lee et al., J. Gen. Virol. 1998), 79, 613), and the new synthetic late-early optimized (LEO) promoter (Di Pilato et al. J Gen Virol.
  • the promoter is the synthetic early-late (sE/L) promoter.
  • the nucleic acid encoding for the prefusion-stabilized S protein, or a fragment thereof, comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P of at least one SARS-CoV-2 variant or linage is operably linked and under the control of a synthetic promoter.
  • Synthetic promoters are DNA sequences that do not exist in nature and which are designed to regulate the activity of genes to which they are operably linked, controlling a gene's ability to produce its encoded protein.
  • the synthetic promoter drives the expression of the antigenic protein early during infection. For instance, in an embodiment, the expression of the antigenic protein can be detected as early as 3-hour post-infection.
  • the synthetic promoter may also drive the expression of the antigenic protein late during infection.
  • the expression of the antigenic protein is operably linked and under the control of a synthetic promoter that drives the expression of the antigenic protein both, early and late, during viral infection.
  • the synthetic promoter may be comprised by one or more elements driving early expression of said antigen.
  • the synthetic promoter may be comprised by one or more elements driving late expression of said antigen.
  • Different types of synthetic early/!ate promoters are further described in WO 2010/102822 A1.
  • the synthetic promoter is formed by both early and late elements, referred as sE/L promoter (Chakrabarti, S.; Sisler, J.R.; Moss, B. Compact, synthetic, vaccinia virus early/late promoter for protein expression.
  • the vaccine composition comprises an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operab!y linked to an early/late promoter from VACV, preferably the synthetic early/late promoter; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
  • a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions
  • the nucleic acid encoding for the prefusion-stabilized S protein, or a fragment thereof, comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P of at least one SARS- CoV-2 variant or linage is operably linked and under the control of the synthetic early/late promoter, wherein the synthetic early/late promoter comprises or consists of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26.
  • the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operably linked to an early/!ate promoter from VACV, preferably the synthetic early/late promoter; wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
  • a Kozak sequence can be added downstream the synthetic early/late promoter.
  • downstream refers to a nucleotide sequence that is located 3’ to a reference nucleotide sequence, in this case to the synthetic early/late promoter.
  • the nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, and that is operably linked to the synthetic early/late promoter further comprises a Kozak sequence located downstream the synthetic early/late promoter.
  • said Kozak sequence comprises or consists of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22.
  • the nucleic acid inserted in MVA genome according to the invention can further encode for one or more antigenic proteins that can be any protein(s) from any SARS-CoV-2 virus variant or linage.
  • the nucleic acid comprised in the MVA vector further encodes for one or more antigenic proteins selected from the group consisting of structural proteins E (envelope), receptor-binding domain (RBD), N (nucleocapsid) or M (membrane), or any combination thereof, from at least one SARS-CoV-2 variant.
  • said further antigenic proteins are inserted in a different locus of the MVA genome, preferably in the HA locus.
  • said further antigenic proteins are placed under the control of a synthetic VACV promoter, preferably the synthetic early/late promoter.
  • the MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from a variant of concern (VOC) as defined by the Centers for Disease Control and Prevention (CDC) “SARS-CoV-2 Variant Classifications and Definitions”.
  • VOC variant of concern
  • CDC Centers for Disease Control and Prevention
  • VOC variant of concern
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage is derived from the Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947).
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage is derived from the United Kingdom SARS-CoV-2 variant VOC 202012/01 (Lineage B.1.1.7, also known as VOC alpha).
  • VOC-202012/01 variant has been reported in 31 other countries/territories/areas in five of the six WHO regions.
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from the South African SARS-CoV-2 variant (Lineage B.1.351, also known as VOC beta).
  • South Africa On 18 December 2020, national authorities in South Africa announced the detection of a new variant of SARS-CoV-2 that is rapidly spreading in three provinces of South Africa. South Africa has named this variant as Lineage B.1.351 , also known as 501Y.V2. This variant is described in the scientific literature, see, e.g., Tegally et al.
  • SARS-CoV-2 severe acute respiratory syndrome-related coronavirus 2
  • SARS-CoV-2 South African variant is characterised by three mutations K417N, E484K and N501Y in the RBD. While SARS-CoV-2 VOC 202012/01 from the UK also has the N501Y mutation, phylogenetic analysis has shown that the virus from South Africa are different virus variants.
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from the Brazilian SARS-CoV-2 variant VOC-202101/02 (Linage B.1.1.28, also known as VOC gamma).
  • Brazilian variant is also known as Lineage P.1, also known as 20J/501Y.V3, Variant of Concern 202101/02 (VOC-202101/02). This variant is described in the scientific literature, see, e.g., Faria, et al. Genomic Characterisation of an Emergent SARS-CoV-2 Lineage in Manaus: Preliminary Findings.
  • SARS-CoV-2 has 17 unique amino acid changes, ten of which are in its S protein, including these three designated to be of particular concern: N501Y, E484K and K417T.
  • This variant of SARS-CoV-2 was first detected by the National Institute of Infectious Diseases (NIID), Japan, on 6 January 2021 in four people who had arrived in Tokyo having visited Amazonas, Brazil four days earlier. It was subsequently declared to be in circulation in Brazil and spreading around the world.
  • NIID National Institute of Infectious Diseases
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from the Californian SARS-CoV-2 (Linage B.1.427 or B.1.429, also known as variant of interest epsilon).
  • This variant is characterized by the mutations S131 , W152C in the N-terminal domain (NTD) of the S protein and by the L452R mutation in the RBD of the S protein. This variant was originally detected in
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from a SARS-CoV-2 variant or linage selected from the group including, but not limited to, Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), Linage B.1.1.28 (Brazilian variant), Linage B.1.351 (South African variant), Linage B.1.427 or Linage B.1.429 (California variant), Linage B.1.617 (Indian variant), or Linage B.1.1.7 (United Kingdom variant), or Linage B.1.1.529 (Omicron variant) or any combination thereof.
  • Wuhan-Hu-1 seafood market pneumonia virus isolate GenBank accession number: MN908947
  • Linage B.1.1.28 Brazilian variant
  • Linage B.1.351 South African variant
  • Linage B.1.427 or Linage B.1.429 Californ
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage is derived from a SARS-CoV-2 variant selected from the group consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), Linage B.1.1.28 (Brazilian variant), Linage B.1.351 (South African variant), Linage B.1.427 or Linage B.1.429 (California variant), Linage B.1.617 (Indian variant), or Linage B.1.1.7 (United Kingdom variant), or Linage B.1.1.529 (Omicron variant), or any combination thereof.
  • Wuhan-Hu-1 seafood market pneumonia virus isolate GenBank accession number: MN908947
  • Linage B.1.1.28 Brazilian variant
  • Linage B.1.351 South African variant
  • Linage B.1.427 or Linage B.1.429 California variant
  • Linage B.1.617 Indian variant
  • the Indian variant or B.1.617 linage includes the Delta variant or Linage B.1.617.2.
  • the Omicron variant or linage B.1.1.529 includes BA.1 , BA.2, BA.3, BA.4, BA.5 and descendent lineages.
  • the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage is derived from a SARS-CoV-2 variant or linage selected from the group including or consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), linage B.1.1.7 (alpha VOC), linage B.1.351 (beta VOC), linage B.1.1.28 or P1 (gamma VOC), linage B.1.617.2 (delta VOC), linage B.1.1.529 (omicron VOC), or other lineages such as linage B.1.427 or Linage B.1.429 (epsilon variant of interest), or any combination thereof.
  • Wuhan-Hu-1 seafood market pneumonia virus isolate GenBank accession number: MN908947
  • linage B.1.1.7 alpha VOC
  • linage B.1.351 beta VOC
  • the MVA vector provided in the first aspect of the present invention or in any of its embodiments comprises at least one nucleic acid encoding the S protein of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), or a fragment of said S protein comprising at least one epitope, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operably linked to an early/late promoter from VACV, preferably the synthetic early/late promoter; wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
  • the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, preferably Wuhan variant, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operably linked to an early/late promoter from VACV, preferably the synthetic early/late promoter; wherein said nucleic acid is inserted into the TK locus of the MVA genome; wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof, and wherein said nucleic acid is codon optimized for
  • the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises, from 5 ' to 3 ' , at least the following sequences: i) the synthetic early/late promoter comprising or consisting of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26, ii) a Kozak sequence comprising or consisting of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22, iii) at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising
  • the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises, from 5 ' to 3 ' , at least the following sequences: i) the synthetic early/late promoter comprising or consisting of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26, ii) a Kozak sequence comprising or consisting of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22, and iii) at least one nucleic acid encoding the S protein of at least one SARS-CoV-2 variant or linage, preferably Wu
  • the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises, preferably from 5 ' to 3 ' , at least the following sequences: i) the synthetic early/late promoter comprising or consisting of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26, ii) a Kozak sequence comprising or consisting of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22, and iii) at least one nucleic acid encoding the S protein, wherein the amino acid protein of said S protein comprises or consists of S
  • nucleic acid encoding for the S protein or the fragment as defined in iii) is operably linked to the synthetic early/late promoter as defined in i), wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein.
  • the nucleic acid comprised in the MVA vector comprises, consists, or consists essentially of SEQ ID NO: 23, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 23.
  • Rational design of S-based vaccines also provides the generation of chimeric S proteins comprising the most dominant antigenic epitopes from more than one SARS-CoV-2 variants or linages.
  • the S protein, or a fragment of said S protein comprising at least one epitope comprises or consists of the sequences of two or more SARS-CoV-2 variants or linages.
  • the S protein, or a fragment of said S protein comprising at least one epitope comprises or consists of a consensus sequence derived from two or more different SARS-CoV-2 variants or linages.
  • compositions and vaccines suitable for inducing an immune response in a living animal body, including a human against the SARS-CoV-2 virus.
  • the vaccines of the first aspect preferably comprise the MVA vector described herein formulated in solution in a concentration range of from 1 x 10 7 to 1 x 10 8 PFUs per dose.
  • FIGs 5-15 show that immunogenicity was induced in vaccinated mice with an intramuscular dose of 1 x 10 7 PFUs per dose (see immunization schedule in Figures 5 and 13). Further, as shown in Figure 13, mice were vaccinated with a single dose of 1x10 7 PFUs of MVA-S(3P), which indicates that this dose is sufficient to induce protective immunity that leads to 100% survival upon a lethal challenge with SARS-CoV-2.
  • mice vaccinated with MVA-S(3P) did not show any weight loss nor disease symptoms, indicating that the vaccine is not only able to protect mice from a lethal challenge, but it is able to stop and/or reduce viral infection and the symptoms associated to it at early times upon challenge, as it is described in Figure 13D and 13E.
  • one single intramuscular dose of MVA-S(3P) reduced lung pathology and levels of proinflammatory cytokines, as shown in Figure 14.
  • one single intranasal dose of 1 x 10 7 PFUs of MVA-S(3P) induced in mice local and systemic SARS-CoV-2-S-specific CD4+ and CD8+ T-cell immune responses see Fig.
  • Intranasal administration of one dose of 1 x 10 7 PFUs of MVA-S(3P) of the present invention also prevented morbidity (see Fig. 18B) and mortality (see Fig. 18C) in SARS-CoV-2 challenged K18-hACE2 mice, reducing SARS-CoV-2 virus replication in lungs and nasal washes (see Fig. 18D to 18G), thereby reducing lung pathology (see Fig. 19) and the levels of pro-inflammatory cytokines in lungs and nasal washes (see Fig. 20).
  • the vaccine compositions provided herein in the first aspect may generally include one or more pharmaceutically acceptable and/or approved carriers, additives, antibiotics, preservatives, adjuvants, diluents and/or stabilizers.
  • auxiliary substances can be water, saline, glycerol, ethanol, wetting or emulsifying agents, pH buffering substances, or the like.
  • Suitable carriers are typically large, slowly metabolized molecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates, or the like.
  • the recombinant MVA viruses provided herein can be converted into a physiologically acceptable form. This can be done based on experience in the preparation of poxvirus vaccines used for vaccination against smallpox as described by H. Stickl et a!., Dtsch. med. Wschr. 99:2386-2392 (1974).
  • purified viruses can be stored at -80°C with a titer of 5 x 10 8 PFUs/ml formulated in about 10 mM Tris, 140 mM NaCI pH 7.4.
  • a titer of 5 x 10 8 PFUs/ml formulated in about 10 mM Tris, 140 mM NaCI pH 7.4.
  • particles of the virus can be lyophilized in 100 ml of phosphate-buffered saline (PBS) in the presence of 2% peptone and 1% human albumin in an ampoule, preferably a glass ampoule.
  • the vaccine shots can be produced by stepwise freeze-drying of the virus in a formulation.
  • This formulation can contain additional additives such as mannitol, dextran, sugar, glycine, lactose or polyvinylpyrrolidone or other aids such as antioxidants or inert gas, stabilizers or recombinant proteins (e.g., human serum albumin) suitable for in vivo administration.
  • additional additives such as mannitol, dextran, sugar, glycine, lactose or polyvinylpyrrolidone or other aids such as antioxidants or inert gas, stabilizers or recombinant proteins (e.g., human serum albumin) suitable for in vivo administration.
  • the glass ampoule is then sealed and can be stored between 45°C and room temperature for several months. However, as long as no need exists, the ampoule is stored preferably at temperatures below -20°C.
  • the lyophilizate can be dissolved in an aqueous solution, preferably physiological saline or Tris buffer, and administered either systemically or locally, i.e., parenteral, subcutaneous, intravenous, intramuscular, intranasal, or any other path of administration known to the skilled practitioner.
  • aqueous solution preferably physiological saline or Tris buffer
  • parenteral i.e., parenteral, subcutaneous, intravenous, intramuscular, intranasal, or any other path of administration known to the skilled practitioner.
  • the mode of administration, the dose and the number of administrations can be optimized by those skilled in the art in a known manner. However, most commonly a patient is vaccinated with a second shot about one month to six weeks after the first vaccination shot, although booster doses can also be administered years after the first dose.
  • the MVA vector is further modified by deletion of one or more vaccinia immunomodulatory genes; preferably one, two, or three of the genes C6L, K7R, and A46R. Most preferably, all three genes are deleted. Deletion of these genes has been shown to enhance the innate immune response triggered by the viral vector, and also adaptive antigen-specific immune responses.
  • the present invention provides a vaccine composition comprising an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof, and wherein the MVA vector is further modified by deletion of one or more vaccinia immunomodulatory genes; preferably one, two, or three of the genes C6L, K7R, and A46R.
  • “derivatives” or “variants” of MVA refer to viruses exhibiting essentially the same replication characteristics as MVA but exhibiting differences in one or more parts of their genomes. These "derivatives” or “variants” of MVA must fail to reproductively replicate in vivo in humans and mice, even in severely immune suppressed mice. Tests and assays for the properties of MVA variants are described in WO 02/42480 (US 2003/0206926) and WO 03/048184 (US 2006/0159699).
  • the term “fails to reproductively replicate” refers to a virus that has a virus amplification ratio at 4 days after infection of less than 1. Assays described in WO 02/42480 or in U.S. Patent No. 6,761 ,893 are applicable for the determination of the virus amplification ratio.
  • the amplification or replication of a virus is normally expressed as the ratio of virus produced from an infected cell (output) to the amount originally used to infect the cell in the first place (input) referred to as the "amplification ratio".
  • An amplification ratio of "1" defines an amplification status where the amount of virus produced from the infected cells is the same as the amount initially used to infect the cells, meaning that the infected cells are permissive for virus infection and reproduction.
  • an amplification ratio of less than 1 i.e., a decrease in output compared to the input level, indicates a lack of reproductive replication and therefore attenuation of the virus.
  • the recombinant MVA vector of any of the embodiments used for generating the recombinant virus of the present invention is characterized for being replication deficient in mammalian cells, particularly human cells.
  • the recombinant MVA vector of any of the embodiments used for generating the recombinant virus is a MVA virus or a derivative having the capability of reproductive replication in vitro in chicken embryo fibroblasts (CEF) cells and in established chick cells DF-1 , but no capability of reproductive replication in human cervix adenocarcinoma cell line HeLa.
  • the recombinant MVA vector of any of the embodiments used for generating the recombinant virus is a MVA vector may be further modified by deletion of one or more vaccinia immunomodulatory genes; preferably one, two, or three of the genes C6L, K7R, and A46R. Most preferably, all three genes are deleted.
  • MVA vectors useful for the present invention can be prepared using methods known in the art, such as those described in WO 02/042480 and WO 02/24224, both of which are incorporated by reference herein.
  • a MVA viral strain suitable for generating the recombinant viruses of the present invention may be strain MVA-572, MVA-575 or any similarly attenuated MVA strain.
  • suitable may be a mutant MVA, such as the deleted chorioallantoic vaccinia virus Ankara (dCVA).
  • a dCVA comprises del I, del II, del III, del IV, del V, and del VI deletion sites of the MVA genome. The sites are particularly useful for the insertion of multiple heterologous sequences.
  • the dCVA can reproductively replicate (with an amplification ratio of greater than 10) in a human cell line (such as human 293, 143B, and MRC-5 cell lines), which then enable the optimization by further mutation useful for a virus-based vaccination strategy (see WO 201 1/092029).
  • a human cell line such as human 293, 143B, and MRC-5 cell lines
  • the Combination Vaccines and methods described herein may be used as part of a homologous prime-boost regimen.
  • a first priming vaccination is given followed by one or more subsequent boosting vaccinations.
  • the boosting vaccinations are configured to boost the immune response generated in the first vaccination by administration of the same recombinant MVA that was used in the first vaccination.
  • a homologous prime-boost regimen may be employed wherein a MVA viral vector as defined herein in the first aspect of the invention or in any of its embodiments is administered in a first dosage.
  • One or more subsequent administrations of a MVA viral vector as defined herein in the first aspect or any of its embodiments can be given to boost the immune response provided in the first administration.
  • the one or more antigenic determinants are the same or similar to those of the first administration.
  • the MVA vector provided herein is administered as a boost (i.e., as a second, third, fourth, or successive vaccinations).
  • the MVA recombinant viral vectors according to the present invention may also be used in prime-boost regimens in combination with other immunogens (heterologous prime/boost combination), such as in combination with a DNA or RNA vector or another viral vector, such as an adenoviruses.
  • other immunogens heterologous prime/boost combination
  • one or more subsequent boosting vaccinations may be done with the MVA vector provided herein and not used in the prime vaccination, e.g., if another immunogenic vector is given in a prime, then subsequent boosting vaccinations may be performed with the MVA provided herein, and vice versa.
  • a vaccine combination (from hereinafter referred to as homologous vaccine combination) comprising:
  • compositions comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments; and 2. a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments; wherein one of the compositions is a priming composition and the other composition is a boosting composition, preferably wherein the boosting composition comprises or consists of two or more doses of the vector of the boosting composition.
  • a vaccine combination from hereinafter referred to as heterologous vaccine combination
  • heterologous vaccine combination comprising:
  • composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments;
  • compositions comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant or linage, preferably selected from the group consisting of viral vectors, recombinant proteins or polypeptides, nucleic acids, virus-like particles, nanoparticles, or any combination thereof, wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order.
  • the composition comprising the MVA vector as defined in the first aspect or any of its embodiments is administered as a boost, after a prime with a composition comprising an immunologically effective amount of an immunogen of at least one SARS-CoV-2 variant or linage.
  • the boost composition comprises or consists of two or more doses of the vector or immunogen of the boosting composition.
  • the recombinant heterologous or homologous vaccine combinations may be either monovalent, i.e., comprising only one heterologous sequence encoding an antigenic determinant of SARS-CoV-2, or multivalent, i.e., comprising at least two heterologous sequences encoding antigenic determinants of SARS-CoV-2, such as those selected from the list consisting of structural proteins S, RBD, E, N or M of SARS- CoV-2, preferably such antigenic proteins are those selected from any of SEQ ID NO 2,
  • SEQ ID NO 4 SEQ ID NO 6, SEQ ID NO 8 and SEQ ID NO 10, respectively encoded by nucleic acid sequences SEQ ID NO 1, SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7 and SEQ ID NO 9.
  • the immunologically effective amount of an immunogen of at least one SARS-CoV-2 variant or linage comprises an antigenic protein or nucleic acid encoding for an antigenic protein, wherein the antigenic protein is selected from any of the group of structural proteins S, RBD, E, N or M of SARS-CoV-2, or any combination or fragments thereof.
  • the at least one immunogen of at least one SARS-CoV-2 variant or linage is a nucleotide sequence of a DNA or RNA vector that encodes for an antigenic protein of at least one SARS-CoV-2 variant or linage.
  • said nucleotide sequence encoding for an antigenic protein is preferably the structural protein S of SARS-CoV-2, or a fragment thereof such as the RBD.
  • heterologous vaccine compositions it is important to note that upon injection, preferably intramuscularly, of the DNA/RNA vaccine, cells, preferably muscle cells, may be efficiently transfected and produce a relatively large amount of antigen that may be secreted or otherwise released. Once the plasmid or the RNA reaches the cell, the antigen of interest is produced. Next, the transfected cell displays on its surface the foreign antigen in both major histocompatibility complex (MHC) classes I and class II molecules. The antigen-presenting cell primed with the antigen travels to the lymph nodes and presents the antigen peptide and costimulatory molecules, initiating the immune response.
  • MHC major histocompatibility complex
  • DNA/RNA-based vectors suitable for used as vaccines are known in the art.
  • Hobernik and Bros Int J Mol Sci. 2018 Nov 15;19(11 ):3605 summarize the knowledge on the course of action of DNA vaccines and the methods for DNA vaccine immunogenicity optimization.
  • Lee et al. Acta Biomater. 2018 Oct 15;80:31-47 relates to engineering DNA vaccines against infectious diseases.
  • the DNA/RNA-based vaccine vector encode for one or more antigens against which the immune response is to be elicited. Further, the DNA/RNA vector can also encode other co-stimulatory molecules, such as interleukins, cytokines, etc.
  • the promoter operably linked to the antigen of interest would need to be recognized by mammal cellular transcription machinery.
  • Promoters for expressing proteins in mammalian cells are also known in the art. For instance, some viral promoters might be used, such as cytomegalovirus promoter or T7 phage promoter.
  • Any DNA, linear or plasmid, able to express the antigen in a mammalian cell may be used to construct a DNA/RNA vaccine.
  • Mammalian expression DNA and RNA vectors are widely known in the art.
  • the other immunogen that is combined with the MVA vector provided herein is a mammalian expression vector (a DNA plasmid vector) and produces high levels of the antigen.
  • a mammalian expression vector a DNA plasmid vector
  • suitable mammalian expression plasmid vectors that can be used in the present inventions are, but not limited to, pCDNA, pCAGGS, etc.
  • the mammalian expression vector can be grown in bacterial cells for high-yield production.
  • the other immunogen that is combined with the MVA vector provided herein is a RNA molecule.
  • the other immunogen that is combined with the MVA vector provided herein is an adenovirus.
  • the other immunogen that is combined with the MVA vector provided herein is a recombinant protein or polypeptide.
  • DNA/RNA-based vaccine has been produced by endo-free means, for instance, by using EndoFree Plasmid Kits by Qiagen.
  • Vaccines and kits comprising recombinant MVA viruses
  • kits comprising any one or more of the recombinant MVAs described herein.
  • the kit can comprise one or multiple containers or vials of the recombinant MVA, together with instructions for the administration of the recombinant MVA to a subject at risk of SARS-CoV-2 infection.
  • the subject is a human.
  • the instructions indicate that the recombinant MVA is administered to the subject in a single dose, or in multiple (i.e., 2, 3, 4, etc.) doses.
  • the instructions indicate that the recombinant
  • the vaccines and kits comprising recombinant MVA vectors or vaccine combinations as described in the first or second aspects or any of their embodiments comprise a single dose to be administrated to a subject in need thereof.
  • the instructions indicate that the recombinant MVA virus is administered in a first (priming) and second (boosting) administration to naive or non- naive subjects.
  • the instructions indicate that the recombinant MVA virus is administered as a boost to naive or non-naive subjects.
  • a kit comprises at least two vials or container for prime/boost immunization comprising the recombinant MVAs as described herein for a first inoculation ("priming inoculation") in a first vial/container and for an at least second and/or third and/or further inoculation ("boosting inoculation") in a second and/or further vial/container.
  • the vaccines and kits described herein comprise a first (priming) and second (boosting) dose of an immunologically effective amount of the recombinant MVAs as described herein, for use in homologous or heterologous prime boost inoculations.
  • kits comprising one, two, or more doses of any of the vaccine compositions as defined in the first aspect of the invention or any of its embodiments, or of any of the homologous or heterologous vaccine combinations of the second aspect of the invention or any of its embodiments.
  • the kit comprises an immunologically effective amount of a MVA-based vaccine composition, preferably MVA-S(3P) vector according to the first aspect of the invention in a first vial or container for a first administration (priming) and in a second vial or container for a second administration (boosting).
  • a preferred embodiment of the third aspect of the invention refers to a kit comprising an immunologically effective amount of a MVA vector according to the first aspect or any of its embodiment in a container for a first or a second or subsequent administrations, wherein the kit further comprises at least another container comprising an immunologically effective amount of another immunogen of at least one SARS-CoV-2 variant or linage for a first or a second or subsequent administrations.
  • kits comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant or linage in a first vial or container for a first administration (priming), and an immunologically effective amount of a MVA vector according to the first aspect or any of its embodiments, in a second vial or container for a second administration (boosting).
  • any of the kits referred to herein comprise a third, fourth or further vial or container comprising any of the vaccine compositions indicated throughout the present invention for a third, fourth or further administration.
  • the MVA vector provided herein is used in a second, third, fourth, or further administrations.
  • the combination of the combination of compositions contained in the containers is capable of producing at least the S protein, or a fragment thereof, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P derived from at least one SARS-CoV-2 variant or linage, in the subject to be treated, and generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant or linage in a subject in need thereof.
  • the vaccines compositions and combinations and kits provided in any of the previous aspects are used in therapy.
  • the vaccines compositions and combinations and kits provided in any of the previous aspects are also for use as a medicament or as a vaccine for the treatment and/or prevention of a coronavirus-caused disease, preferably a SARS-CoV-2-caused disease.
  • the vaccines compositions and kits provided in any of the previous aspects are for use in generating a protective immune response against at least one SARS-CoV-2 subtype or linage, wherein the kits or vaccine composition comprise one dose of an immunologically effective amount of the vaccine compositions provided herein.
  • the vaccines compositions and kits provided in any of the previous aspects are for use in generating a protective immune response against at least one SARS-CoV-2 variant or linage, wherein the kits or vaccine composition comprise at least one dose of an immunologically effective amount of the vector MVA-S(3P).
  • the vaccine composition according to the first aspect or any of its embodiment or the kits of the third aspect or any of its embodiments is for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant or linage, wherein said composition is used for priming and/or for boosting said immune response, and wherein the MVA is capable of producing said S protein, or fragment thereof, in the subject to be treated.
  • the vaccine composition, combination, or kits are for use in generating or inducing an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, preferably wherein said immunogenic and/or protective immune response is generated in the subject after at least a single administration (be it as a prime or as a boost) of the vaccine composition, combinations, or kits described herein.
  • the vaccine composition according to the first aspect, the vaccine combinations according to the second aspect or the kits according to the third aspect, or any of their related embodiments are used to induce an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant or linage with only a single dose of an immunologically effective amount of the MVA-S(3P) of the invention, wherein preferably the single dose contains concentrations of MVA of about 1 x 10 7 to 2 x 10 8 PFUs.
  • said single dose of the vaccine composition or combination or the kits of the first or second or third aspects, or any of their related embodiments is administered as a boost, preferably after a vaccination with a different immunogen (such as a RNA vaccine, DNA vaccine, protein-based vaccine, etc.).
  • a different immunogen such as a RNA vaccine, DNA vaccine, protein-based vaccine, etc.
  • the vaccines, vaccine combinations and kits provided in any of the previous aspects are for use in generating a protective immune response against at least one SARS-CoV-2 variant or linage, wherein if the kits or vaccine combinations are used, the first composition is used for priming said immune response and the second composition is used for boosting said immune response or for use in generating a protective immune response against at least one SARS-CoV-2 variant or linage, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response.
  • the boosting composition can comprise two or more doses of the vector of the boosting composition.
  • the vaccine combination according to the second aspect or any of its embodiments is for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant or linage, and wherein said combination is capable of producing said S protein, or fragment thereof, in the subject to be treated.
  • the vaccine composition according to the first aspect or the vaccine combinations according to the second aspect or any of their embodiments are used to induce an enhanced immune response against at least one SARS-CoV-2 variant or linage in a subject in need thereof, preferably in a human subject, wherein the MVA is capable of producing one or more proteins, or fragments thereof, selected from the group consisting of proteins S, E, RBD, N and/or M, or any combination thereof, derived from at least one SARS-CoV-2 variant or linage, in the subject to be treated.
  • the present invention provides heterologous vaccine programs that consists of a combination vaccine and/or vaccination kit which comprises:
  • compositions comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments, and 2. a composition comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant or linage, wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order, and preferably wherein the boosting composition comprises two or more doses.
  • the MVA vector as defined in the first aspect or any of its embodiments is the boosting composition.
  • the present invention also provides homologous vaccination regimes using two equal non-replicating viral vectors.
  • the present invention thus provides a combination vaccine and/or vaccination kit which comprises:
  • composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments, and
  • compositions comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments, wherein one of the compositions is a priming composition and the other composition is a boosting composition, preferably wherein the boosting composition comprises two or more doses.
  • the combination vaccines and/or kit comprises at least two vials or containers for prime/boost immunization comprising the recombinant MVA according to the first aspect or any of its embodiments for a first inoculation ("priming inoculation") in a first vial or container and for an at least second and/or third and/or further inoculation ("boosting inoculation”) in a second and/or further vial or container.
  • prime/boost immunization comprising the recombinant MVA according to the first aspect or any of its embodiments for a first inoculation ("priming inoculation") in a first vial or container and for an at least second and/or third and/or further inoculation ("boosting inoculation”) in a second and/or further vial or container.
  • the heterologous combination vaccine and/or kit can comprise multiple containers or vials of the recombinant MVA/other immunogen, together with instructions for the administration of the recombinant MVA/other immunogen to a subject at risk of SARS- CoV-2 infection.
  • the subject is a human.
  • the instructions indicate that the recombinant MVA/other immunogen is administered to the subject in a single dose, or in multiple (i.e., 2, 3, 4, etc.) doses.
  • the instructions indicate that the recombinant MVA/other immunogen virus is administered in a first (priming) and second (boosting) administration to naive or non-naive subjects.
  • the other immunogen of at least one SARS-CoV-2 variant or linage is selected from the group including, but not limited to, viral vectors, recombinant proteins or polypeptides, nucleic acids, virus like particles, nanoparticles, or any combination thereof.
  • said immunogen is selected from the group consisting of viral vectors, recombinant proteins or polypeptides, nucleic acids, virus-like particles, nanoparticles, or any combination thereof.
  • the first and/or second composition or MVA and/or other immunogen of any combination vaccine, vaccination kit and/or any homologous or heterologous vaccine program of the invention can comprise any of the MVA vector described herein and any combination thereof.
  • vaccine combinations of any of the embodiments for use as a medicament or vaccine for inducing an enhanced immune response against a SARS- CoV-2 infection wherein the combination is capable of producing the antigenic determinant, and/or SARS-CoV-2 -like particles in the subject to be treated, preferably, wherein the combination vaccine is producing the encoded antigenic determinant in the subject to be treated.
  • a fourth aspect of the present invention provides a method of generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant or linage in a subject in need thereof, preferably in a human subject, the method comprising administering to the subject the recombinant MVA vaccine composition as described in the first aspect of the invention or any of its embodiments; or a kit or any of the vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention or any of their embodiments.
  • said method is for priming the immune response and/or for boosting said immune response.
  • Figs. 15B, 15C, 21 B, and 21 C neutralizing antibody titers against SARS- CoV-2 parental Wuhan strain, D614G mutant, and VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1), and delta (B.1.167.2) were detected in serum from mice immunized with MVA-S(3P), markedly higher than the titers in MVA-S- or MVA-A-S vaccinated mice.
  • the vaccine composition according to the first aspect or the vaccine combination according to the second aspect or the kits of the third aspect, or any of their related embodiments are for use in generating an immunogenic and/or protective immune response that confers protection (including cross protection) against infections caused by different SARS-CoV-2 variants or linages, preferably against infections caused at least by SARS-CoV-2 Wuhan strain, D614G mutant, VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1), delta (B.1.167.2) and omicron (B.1.1.529) linages, and/or any combinations thereof.
  • the vaccine composition according to the first aspect or the vaccine combination according to the second aspect or the kits of the third aspect or any of their related embodiments are for use in generating an immunogenic and/or protective immune response against the S protein of at least one, two, three, four, five, six, or more SARS-CoV-2 different variants or linages, preferably selected from Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351, linage P.1, linage B.1.167.2, linage B.1.1.529, and/or any combination thereof.
  • the vaccine composition according to the first aspect or the vaccine combinations according to the second aspect or the kit of the third aspect or any of their related embodiments are used to induce an immunogenic and/or protective immune response against the S protein of at least one SARS-CoV-2 variant or linage, wherein preferably said immunogenic and/or protective immune response is directed against at least a SARS-CoV-2 variant or linage selected from the group consisting of Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351 , linage P.1, linage B.1.167.2, linage B.1.1.529, and/or any combination thereof.
  • the protective immune response elicited by the vaccine composition according to the first aspect or the vaccine combination according to the second aspect or the kits of the third aspect or any of their related embodiments protects a subject in need thereof, preferably after a single dose, preferably administered as a prime or as a boost, against at least one or more infections caused by at least a SARS-CoV-2 virus, preferably selected from the list consisting of SARS- CoV-2 Wuhan strain, D614G mutant, VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1), delta (B.1.167.2), and/or any combination thereof.
  • said protective immune response protects a subject in need thereof, preferably after a single dose, preferably administered as a prime or as a boost, against at least one, two, three, four, five, six, or more infections caused by at least one SARS-CoV-2 variant or linage, preferably selected from Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351, linage P.1 , linage B.1.167.2, linage B.1.1.529, and/or any combination thereof. Further, since immunization with the MVA-
  • S(3P) of the invention elicited SARS-CoV-2 S-specific CD4+ and CD8+ T cell-mediated immune response with memory phenotype (see, e.g, Fig. 11), it is more than plausible that they are protective not only against a first SARS-CoV-2 infection, but also after subsequent SARS-CoV-2 infections.
  • the vaccine composition according to the first aspect or the vaccine combinations according to the second aspect or the kit of the third aspect or any of their related embodiments are used to induce in a subject in need thereof a protective immune response against an infection caused by at least one SARS-CoV-2 variant or linage, preferably selected from the group consisting of Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351, linage P.1 , linage B.1.167.2, linage B.1.1.529, and/or any combination thereof; preferably wherein said protective immune response is capable of protecting said subject against said SARS-CoV-2 infections for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , or 12 months or years.
  • the term “immunogenic and protective immune response, "protective immunity” or “protective immune response” means that the vaccinated subject is able to control an infection with the pathogenic agent against which the vaccination was done.
  • the subject having developed a “protective immune response” develops only mild to moderate clinical symptoms or no symptoms at all.
  • a subject having a "protective immune response” or “protective immunity” against a certain agent will not die as a result of the infection with said agent.
  • the subject animal is a mammal.
  • the mammal may be an adult cow, a calf, in particular a juvenile calf, a rat, rabbit, pig, mouse, but preferably a human, and the method comprises administering a dose of the recombinant MVA or combinations thereof as described in the fourth aspect of the invention.
  • the protective immune response with a single dose (be it as a boost or as a prime) is capable of, or is characterized by being, sufficient to prevent a vaccinated subject from contracting an infection that leads to the morbility and/or mortality of said subject, when infected by at least one SARS-CoV-2 variant or linage.
  • infection is herein understood, but not limited to, as the presence of replication of the virus in the body’s cells, preferably lung cells, of the host. More preferably, the term “infection” is understood as the presence of replication of the virus in the body’s cells, preferably lung cells, of the host, wherein said replication leads to the morbidity and/or mortality of said subject.
  • the subject is a human.
  • the subject is an adult.
  • the adult is immune-compromised.
  • the adult is over the age of 10, 15, 20, 25, 30, 25, 40, 45, 50, 55, 60, 65, 70, 75, 80, or 85 years.
  • the recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention, may be preferably administered to the subject at a dose of 1 x 10 7 , 5 x 10 7 , 1 x 10 8 or 2 x 10 8 PFUs/dose.
  • any of the recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention are administered to the subject at any of the doses provided herein prior to SARS-CoV-2 virus exposure as, e.g., 1 , 2, 3, or 4 weeks or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months before SARS-CoV-2 virus exposure.
  • any of the said vaccine compositions or kits provided herein is administered to the subject at any of the doses provided herein after SARS-CoV-2 virus exposure as, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9. 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 hours or 1, 2, 3, 4, 5, 6, or 7 days after SARS-CoV-2 exposure.
  • the recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention are administered to the subject in a single dose, or in multiple (i.e., 2, 3, 4, etc.) doses.
  • the said kits or vaccine compositions provided herein are administered in a first (priming) and second (boosting) administration.
  • a single dose of MVA viral vector as defined herein in the first aspect of the present invention may be given to induce protective immune response, either intramuscularly (as shown in Figures 13-15; vaccinated mice Group 2) or intranasally (as shown in Figures 16-21).
  • more than one dose of an immunologically effective amount of an MVA viral vector as defined herein in the first aspect of the present invention may be given to induce protective immune response.
  • a single dose of an immunologically effective amount of MVA-S(3P) is preferred, although two doses might be a choice for longer term immune responses.
  • Boosting compositions are generally administered once or multiple times weeks or months after administration of the priming composition, for example, about 1 or 2 weeks or 3 weeks, or 4 weeks, or 6 weeks, or 8 weeks, or 16 weeks, or 20 weeks, or 24 weeks, or 28 weeks, or 32 weeks or one to two years.
  • the initial boosting inoculation is administered 1-12 weeks or 2-12 weeks after priming, more preferably 1 , 2, 3, 4 or 8 weeks after priming.
  • the initial boosting inoculation is administered 4 or 8 weeks after priming.
  • the initial boosting is conducted at least 2 weeks or at least 4 weeks after priming.
  • the initial boosting is conducted 4-12 weeks or 4-8 weeks after priming.
  • the recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention, or in any of their embodiments, can be administered systemically or locally.
  • the said recombinant vaccine compositions are administered parenterally, subcutaneously, intravenously, intramuscularly, or intranasally, in particular intranasally or intramuscularly.
  • the recombinant MVA or the containers comprising the recombinant MVA are administered intranasally.
  • the said recombinant vaccine compositions are administered by any other path of administration known to the skilled practitioner.
  • the said recombinant vaccine composition is administered intramuscularly, preferably the recombinant vaccine composition is administered intramuscularly in a volume ranging between about 0.10 and 1.0 ml, preferably containing concentrations of e.g., about 1 x 10 7 to 2 x 10 8 PFUs/ml.
  • the said recombinant vaccine composition is administered in a volume ranging between 0.25 and 1.0 ml. More preferably, the said recombinant vaccine composition is administered in a volume of about 0.5 ml.
  • the MVA vector of the present invention also elicits an immune response against the poxviral E3 protein, which is a host range protein encoded by the E3L gene comprised in VACV genome.
  • the E3 protein is typical from poxviruses, and thus not only the MVA virus encodes for it, but also other poxviruses such as monkeypox or smallpox. This means that an immune response generated against said E3 protein elicited by one or more MVA immunizations would also target E3 protein from monkeypox or smallpox viruses.
  • the MVA vectors described herein provide dual immunogenicity: they elicit an immunogenic and/or protective response against at least one SARS-CoV-2 variant or linage, and at the same time they elicit an immune response against a poxvirus, such as the monkeypox or smallpox viruses.
  • the present invention provides an MVA vector expressing the E3 protein of poxviruses for use in generating an immunogenic and/or protective immune response against at least a poxvirus, preferably against smallpox and/or monkeypox virus.
  • the MVA vector expressing the poxviral E3 protein for use according to the fifth aspect is for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the poxviral E3 protein, or a fragment of said protein, wherein preferably said vector is used for priming and/or for boosting said immune response, and wherein the MVA is capable of producing said poxviral E3 protein, or fragment thereof, in the subject to be treated.
  • the MVA vector used according to the fifth aspect comprises at least one nucleic acid that encodes for the E3 protein of poxviruses, preferably operably linked and under the promoter of the wildtype promoter of E3L gene.
  • the nucleotide sequence of the poxviral E3 protein comprises or consists of SEQ ID NO: 24, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 24.
  • the amino acid sequence of the poxviral E3 protein comprises or consists of SEQ ID NO: 25, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 25.
  • a further aspect of the present invention refers to the use of said MVA-S(3P) virus in generating an immunogenic and/or protective immune response against at least a poxvirus, preferably against smallpox and/or monkeypox virus.
  • the MVA vector for use not only expresses the poxviral E3 protein, but also expresses the S protein of at least one SARS-CoV-2 variant or linage, wherein said S protein comprises at least the amino acid substitutions R682G, R683S, R685S, A942P, K986P and V987P as defined using the amino acid numbering of the reference Wuhan S protein PDB ID 6VSB.
  • the vaccines compositions and/or combinations and/or kits provided in any of the previous aspects and their related embodiments are for use as a medicament or as a vaccine for the treatment and/or prevention of a poxvirus-caused disease.
  • the vaccines compositions, combinations and/or kits provided in any of the previous aspects and their related embodiments are for use in generating a protective immune response against at least a poxvirus, wherein the kits or vaccine composition or combinations comprise at least one dose of an immunologically effective amount of the vector MVA wild type or MVA-S(3P).
  • the vaccines compositions and combinations and/or kits provided in any of the previous aspects or in any of their related embodiments are for use as bivalent vaccines to generate an immunogenic and/or protective immune response against both at least a poxvirus and/or at least one SARS-CoV-2 variant or linage, wherein the kits or vaccine composition comprise at least one dose of an immunologically effective amount of the compositions of the first aspect or any of its embodiments.
  • said immunogenic and/or protective immune response is at least against the poxviral E3 protein and/or against at least the S protein from at least one SARS-CoV-2 variant or linage.
  • the vaccine composition of the first aspect or any of its embodiments is used for priming and/or for boosting an immune response
  • the MVA vector is capable of producing a S protein comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, or fragment thereof, and the poxviral E3 protein, in the subject to be treated.
  • said immunogenic and/or protective immune is achieved after a single administration of the vaccine compositions or combinations.
  • the vector of the fifth aspect may be used to induce an enhanced immune response against at least one SARS-CoV-2 variant or linage and/or against at least a poxvirus in a subject in need thereof, preferably in a human subject, wherein the MVA is capable of producing one or more proteins of said viruses, preferably the S protein of at least a SARS-CoV-2 variant or linage comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and the poxviral E3 protein.
  • vaccine compositions and combinations and kits for use in priming or boosting an immune response against a poxviral infection, preferably smallpox and/or monkeypox infection, and/or against a SARS-CoV-2 infection, preferably wherein the recombinant MVA is administered at least once, twice, three times or four times.
  • the vaccine of the first aspect comprising a MVA comprising a heterologous nucleotide sequence encoding the S protein of at least a SARS-CoV-2 variant or linage, wherein said S protein comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P defined using the amino acid numbering of the reference Wuhan S protein PDB ID 6VSB, provides a coronavirus and a poxvirus vaccine capable of inducing both cellular and humoral responses sufficient to confer protective immunity to one or subsequent SARS-CoV-2 virus infections, as well as to one or subsequent poxvirus infections.
  • a vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid encoding the Spike (S) protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
  • MVA modified vaccinia virus Ankara
  • TK thymidine kinase
  • nucleic acid encoding for the S protein, or a fragment thereof, of at least one SARS-CoV-2 variant is operably linked to an early/late promoter from Vaccinia Virus (VACV), preferably the synthetic early/late promoter.
  • VACV Vaccinia Virus
  • nucleic acid encoding for the S protein, or a fragment thereof, of at least one SARS-CoV- 2 variant is inserted into the TK locus of the MVA genome and is operably linked to an early/late promoter from VACV, preferably the synthetic early/late promoter.
  • nucleic acid comprised in the MVA vector further encodes for one or more antigenic proteins selected from the group consisting of structural proteins E (envelope), receptor-binding domain (RBD), N (nucleocapsid) or M (membrane), or any combination thereof, from at least one SARS-CoV-2 variant.
  • At least one SARS-CoV-2 variant is selected from the group consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), Linage B.1.1.28 (Brazilian variant), Linage B.1.351 (South African variant), Linage B.1.427 or Linage B.1.429 (California variant), Linage B.1.617 (Indian variant) or Linage B.1.1.7 (United Kingdom variant), or any combination thereof.
  • composition according to any of clauses 1 to 6, wherein the vaccine further comprises one or more pharmaceutically acceptable carriers, additives, antibiotics, preservatives, adjuvants, diluents and/or stabilizers.
  • a vaccine combination comprising: a. a first composition comprising an immunologically effective amount of a MVA vector as defined in any clauses 1 to 7; and b. a second composition comprising an immunologically effective amount of a MVA vector as defined in any of clauses 1 to 7; wherein one of the compositions is a priming composition and the other composition is a boosting composition.
  • a vaccine combination comprising: a. a first composition comprising an immunologically effective amount of a MVA vector as defined in any of clauses 1 to 7; and b.
  • a second composition comprising an immunologically effective amount of at least one immunogen derived from at least one SARS-CoV-2 variant; wherein one of the compositions is a priming composition and the other composition is a boosting composition.
  • the vaccine combination for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant, and wherein said combination is capable of producing said S protein, or fragment thereof, in the subject to be treated.
  • a kit comprising one, two, or more doses of the vaccine composition as defined in any of clauses 1 to 7, or the vaccine combination as defined in any of clauses 8 to 10.
  • a kit comprising an immunologically effective amount of a MVA vector according to any of clauses 1 to 7 in a first container for a first administration (priming) and in a second container for a second administration (boosting).
  • a kit comprising an immunologically effective amount of a MVA vector according to any of clauses 1 to 7 in a container for a first or a second administration, wherein the kit further comprises at least another container comprising an immunologically effective amount of another immunogen derived from at least one SARS-CoV-2 variant for a first or a second administration.
  • a kit comprising an immunologically effective amount of an immunogen derived from at least one SARS-CoV-2 variant in a first container for a first administration (priming), and an immunologically effective amount of a MVA vector according to any of clauses 1 to 7 in a second container for a second administration (boosting).
  • the kit according to any of clauses 18 to 21, comprising in a third, fourth or further containers a MVA vector according to any of clauses 1 to 8 for a third, fourth or further administration.
  • kits according to clause 23, wherein the combination of compositions contained in the containers is capable of producing at least the S protein, or a fragment thereof, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P derived from at least one SARS-CoV-2 variant, in the subject to be treated, and generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant in a subject in need thereof.
  • the kit for use according to any of clauses 23 or 24, wherein said compositions comprised in the containers are administered via the intramuscular or intranasal route.
  • compositions or combinations of compositions contained in the containers are administered via the intramuscular or intranasal route.
  • said method comprises administering the vaccine compositions according to any of clauses 1 to 8 for priming said immune response and/or boosting said immune response.
  • said compositions or combinations of compositions comprised in the containers are administered via the intramuscular or intranasal route.
  • CoV-2 variant in a subject in need thereof, preferably in a human subject, comprising administering to the subject the vaccine composition according to any of clauses 1 to 7 or any of the vaccine combinations according to any of clauses 8 to 10.
  • compositions or combinations of compositions comprised in the containers are administered via the intramuscular or intranasal route.
  • Culture media DF-1 (a spontaneously immortalized chicken embryo fibroblast [CEF] cell line, ATCC catalog no. CRL-12203) and HeLa cells (a human epithelial cervix adenocarcinoma; ATCC catalog no. CCL-2) were grown in Dulbecco’s modified Eagle’s medium (DMEM) (Gibco) supplemented with non-essential amino acids (1X, Sigma-Aldrich) and L- glutamine (2 mM, Merck) and with 10 % fetal calf serum (FCS) (Gibco).
  • DMEM Dulbecco’s modified Eagle’s medium
  • FCS 10 % fetal calf serum
  • Opti-MEM medium (Gibco) was used as a transient culture medium during plasmid transfection.
  • DMEM was used as a medium for absorbing the virus and was removed after 1 hour, and DM EM-2 % FCS was used as a medium for incubating infections.
  • the solid infection medium was used to select the recombinant virus plaques and consisted of a 1:1 ratio of DMEM 2X-4 % FCS and 1.9 % previously melted agarose (Conda). Vero-E6 cells (ATCC catalog no.
  • CRL-1586 were maintained in complete medium (DMEM supplemented with 10 mM HEPES [Gibco-Life Technologies], 1 * nonessential amino acids [Gibco-Life Technologies], penicillin [100 U/ml; Sigma-Aldrich], streptomycin [100 mg/ml; Sigma-Aldrich], and 10% heat inactivated fetal bovine serum [FBS, Gibco-Life Technologies]). All the cells were kept in a humidified incubator at 37°C and 5 % CO2. 1.2. Bacteria
  • the bacterial strains used for plasmid growth and transformations during cloning were chemically competent Escherichia coii DFI5a cells (CNB) and electrocompetent Escherichia coli DH10B cells (New England Biolabs).
  • the bacteria were cultured in Luria-Bertani (LB) medium supplemented with 1 % bacto-tryptone (BD Biosciences), 1 % NaCI (Sigma-Aldrich), and 0.5 % yeast extract (BD Biosciences) at pH 7 in the presence of ampicillin (100 pg/ml, Merck) or kanamycin (100 pg/ml, Merck) (Green MR, Sambrook J. 2012. Molecular Cloning: a laboratory manual, 4 ed. Cold Spring Harbor Laboratory Press, New York, USA)
  • coronvirus SARS-CoV-2 S antigen SEQ ID NO 1 and SEQ ID NO 2
  • the SARS-CoV-2 antigen used to generate the recombinant MVA-CoV2-S(3P), also referred as abbreviated MVA-S(3P) vaccine candidate, is a prefusion-stabilized full- length SARS-CoV-2 S gene (Wuhan seafood market pneumonia virus isolate Wuhan- Hu-1. GenBank accession number: MN908947.3).
  • the nucleotide sequence of this S protein was edited with codons optimized for humans by GeneArt (Thermo Fisher Scientific), and contains three mutations in the furin cleavage site (R682G, R683S, R685S) that avoid the cleavage of the S protein in S1 and S2, and three additional mutations in the S2 region that stabilizes the S protein in a prefusion conformation (A942P, K986P, and V987P).
  • the parental MVA used for generating MVA-CoV2-S(3P) vaccine candidate was a wild- type MVA (MVA-WT).
  • the S gene was inserted in the viral TK locus (gene J2R) to generate the MVA-CoV2-S(3P) vaccine candidate.
  • the S gene is under the control of the synthetic early/late viral promoter (pE/L, also called sE/L).
  • SARS-CoV-2 strain MAD6 (kindly provided by Jose M. Honrubia and Dr. Luis Enjuanes, CNB-CSIC, Madrid, Spain) is a virus isolated from a patient from Hospital 12 de Octubre in Madrid. The virus was isolated, plaque cloned three times and amplified at CNB-CSIC. Full-length virus genome was sequenced, and it was found to be identical to SARS-CoV-2 reference sequence (Wuhan-Hu-1 isolate, GenBank: MN908947), except the silent mutation C3037>T, and two mutations leading to amino acid changes: C14408>T (in nsp12) and A23403>G (D614G in S protein).
  • SARS-CoV-2 B.1.351 VOC was obtained from the European Virus Archive Global (EVA-GLOBAL) (Human 2019-nCoV-hCoV-19/France/PDL-IPP01065/2021, clade 20H/501Y.V2/Beta, V2 (B.1.351)) and was then amplified at the CNB-CSIC in Vero-E6 cells.
  • EVA-GLOBAL European Virus Archive Global
  • a plasmid transfer vector pCyA was used for inserting the coronavirus SARS-CoV-2 prefusion-stabilized S(3P) gene into the MVA genome.
  • the cells were first infected with the parental MVA-WT virus and then transfected with this plasmid.
  • the recombinant MVA virus was subsequently selected after several consecutive plaque purification steps.
  • the process whereby a heterologous gene is inserted into the MVA genome is called homologous recombination, a type of genetic recombination in which nucleotides sequences are exchanged between two similar or identical DNA molecules. In this case, recombination occurs between the genetic sequences of the transfer plasmid and the viral genome.
  • the transfer plasmid In order to insert the heterologous genes into the MVA genome, the transfer plasmid must contain the following elements:
  • Flanking regions of the desired insertion area are sequences including the left (L) and right (R) regions of the MVA TK gene such that they allow recombination processes whereby the antigens of interest are inserted in the TK locus.
  • Antigen of interest This must be located between the L and R flanking regions of the TK gene, such that as a consequence of recombination, the antigen of interest is inserted in the viral genome. This antigen was inserted into the plasmid multiple cloning site (MCS) under the control of the VACV synthetic early/late (sE/L) promoter cloned into that same site.
  • MCS plasmid multiple cloning site
  • - Selectable marker gene in cell culture This is located in the area adjacent to the genes of the antigens of interest and within the flanking regions, such that it is inserted into the viral genome next to the genes of interest. Another area of recombination (L flanking region) necessary for the later removal of the marker gene by additional recombination processes is found to be repeated between the antigen of interest and the marker. Recombinant MVAs containing only the antigen of interest are therefore generated, which is necessary for use as vaccine candidates in humans.
  • the LacZ (b-galactosidase) marker gene was used to select in cell culture the intermediary recombinant viruses forming blue lysis plaques, after insertion in the TK locus.
  • the ampicillin resistance gene (b-Lactamase) is included in such plasmids in order to select the bacteria transformed with that gene.
  • the plasmid transfer vector used to introduce the coronavirus SARS-CoV-2 S protein gene into the MVA TK locus is briefly described below:
  • Plasmid transfer vector pCyA-S was used to generate MVA-S(3P) recombinant virus and was developed by the CNB. It directs the insertion of the coronavirus SARS-CoV-2 prefusion-stabilized S gene sequence, under the control of the VACV sE/L promoter, in the TK locus of the parental MVA-WT virus.
  • pCyA vector was provided to GeneArt (Thermo Fisher Scientific) for optimization of codons, synthesis of the prefusion-stabilized S gene of SARS- CoV-2 and insertion into the plasmid vector.
  • the S gene was introduced between the VACV TK-L and TK-R flanking regions, under the control of the VACV sE/L promoter, in plasmid pCyA-20 MCS (Gomez et al., 2013, J Virol 87:7282-7300). Furthermore, this plasmid also contains the selectable marker genes for ampicillin and b-galactosidase (LacZ gene). Polymerase chain reaction (PCR) and sequencing techniques confirmed that plasmid pCyA-S(3P)
  • mice of strain C57BL/6JOIaHsd (Envigo Laboratories) 6-8 weeks of age at the start of the experiment were used for the immunogenicity studies. These tests were approved by the Ethics Committee for Animal Testing (CEEA, Comite Etico de Experimentacion Animal) of the CNB (Spanish National Center for Biotechnology), and by the Division of Animal Protection of the Considad de Madrid (PROEX 49/20), in accordance with national and international guidelines and Spanish Royal Decree (RD 53/2013), and were carried out in the animal facility of the National Center for Biotechnology (CNB; Madrid, Spain) in a pathogen-free area.
  • mice Male and female transgenic humanized K18-hACE2 mice, expressing human ACE2, were obtained from the Jackson Laboratory (034860-B6.Cg-Tg(K18-ACE2)2Prlman/J) and efficacy experiments were performed at the BSL-3 laboratory of CISA-INIA (Madrid, Spain).
  • the experiments performed in K18-hACE2 humanized transgenic mice at the CNB-CSIC and CISA-INIA were approved by the Ethical Committee of Animal Experimentation (CEEA) of the CNB-CSIC and CISA-INIA (Madrid, Spain) and by the Division of Animal Protection of the Considad de Madrid (PROEX 169.4/20 and 161.5/20).
  • Animal procedures were conformed to international guidelines (European Union (EU) Directive 2010/63EU and Recommendation 2007/526/EC) and to the Spanish law under the Royal Decree (RD 53/2013).
  • Table 1 shows the different oligonucleotides used for recombinant virus cloning, sequencing, and generation processes and those used in the PCR for detecting mycoplasma contamination.
  • SARS-CoV-2 S peptide pools These peptides are grouped into two mixtures, S1 (158 peptides) and S2 (157 peptides) (JPT). They are overlapping peptides of the coronavirus SARS-CoV-2 S-protein formed by 15 amino acids (15-mers), 11 of which are overlapping. Each peptide pool (S1 or S2) is at a concentration of 500 pg/ml. 2.2.2. Proteins
  • the coronavirus SARS-CoV-2 S and RBD soluble proteins were used in enzyme-linked immunosorbent assays (ELISA) at a concentration of 2 pg/ml. Those proteins were provided by Dr. Jose Maria Casasnovas (CNB, Madrid).
  • the S sequence (residues 1 to 1 ,208; Wuhan-Hu-1 strain, GenBank accession number MN908947.3) contained a T4 fibritin trimerization sequence, a Flag epitope, and an 8xHistag at the C-terminus.
  • the furin-recognition motif (RRAR) was replaced by the GSAS sequence, and it also contained the A942P, K986P, and V987P substitutions in the S2 portion.
  • the S protein was purified by nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography from transfected cell supernatants and it was transferred to HEPES buffered saline (HBS), pH 7.5, during concentration or by size- exclusion chromatography (SEC).
  • Ni-NTA nickel-nitrilotriacetic acid
  • the RBD proteins with the S residues 332-534 were produced with an N-terminal HA- tag (YPYDVPDYA) and fused to either a T4 fibritin trimerization sequence, a Flag epitope and an 8xHis-tag (RBD-TFH), or to the human IgGi Fc region (RBD-Fc) at its C-terminus.
  • YPYDVPDYA N-terminal HA- tag
  • RBD-TFH 8xHis-tag
  • RBD-Fc human IgGi Fc region
  • RBD-Fc proteins with RBD substitutions in VoC were also produced: alpha (B.1.1.7; N501Y), beta (B.1.351; K417N-E484K-N501Y), gamma (P.1.; K417T-E484K- N501Y), delta (B.1.617.2; L452R-T478K), kappa (B.1.617.1; L452R-E484Q) and zeta (P.2; E484K).
  • the RBD-TFH and RBD-Fc proteins were purified by affinity chromatography with Ni-NTA and IgSelect (GE Healthcare) columns, respectively.
  • plasmid DNA from bacterial cultures To extract plasmid DNA from a bacterial culture, the bacteria were previously grown in LB and then DNA was then extracted by means of different commercial kits. The purification of plasmid DNA during the molecular cloning process was performed using the Qiagen Plasmid Mini kit (Qiagen), from 2 ml of positive bacterial clone cultures, following the manufacturer’s instructions. Larger amount of purified plasmid DNA were obtained (from 200-ml bacterial cultures) for use in transfections and infections- transfections in cell cultures using the Qiagen Plasmid Maxi kit (Qiagen), following the manufacturer's protocol. The plasmid DNAs used for in vivo experiments were purified by means of the Qiagen Plasmid endo-free Mega kit (Qiagen) from 500-ml bacterial cultures, following the manufacturer’s recommendations.
  • Qiagen Plasmid Mini kit Qiagen Plasmid Mini kit
  • RNAse A 40 pg/ml, PanReac AppliChem
  • RNAse A 40 pg/ml, PanReac AppliChem
  • saturated NaCI was added. It was mixed by inverting the tube and centrifuged at 13000 rpm for 10 min at room temperature. The supernatant was collected, mixed with isopropanol at a ratio of 1 :0.7 to precipitate the DNA, and centrifuged at 13,000 rpm for 10 min at room temperature. The precipitate was washed with 75 % ethanol and centrifuged again at 13,000 rpm for 10 min at room temperature.
  • PCR Polymerase chain reaction
  • the PCR technique was used to amplify DNA fragments for later cloning or to check for the gene insertion in transfer plasmids or in the recombinant MVA genome.
  • the polymerase used was Phusion® High Fidelity (New England Biolabs) with its corresponding buffers and reagents and following the manufacturer’s recommendations. About 10-100 ng of template DNA together with 0.4 mM of the corresponding oligonucleotides, 1-2.5 units of Phusion® High Fidelity polymerase with the corresponding buffer, and 0.2 mM of each of the four deoxynucleotide triphosphates (dNTPs) (Roche Diagnostics GmbH) were used for each reaction.
  • dNTPs deoxynucleotide triphosphates
  • the temperature used for annealing was selected according to the oligonucleotides used, and the extension time used depended on the length of the fragment to be amplified.
  • the reactions were carried out in a 96-well VeritiTM thermocycler (Applied Biosystems).
  • Coronavirus SARS-CoV-2 S gene was cloned into transfer plasmid pCyA to generate plasmid transfer vector pCyA-S by GeneArt (Thermo Fisher Scientific).
  • the protein samples of the cell extracts and supernatants were analyzed by means of one-dimensional sodium dodecyl sulfate-polyacrylamide gel (SDS-PAGE) electrophoresis according to standard protocols previously described (Green MR, Sambrook J. 2012. Molecular Cloning: a laboratory manual, 4 ed. Cold Spring Harbor Laboratory Press, New York, USA).
  • SDS-PAGE sodium dodecyl sulfate-polyacrylamide gel
  • the proteins were precipitated from the supernatant with 10 % trichloroacetic acid (TCA) (Sigma-Aldrich), centrifuged at 13,000 rpm for 15 min at room temperature, and the precipitate was resuspended in Laemmli 1C-b- mercaptoethanol. After that, both the cell extract and supernatant samples were denatured at 95°C for 10 min and were loaded in 7 % polyacrylamide gels in the presence of SDS. The proteins were separated by means of one-dimensional electrophoresis at 100 V and at room temperature for about 90 min.
  • TCA trichloroacetic acid
  • the SDS-PAGE gels were transferred to nitrocellulose membranes (GE Healthcare), following the wet system protocol recommended by the manufacturer (Mini Trans-Blot® Cell, Bio-Rad).
  • the gel and previously hydrated nitrocellulose membrane were arranged between two Whattman-3MM® filter papers (GE Healthcare), which were also hydrated. They were then mounted in the transfer system in the presence of the transfer buffer, and the transfer was performed at a current intensity of 100 V for 50 min. Once this ended, checking for the presence of proteins was performed by staining the membrane with the reversible Ponceau S stain (0.2 % Ponceau in 3 % TCA; Sigma-Aldrich).
  • nitrocellulose membrane was then blocked with a 5 % skim milk powder solution prepared in PBS 1X-0.05 % Tween20 (Sigma-Aldrich) (PBS-T) at room temperature for 1 hour with gentle stirring.
  • PBS-T PBS 1X-0.05 % Tween20
  • the corresponding primary antibodies prepared at the desired dilution in the blocking buffer, were added and incubated under stirring at 4°C overnight.
  • the membrane was incubated with the appropriate secondary antibody (suitably diluted in the same blocking buffer) for 1 hour at room temperature and was then washed again four times with PBS-T.
  • the membranes were developed with the ECL® luminol system (Amersham), exposing Carestream Kodak BioMax XAR autoradiography film (Kodak) or directly in the ChemiDocTM Imaging System (Bio-Rad). The proteins bands were analyzed and quantified by means of Image Lab software (Bio-Rad).
  • Monolayers of HeLa cells were mock infected or infected at 5 PFU/cell with MVA-WT, MVA-S, or MVA-S(3P).
  • cells were collected by scraping and centrifuged at 2,000 rpm for 5 min, and the cellular pellets were resuspended in phosphate-buffered saline (PBS) staining solution (1X PBS, 0.5% bovine serum albumin [BSA], 1% FCS, 0.065% sodium azide, 2 mM EDTA) and added to a 96-well plate at a rate of 200,000 cells per well. Then, Fc block (BD Pharmingen) was added for 20 min at 4°C.
  • PBS phosphate-buffered saline
  • mice monoclonal antibodies against S and RBD proteins were added to the cells for 30 min at 4°C, and then anti-mouse IgG fluorescein isothiocyanate (FITC)- conjugated antibodies (diluted 1 :100; eBioscience) were added to the cells as secondary antibodies for 20 min in the dark at 4°C.
  • FITC fluorescein isothiocyanate
  • cells were fixed with 4% paraformaldehyde (PFA) for 20 min in the dark at 4°C and were acquired using a Gallios flow cytometer (Beckman Coulter). Data were analyzed using FlowJo software (version 8.5.3; Tree Star, Ashland, OR).
  • Mammalian expression vectors that contained recombinant DNAs coding for the soluble S protein with a T4 fibritin trimerization sequence, a Flag peptide and a His-tag at the C- terminus were used for S expression by transfection of HEK293T cells.
  • S constructs without the furin motif and with the K986P and V987P substitutions in the S2, and without (S2P) or with the mutation A942P (S3P) were transfected into cells for protein expression.
  • the cell supernatants were collected for analysis of protein expression by sandwich ELISA using an anti-Flag antibody and a biotin-labelled antibody that recognize the RBD.
  • Optical density at 490 nm in the ELISA assays were corrected by the background signals determined in wells with untransfected cell supernatants. Two independent transfections were performed. 3.3. Virus manipulation techniques
  • viruses All the viruses were kept at -70°C and thawed at 37°C in a bath prior to use. Once thawed, they were stirred with a vortex and sonicated with a 3-cycle 10-second sonication and 10-second pause program (Misonix Incorporated S-3000 Sonicator, Cole-Parmer). The viruses were then added to the cell monolayer with the minimum volume of (serum-free) DMEM needed to cover the cell monolayer at the desired MOI. After 1 hour of adsorption at 37°C, the inoculum was removed and fresh DMEM-2 % FCS medium was added. The time the different infections were maintained varied with the objective of the infection, and the manner in which the cells were collected also varied.
  • MVA-S(3P)j a recombinant MVA virus expressing coronavirus SARS-CoV-2 prefusion-stabilized S protein [MVA-S(3P)j was generated in DF-1 cells according to the previously described standard infection/transfection protocol (Earl et al., 2001, Curr Protoc Mol Biol, 16:16 17), with certain modifications.
  • MVA-WT was used as the parental virus, as previously described (Garcia- Arriaza et al., 2014, J Virol 88:3527-3547).
  • DNA-lipofectamine 2000 was prepared by mixing 10 pg of the corresponding transfer plasmid with the suitable volume of lipofectamine 2000 (Invitrogen) in Opti- MEM (Gibco) (1.5 pi lipofectamine 2000/pg of DNA) for 20 min at room temperature to form DNA-liposome complexes.
  • the inoculum was removed, the cells were washed two times with Opti-MEM and incubated with 1 ml of the DNA-lipofectamine mixture for 4-6 hours at 37°C and 5 % CO2.
  • the transfection medium was removed, the cells were washed two times with Opti-MEM and incubated with DMEM-2 % FCS medium at 37°C and 5 % CO2.
  • DMEM-2 % FCS medium 37°C and 5 % CO2.
  • the cells were then frozen (at -70°C) and thawed (at 37°C) three times, stirring with a vortex between each freeze-thaw cycle to lyse them and release the virus into the supernatant, which was obtained after centrifuging at 3,000 rpm for 5 min at room temperature.
  • the virus was then used to infect confluent monolayers of DF-1 cells grown in 6-well plates (M6) (Nunc) at different serial dilutions (from 10 1 to 10 6 ) in serum-free DMEM.
  • the inoculum was removed and replaced with 3 ml of solid infection medium consisting of a mixture of 1.9 % (previously melted) agarose (Conda) with DMEM 2X-4 % FCS medium at a 1 :1 ratio.
  • solid infection medium consisting of a mixture of 1.9 % (previously melted) agarose (Conda) with DMEM 2X-4 % FCS medium at a 1 :1 ratio.
  • 1 ml of the 1.9 % agarose-DMEM 2X-4 % FCS 1:1 mixture and 1.2 mg/ml of X-Gal substrate (Sigma-Aldrich) was added to view the lysis plaques. After 24 hours, the blue plaques that were more isolated from other lysis plaques were selected.
  • the selected lysis plaques were obtained with a 150-mm glass Pasteur pipette (Deltalab) and added to 500 pi of serum-free DMEM. After three freeze-thaw cycles and subsequent stirring with a vortex and sonication, these plaques were used as an inoculum to infect monolayers of confluent cells in 24-well plates (M24) (Nunc) as explained in section 3.3.1. These infections were performed to re-grow the virus, and they were collected when a cytopathic effect was observed.
  • the initial viral stock (stock P1) consists of the generated recombinant virus originating from cell monolayers infected with the final plaque and collected after observing a cytopathic effect.
  • stock P2 5 p150 plates (Nunc) containing confluent DF-1 cells were infected at an MOI of 0.05 PFU/cell and cells were collected when a cytopathic effect was observed.
  • Stock P2 was used in all the experiments for characterizing the virus in vitro.
  • the purified viral stock (stock P3) was generated from stock P2 (described in section 3.3.4.).
  • Viral titration Titration of the MVA-S(3P) virus was carried out according to the previously described standard protocols (Ramirez et ai., 2000, J. Virol, 74:923-933).
  • DF-1 cells seeded in M6 plates were infected in duplicate with serial dilutions of the virus in serum-free DMEM, as described in section 3.3.1. The medium was removed 30-40 hours post-infection and the cells were fixed for 3 min using a 1:1 mixture of methanol and acetone and the titer was determined by means of an immunostaining assay which allows detecting and counting lysis plaques formed by the virus.
  • the monolayers were thereby incubated with a rabbit anti-VACV WR polyclonal primary antibody (diluted 1:1.000 in PBS-3 % FCS; CNB) for 1 hour at room temperature; it was then washed three times with PBS 1X and incubated for 1 hour at room temperature with the HRP-conjugated goat anti- rabbit secondary antibody (diluted 1 :1.000 in PBS-3 % FCS; Sigma-Aldrich).
  • the plates were developed using 1 mg/ml of 3,3’- diaminobenzidine tetrahydrochloride (DAB; Sigma-Aldrich), as the HRP substrate, with 30 % hydrogen peroxide (Sigma-Aldrich) and 3 % nickel sulfate (N1SO4) (Sigma- Aldrich). After counting the lysis plaques, the titer was referenced as PFU/ml. Replication kinetics
  • MVA-S(3P) The genetic stability of vaccine candidates MVA-S(3P) was analyzed. Monolayers of DF-1 cells were infected with MVA-S(3P) recombinant virus at an MOI of 0.05 PFU/cell. The cells were collected 72 hours post-infection, frozen-thawed three times, and briefly sonicated. The cell extracts were then centrifuged at 1,500 rpm for 5 minutes, and the supernatant was used for a new round of infection at a low MOI. The same method was repeated eight times. Expression of the coronavirus SARS-CoV-2 S protein was analyzed by means of Western blot (see section 3.2.1.) after infecting DF-1 cells with the viral stocks from each passage. 3.3.4. Virus purification
  • Purified virus stocks (stock P3) were used for the in vivo assays according to the method first described by Joklik (Joklik, 1962, Virology, 18:9-18) and modified by Esteban (Esteban, 1984, Virology, 133:220-227).
  • 30 p150 plates containing confluent CEF cells were infected with a stock P2 of MVA-S(3P) at an MOI of 0.01 PFU/cell. The cells were collected when a cytopathic effect was observed (usually after 3 days), centrifuged at 1 ,500 rpm for 5 min at 4°C, and the precipitate was washed with PBS and resuspended in 10 mM Tris-HCI buffer pH 9.
  • the infected cells were then lysed by means of three sonication cycles, stirring with a vortex, and centrifugation to release the viral particles into the supernatant.
  • this supernatant was centrifuged for 1 hour at 20,000 rpm at 4°C in the SW28 rotor (Beckman) on a 36 % sucrose pad in 10 mM Tris-HCI pH 9.
  • the obtained precipitate was resuspended in 10 mM Tris-HCI pH 9 and centrifuged again on another 36 % sucrose pad under the same conditions.
  • the precipitate obtained in this second centrifugation was resuspended in 10 mM Tris-HCI pH 9, aliquoted, and frozen at -70°C until use.
  • the purified virus was titered in duplicate and checked for the absence of mycoplasma contamination (through PCR with mycoplasma-specific oligonucleotides; see Table 1), bacteria (by means of growth in LB agar plates), and fungi (by means of growth in blood agar plates, Oxoid). Furthermore, checking for the correct expression of the S antigen of stock P3 was performed by means of PCR and Western blot before use in the in vivo assays.
  • Intramuscular immunization was performed in the triceps of both hind legs in a total volume of 100 pi of PBS (50 mI/leg), using a BD Micro-Fine (30 G) x 8 mm insulin syringe (BD Biosciences).
  • mice 6 female C57BL/6 mice per group were inoculated with a single dose of 1 x 10 7 PFU of vaccine candidates MVA-S, MVA-A-S and MVA-S(3P) and control MVA-WT virus by intranasal route in 50mI of PBS. The mice were sacrificed 14 days after the immunization.
  • the ELISpot assay was used to detect S antigen-specific IFNy-secreting T cells.
  • 96-well nitrocellulose-bottom plates (Millipore) were covered with 75 mI/well of a solution of the rat anti-mouse IFNy monoclonal antibody (Pharmingen, San Diego, California) at a concentration of 6 pg/ml in PBS. After incubating overnight at room temperature, the wells were washed three times with RPMI medium and blocked with RPMI-10 % FCS for at least one hour at 37°C in 5 %C0 2 atmosphere.
  • the spleens of each group of immunized animals were collected in RPMI-10 % FCS medium and processed together to obtain the splenocytes as previously described (Garcia-Arriaza et al., 2013, PLoS One, 8:e66894; Najera et al., 2010, PLoS One, 5:e11406).
  • the spleens were homogenized by means of mechanical disintegration through a 40-pm cell strainer (Falcon). The disintegrated cells were centrifuged for 5 min at 1 ,500 rpm at 4°C and washed with RPMi-10 % FCS.
  • the erythrocytes were lysed by adding 0.1 M NH4CI (2 ml/spleen) for 5 min in ice. After this time, the cells were washed three times with RPMI-10 % FCS to eliminate fat and resuspended in 12 ml of RPMI-10 % FCS, and the number of living splenocytes was counted by means of staining with trypan blue (4 % in water; Sigma-Aldrich).
  • 10 6 splenocytes per condition were re-stimulated with 1 pg/ml of the S1 or S2 peptide pool.
  • 10 6 splenocytes were stimulated with 2.5 pg/ml of VACV E3 peptide.
  • the plates were incubated with the peptides for 48 hours at 37°C in 5 % CO2 atmosphere, washed five times with PBS-T, and incubated with 2 pg/ml of biotinylated rat anti-mouse IFNy monoclonal antibody XMG1.2 (Pharmingen) diluted in PBS-T, for 2 hours at room temperature.
  • the plates were then washed five times with PBS-T and a 1 :800 dilution of HRP-conjugated streptavidin (0.5 mg/ml; Sigma-Aldrich) was added. After 1 hour at room temperature, it was washed three times with PBS-T and two times with PBS, and finally 1 pg/ml of the DAB substrate (Sigma-Aldrich), resuspended in 50 mM Tris-CI pH 7.5 and 0.015 % H2O2, was added to develop the plates.
  • HRP-conjugated streptavidin 0.5 mg/ml; Sigma-Aldrich
  • the reaction was stopped by washing the plate with abundant water and once it was dry, the spots were counted using the ELISpot Reader System -ELR02- plate reader (AID Autoimmun Diagnostika GmbH) with the aid of AID ELISpot reader system software (Vitro).
  • mice per group were immunized and sacrificed 10 days after the last immunization. Moreover, animals immunized with one single intranasal dose were sacrificed at 14 days postimmunization. After sacrificing the animals, spleens, lungs or bronchial lymph nodes were removed from the immunized animals in RPMI-10 % FCS medium and processed as described in the preceding section.
  • the cells were then resuspended in RPMI-10 % FCS medium with 2 pl/ml of Monensin 1X (Thermo Fisher Scientific), 2 pl/ml of brefeldin A (BFA) ( Protein Transport Inhibitor BD GolgiPlug, BD Biosciences), and a 1 :300 dilution of anti-CD107a-FITC antibody.
  • 1-4 x 10 6 cells were added in M96 conical bottom wells and were incubated for 6 hours in the presence of 1 pg/ml of the S1 or S2 peptide pool, or with 5 pg/ml of VACV E3 peptide to determine the response to the MVA vector or to monkeypox virus.
  • the cells were stimulated with 2 mI/ml of LAC (Leukocyte Activation Cocktail, BD Biosciences) and Monensin 1X. After 6 hours of stimulation, the cells were washed with IB buffer and incubated with Violet Dye (0.5 mI/ml, Invitrogen) for 20 min in the dark at 4°C to evaluate cell viability. Next, two washes were performed with IB buffer and the cells were incubated for 20 min in the dark at 4°C with 50 mI of the primary surface antibodies (described in the Table 2) diluted as indicated for each batch.
  • LAC Leukocyte Activation Cocktail
  • Monensin 1X Monensin 1X
  • the cells were then washed two times and 100 mI of Cytofix/Cytoperm (BD Biosciences) was added per well for 20 min in the dark to 4°C for fixing and permeabilizing the cells, and they were then left in IB buffer overnight at 4°C in the dark. A wash was performed the next day with Permwash 1X (BD Biosciences) and 25 m I of Fc Block diluted 1 :100 in Permwash 1X were added for 5 min at 4°C in the dark.
  • Cytofix/Cytoperm BD Biosciences
  • the analysis strategy was performed by selecting the living cells expressing CD3 on their surface; then those expressing CD4, CD8, CD127, or CD62L; and finally those secreting the different cytokines (IFN-y, TNF-a, and IL-2) or expressing degranulation marker CD107a.
  • spleens were extracted from sacrificed animals and processed as explained above. The splenocytes were then resuspended in RPMI-10% FCS medium with 1 mI/ml of BFA (BD Biosciences), 1 mI/ml of Monensin 1X (eBioscience), and a 1 :100 dilution of the anti- CD154 (CD40L)-PE antibody.
  • splenocytes were stimulated with 5 pg/ml of S-protein and 1 pg/ml of S1 and S2 peptide pools for 6 hours at 37°C in a conical- bottom 96-well plate.
  • the cells were then stained with Fixable Viability Stain (FVS) 520 (BD Biosciences) for 20 min at 4°C in the dark to analyze cell viability.
  • FVS Fixable Viability Stain
  • the splenocytes were then washed two times with IB buffer and stained for 20 min at 4°C in the dark with 50 mI of the antibodies specific against the surface markers (described in Table 2), using the dilutions recommended by the manufacturer.
  • the splenocytes were again washed two times with IB buffer, fixed, and permeabilized with the BD Cytofix/Cytoperm TM kit (BD Biosciences) for 20 min at 4°C in the dark, and they were left in IB buffer overnight at 4°C in the dark.
  • the cells were washed the next day with Permwash 1X (BD Biosciences) and the Fc receptors were blocked with 25 pi of Fc Block (diluted to 1:100 in Permwash 1X) for 5 min at 4°C in the dark.
  • the analysis strategy was performed by selecting living cells expressing CD3, CD4, and CD44 on their surface, followed by cells expressing CXCR5, PD1 , and CD154 (CD40L), and finally cells secreting the different cytokines (IFN-y, IL-4, and IL-21).
  • the humoral immune response was determined by analyzing the levels of IgG antibodies in the sera of immunized mice and the capacity of these antibodies to neutralize the SARS-CoV-2 virus. Moreover, levels of IgA antibodies in bronchoalveolar lavages (BAL) were also analyzed. To obtain the sera, blood was collected from the animals by submandibular bleeding or after sacrificing them by means of intracardiac puncture. Next, the blood samples were maintained at 37°C for 1 hour and kept at 4°C overnight. The tubes of blood were centrifuged the next day at 3600 rpm for 20 min at 4°C and the serum was obtained, inactivated at 56°C for 30 min and kept at -20°C until use.
  • BAL bronchoalveolar lavages
  • BAL samples were obtained in 700 mI of RPM I, after the sacrifice of the mice, inactivated at 56°C for 30 min and kept at -20°C until use. Serial dilutions of each individual serum sample (or group of sera) or group of BAL samples were then performed to measure the titers of coronavirus SARS-CoV-2 S-protein-specific and RBD-specific antibodies by means of ELISA, or to measure their SARS-CoV-2 neutralizing capacity. These techniques are explained in the following sections.
  • Enzyme-linked immunosorbent assay ELISA assays were performed to analyze the levels of antibodies in the serum of immunized animals.
  • NUNC MaxiSorpTM 96-well plates (Thermo Fisher Scientific) were coated with 2 pg/ml of the coronavirus SARS-CoV-2 S and RBD proteins in PBS and incubated at 4°C overnight. The plates were washed three times the next day with PBS- T and blocked for 2 hours at room temperature with 5% skim milk prepared in PBS-T.
  • the plates were washed three times with PBS-T, 50 pi of the serial dilutions of the serum or BAL samples diluted in PBS with 1 % skim milk and 0.01% Tween20 were added, and the plates were incubated for 1.5 hours at room temperature.
  • the plates were again washed three times with PBS-T and incubated with 50 pi of HRP-conjugated mouse anti-lgG, -lgG1, -lgG2b, -lgG2c, -lgG3 or -IgA antibodies (diluted to 1:1000 in PBS with 1% skim milk and 0.01% Tween20) for 1 hour at room temperature.
  • the plates were developed by adding 100 mI of TMB substrate (Sigma-Aldrich) and the reaction was stopped by adding 50 mI of 1 M H2SO4. Absorbance was read at 450 nm by means of an EZ Read 400 microplate reader (Biochrom). Total IgG titers were measured as the last dilution that gives an absorbance at least 3 times higher the absorbance of a naive serum.
  • RBD-Fc proteins without (WT, Wuhan) or with mutations in VoC (alpha, beta, gamma, delta, kappa and zeta) were used in ELISA assays to determine the RBD- specific IgG antibody titers. Similar amounts of plastic-bound RBD-Fc proteins were used, as determined with an anti-HA antibody (2.5-0.0025 pg/ml) that recognized an HA tag at the RBD N-terminus. Differences in the HA antibody signal at 450 nm were used to standardize the anti-mouse IgG binding to RBD variants with respect to the WT before IgG titer determination.
  • a mix of retrovirus-based pseudoparticles expressing SARS-CoV-2 S protein and mice serum samples were preincubated for 1 hour at 37°C and then added to the cells in triplicates.
  • the DMEM-2%FCS medium was replaced 24 h after infection, and then, 24 hours later, cells were lysed in passive lysis buffer (Promega, Madison, Wl) and the luciferase activity was measured in a luminometer (Thermo Appliskan Multimode Microplate Reader, Thermo Fisher Scientific).
  • the ID50 titers were determined as the highest dilution of serum which resulted in a 50% reduction of luciferase units compared with serum samples from control group (pseudotyped viruses not incubated with serum).
  • live-virus SARS-CoV-2 neutralization antibody titers were assessed by a microneutralization test (MNT), using SARS-CoV-2 MAD6 strain in a BSL-3 laboratory at the CNB-CSIC. Serum samples were inactivated at 56°C for 30 min and then serially diluted two-fold in duplicate in serum-free DMEM and incubated at a 1:1 ratio with 100 TCID50 (50% Tissue Culture Infectious Dose) of SARS-CoV-2 MAD6 isolate at 37° C for 1 hour.
  • MNT microneutralization test
  • the virus/serum mixture were added to VeroE6 cell monolayers, seeded in 96-well plates (40.000-50.000 cells per well), and incubated at 37° C, in a 5% CO2 incubator for 3 days. Then, cells were fixed with 4% formaldehyde and stained with crystal violet. ID50 titers were calculated as the reciprocal dilution resulting in 50% inhibition of cell death.
  • a WHO International Standard containing pooled plasma obtained from eleven individuals recovered from SARS-CoV-2 infection was used for the calibration and harmonisation of serological assays detecting anti-SARS-CoV-2 neutralizing antibodies (NIBSC code: 20/136).
  • SARS-CoV-2 pseudotyped Vesicular Stomatitis Virus (VSV) expressing S protein SARS-CoV-2 pseudotyped Vesicular Stomatitis Virus (VSV) expressing S protein.
  • SARS-CoV-2 S-protein pseudotyped rVSV-luc recombinant viruses (PSV) were produced as described elsewhere.
  • SARS-CoV-2 S variants used were S_614D, S_614G, alpha (B.1.1.7), beta (B.1.351), gamma (P.1) and delta (B.1.617.2).
  • SARS-CoV-2 S variants used were S_614D, S_614G, alpha (B.1.1.7), beta (B.1.351), gamma (P.1) and delta (B.1.617.2).
  • SARS-CoV-2 S variants used were S_614D, S_614G, alpha (B.1.1.7), beta (B.1.351), gamma (P
  • CoV-2 S mutant D614G was generated by site-directed mutagenesis (Q5 Site Directed Mutagenesis Kit; New England Biolabs) following the manufacturer’s instructions and using as an input DNA a pcDNA3.1 expression vector encoding SARS-CoV-2 S_614D.
  • GISAID EPIJSL 19703357
  • GeneArt Thermo Fisher Scientific, GeneArt GmbH, Regensburg, Germany
  • the neutralization activity of serum samples was tested by triplicates at several two-fold dilutions.
  • viruses-containing transfection supernatants were normalized for infectivity to a MOI of 0.5-1 and incubated with the dilutions of serum samples at 37°C for 1 hour in 96-well plates. After the incubation time, 2 x 10 4 Vero-E6 cells were seeded onto the virus-serum mixture and incubated at 37°C for 24 hours.
  • NT50 titers were calculated using a nonlinear regression model fit with settings for log agonist/inhibitor versus normalized response curves, in GraphPad Prism v8.
  • mice Male and/or female K18-hACE2 mice (9 weeks old at the beginning of the study) immunized with one intramuscular dose of MVA-S and MVA-S(3P) were used to evaluate the efficacy of MVA-S(3P) vaccine candidate.
  • Groups of animals (n 11) received one dose of 1 c 10 7 PFU of MVA-S or MVA-S(3P) by the i.m. route in 100 pi of PBS (50 mI/leg) at week 0.
  • Mice primed with the same dose of non-recombinant MVA- WT were used as a control group.
  • mice were lightly anesthetized with isoflurane and infected intranasally with 1 c 10 5 PFU of SARS-CoV-2 MAD6 in a total volume of 50 mI of PBS.
  • mice Female K18-hACE2 mice (9 weeks old at the beginning of the study) immunized with one intranasal dose of MVA-S, MVA-A-S and MVA-S(3P) were used to evaluate the efficacy of MVA-S(3P) vaccine candidate.
  • Groups of animals (n 9) received one dose of 1 c 10 7 PFU of MVA-S, MVA-A-S or MVA-S(3P) by the i.n. route in 50 mI of PBS at week 0.
  • Mice primed with the same dose of non-recombinant MVA-WT were used as a control group.
  • mice were lightly anesthetized with isoflurane and infected intranasally with 1 c 10 5 PFU of SARS-CoV-2 MAD6 in a total volume of 50 m! of PBS.
  • female K18-hACE2 mice 22 weeks old at the beginning of the study) immunized with two intramuscular doses of MVA-S(3P) were used to evaluate the efficacy of MVA-S(3P) vaccine candidate.
  • Groups of animals (n 11) received two doses of 1 x 10 7 PFU of MVA-S(3P) by the i.m. route in 100 mI of PBS (50 mI/leg) at weeks 0 and 4.
  • mice primed with the same doses of non-recombinant MVA-WT were used as a control group.
  • mice were lightly anesthetized with isoflurane and infected intranasally with 1 c 10 5 PFU of SARS-CoV-2 beta VOC (B.1.351) in a total volume of 50 mI of PBS.
  • mice were monitored daily for body weight change and survival for 10-15 days postchallenge. Animals with more than a 25% of weight loss were euthanized. At days 4-5 postchallenge, three-six mice per group were euthanized, and lungs, BAL, nasal washes and serum samples were collected. One lung was divided longitudinally in two, with one part placed in RNALater stabilization reagent (Sigma-Aldrich) and stored at - 80°C until RNA extraction, and the other part stored also at -80°C until analysis of virus yields.
  • RNALater stabilization reagent Sigma-Aldrich
  • First-strand cDNA synthesis and subsequent real-time PCR were performed in one step using NZYSpeedy One-step RT-qPCR Master Mix (NZYTech) according to the manufacturer’s specifications using ROX as reference dye.
  • SARS-CoV-2 viral RNA and RNA level of several cytokines were determined using previously validated set of primers and/or probes specific for the SARS-CoV-2 subgenomic RNA for the protein E, genomic RNA for the RdRp protein, each cytokine gene tested, and the cellular 28S rRNA for normalization. Data were acquired with a 7500 real-time PCR system (Applied Biosystems) and analyzed with 7500 software v2.0.6.
  • RNA arbitrary units were quantified relative to the negative group (uninfected mice) and were performed using the 2-AACt method. All samples were tested in triplicate.
  • RT-qPCR reverse transcription of 4000 ng of RNA isolated as described above from lung homogenates of K18-hACE2 mice was performed with the QuantiNova reverse transcription kit (Qiagen), according to the manufacturer’s recommendations.
  • Qiagen QuantiNova reverse transcription kit
  • RT-qPCR was performed with a 7500 real-time PCR system (Applied Biosystems) using Power SYBR green PCR Master Mix (Applied Biosystems), as previously described.
  • mRNA expression levels of cytokines IP-10, IL-12b, CCL11, and IFN-y genes were analyzed by real-time PCR with specific oligonucleotides (sequences are available upon request). Specific gene expression was expressed relative to the expression of the cellular 28S ribosomal RNA gene in fold change units using the 2-AACt method. All samples were tested in triplicate. 3.5.2. Analysis of SARS-CoV-2 virus yields by plaque assay
  • Lungs from K18-hACE2 mice used in the efficacy studies were harvested at 4-5 days post-challenge, weighted, and stored directly at -80°C until homogenized with a gentleMACS dissociator (Miltenyi Biotec) in 2 ml of PBS buffer and aliquoted. Moreover, nasal washes and BAL samples were also analyzed.
  • a gentleMACS dissociator Miltenyi Biotec
  • Lung histopathology The entire left lung lobe was removed from each K18-hACE2 mouse and immersion- fixed in zinc formalin (Sigma-Aldrich) for 48 hours. After fixation period, samples were routinely processed and embedded in paraffin blocks that were then sectioned at 4 pm thickness on a microtome, mounted onto glass slides and routinely stained with haematoxylin and eosin (H&E). Lung sections were microscopically evaluated using an Olympus BX43 microscope by a single veterinary pathologist who was blinded to the identity and group of individual mice.
  • the histopathological parameters evaluated were the follows: capillary endothelial cell activation; alveolar haemorrhages; alveolar oedema; perivascular oedema; alveolar septal thickening (interstitial pneumonia); alveolar damage and hyaline membranes in alveoli; inflammatory cell infiltration in alveoli; bronchi/bronchioles with epithelial necrosis, detached epithelium or inflammatory cells in the lumen (bronchitis/bronchiolitis); peribronchial/peribronchiolar and perivascular mononuclear infiltrates; pneumocytes hyperplasia; cytopathic effect or syncytia; squamous metaplasia; uniform interstitial fibrosis; organized fibrotic tissue around the bronchi/bronchioles or intrabronchiolar (bronchiolitis obliterans) and pleural thickening.
  • the histopathological parameters were graded following a semi-quantitative scoring system as follows: (0) no lesion; (1) minimal lesion; (2) mild lesion; (3) moderate lesion; (4) severe lesion.
  • the cumulative scores of histopathological lesions provided the total score per animal.
  • the individual scores were used to calculate the group average.
  • H&E-stained sections were visually scored 0-6 based on the percentage of lung area affected by inflammatory lesions as follows: 0% of the lung injured (score 0); ⁇ 5% (score 1); 6-10% (score 2); 11-20% (score 3); 21-30% (score 4); 31-40% (score 5); > 40% (score 6).
  • the individual scores were used to calculate the group average.
  • a new MVA viral vector-based vaccine have been designed and developed against the coronavirus SARS-CoV-2 causing the COVID-19 pandemic. Once generated, this recombinant MVA virus have been characterized in vitro and their capacity to stimulate adaptive SARS-CoV-2-specific T cell and humoral immune responses in vivo in immunized mice has been analysed, as well as its efficacy in humanized K18-hACE2 mice.
  • MVA-based vaccine candidate expressing the SARS-CoV-2 full-length prefusion-stabilized S structural gene (Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1 , Genbank number: MN908947.3) [termed MVA-S(3P)] (see Materials and Methods).
  • Vaccine candidate MVA-S(3P) was generated following the insertion of the complete sequence of the coronavirus SARS-CoV-2 S gene (prefusion- stabilized) in the genome of the parental virus MVA-WT.
  • MVA-CoV2-S(3P) vaccine candidate express a human codon optimized full- length S protein that contains three mutations in the furin cleavage site (R682G, R683S, R685S) that avoid the cleavage of the S protein in S1 and S2, and three additional mutations in the S2 region that stabilizes the S protein in a prefusion conformation (A942P, K986P, and V987P) ( Figure 1A).
  • Figure 1A shows a diagram of the generated vaccine candidate MVA-S(3P).
  • the methodology used for generating this vaccine candidate has been described above in Materials and Methods.
  • the correct insertion of the coronavirus SARS-CoV-2 S gene and the purity of the generated vaccine candidate MVA-S(3P) was confirmed by means of PCR and sequencing, after amplifying the DNA obtained from DF-1 cells that were not infected (mock) or infected with 5 PFU/cell of MVA-WT, MVA-S, and MVA-S(3P).
  • Oligonucleotides (described in Table 1 of Materials and Methods) which hybridize in the flanking regions of the MVA TK gene ( J2R gene) were used in the PCR, and the obtained results confirmed the presence of the S gene in MVA-S and MVA-S(3P), without contamination with the parental MVA-WT ( Figure 1B).
  • the TK locus of parental virus MVA-WT was amplified as PCR control, with the TK gene being amplified. The correct presence of the S gene inserted in the TK locus was also confirmed by means of DNA sequencing.
  • MVA-S(3P) constitutively express the prefusion-stabilized SARS- CoV-2 S protein
  • vaccine candidates MVA-S and MVA-S(3P) efficiently express the coronavirus SARS-CoV-2 S protein.
  • Vaccine candidate MVA-S(3P) is stable in cell culture
  • Vaccine candidate MVA-S(3P) expresses high levels of S protein in the cell membrane
  • Vaccine candidate MVA-S(3P) replicates well in permissive cells
  • DF-1 cells were infected with vaccine candidates MVA-S and MVA-S(3P), and parental virus MVA-WT, and cell extracts were collected at different times post-infection (0, 24, 48, and 72 hours), and the amount of virus present was determined.
  • the S protein expressed by MVA-S(3P) is present in the cell membrane, similar to what happen with MVA-S ( Figure 4).
  • Figure 4A In permeabilized cells, large amounts of S protein were detected in the cytoplasm of cells infected with MVA-S or MVA-S(3P) ( Figure 4A).
  • Figure 4B S protein cell surface expression, which colocalized with the wheat germ agglutinin (WGA) cell membrane probe.
  • coronavirus SARS-CoV-2 S-protein-specific and S-protein receptor binding domain (RBD)-specific IgG antibodies were analyzed by means of ELISA 10 days after the prime and 10 days after the second immunization (boost).
  • the animals immunized with MVA-WT were used as a control group.
  • vaccine candidate MVA-S(3P) induced higher levels of total IgG, lgG1 , lgG2b, lgG2c, and lgG3 antibodies against SARS-CoV-2 S- and RBD proteins, and higher neutralizing antibodies than MVA-S, after one dose, but similar after two doses.
  • mice were immunized with two doses of MVA-S or MVA-S(3P).
  • mice were immunized with two doses of MVA-WT.
  • Splenocytes originating from the spleens of each group were stimulated ex vivo with a panel of peptide pools covering the complete sequence of the coronavirus SARS-CoV-2 S-protein (S1 and S2 peptide pools).
  • the samples were stimulated with RPMI as a negative control. After 48 hours of stimulation, the cells were labeled with antibodies to identify IFN-y-secreting cells specific for these peptides (Figure 8).
  • splenocytes originating from the spleens of each immunization group were stimulated ex vivo with a panel of peptide pools covering the complete sequence of the coronavirus SARS-CoV-2 S-protein (S1 and S2 peptide pools).
  • the samples were stimulated with RPMI as a negative control.
  • the cells were labelled with specific antibodies to identify (CD4 + and CD8 + ) T cell populations and respondent cells (expressing CD107a on the surface of the T cells as an indirect cytotoxicity marker and/or producing cytokines IFN-y, TNF-a, and IL-2) by ICS.
  • the polyfunctionality of the CD4 + and CD8 + T cell-mediated immune response generated by both immunization groups was analyzed by measuring the simultaneous production pattern of cytokines (IFN-y, TNF-a, and/or IL-2) plus the cytotoxic potential thereof (CD107a as a degranulation marker).
  • the coronavirus SARS-CoV-2 S-protein (S1 +S2)-specific cell-mediated responses generated by both immunization groups were characterized by a similar high polyfunctionality ( Figure 10).
  • the CD4 + T cell-mediated response was mainly characterized by cells which are capable of carrying out all 4 functions (secreting all 3 cytokines and expressing the marker, CD107a) ( Figure 10A).
  • the CD8 + T cell-mediated response was mainly characterized by cells which are capable of carrying out 3 functions (CD107a, IFN-g and TNF-a) ( Figure 10B).
  • TCM T central memory
  • TEM T effector memory
  • TE T effector
  • Splenocytes isolated from the spleen were stimulated ex vivo with a combination of the coronavirus SARS-CoV-2 S-protein, together with the S1 and S2 peptide pools covering the complete sequence of said protein.
  • the samples were stimulated with RPMI as a negative control.
  • the cells were labelled with specific antibodies to identify the population of S-specific Tfh cells (CD4 + , CXCR5 + , and PD1 + ) expressing the marker CD40L (marker related to T cell effector functions) and/or producing the cytokines IFN-y and/or IL-21.
  • the polyfunctionality of the Tfh cell-mediated immune response generated by both immunization groups was analyzed by measuring the simultaneous production pattern of cytokines (IFN-g and/or IL-21) plus the marker, CD40L.
  • the coronavirus SARS-CoV-2 S-protein-specific Tfh cell-mediated responses generated by both immunization groups were characterized by a high polyfunctionality ( Figure 12C).
  • the Tfh cell-mediated response was mainly characterized by cells which are capable of carrying out all 2 functions (secreting IFN-g and IL-21), followed by cells capable of carrying out 3 functions (secreting the 2 cytokines and expressing the marker, CD40L) ( Figure 12C).
  • vaccine candidates MVA-S and MVA-S(3P) induce Tfh cell- mediated responses.
  • mice were immunized with one dose (1 c 10 7 PFU by the intramuscular route) of MVA-S or MVA-S(3P) at week 0 and then challenged at week 4 with 1 x 10 5 PFU of SARS-CoV-2 (MAD6 isolate) by the intranasal route (Figure 13A). Mice primed with MVA-WT were used as control group.
  • mice were monitored for changes in body weight and mortality for 15 days after the challenge. All K18-hACE2 mice immunized with one dose of MVA-S(3P) and challenged with SARS-CoV-2 did not lose body weight (Figure 13B) and survived ( Figure 13C), whereas mice immunized with one dose of MVA-S lost body weight during the first 4 days postchallenge ( Figure 13B), but recovered and survived ( Figure 13C). On the other hand, mice inoculated with MVA-WT and challenged with SARS-CoV-2 lost body weight (more than 25%) (Figure 13B) and all died at 6-7 days postchallenge (Figure 13C).
  • mice per group were sacrificed at day 4 after SARS-CoV-2 virus challenge, lungs collected and processed, and the presence of SARS-CoV-2 subgenomic E and genomic RdRp RNA (Figure 13D) as well as of live infectious virus ( Figure 13E) was analyzed.
  • One dose of MVA-S(3P) was more effective than MVA-S to prevent SARS-CoV-2 replication, reducing significantly subgenomic and genomic SARS-CoV-2 RNA levels (Figure 13D) in comparison to MVA-WT control infected mice, as well as the infectious virus yields with respect to the MVA-S vaccinated mice and MVA-WT control infected mice ( Figure 13E).
  • mice vaccinated with one dose of MVA-S(3P) exhibited lower lung inflammation scores ( Figure 14A, left panel) and lower percentages of lung area with lesions ( Figure 14A, right panel) than control MVA-WT mice, and significantly lower lesions and lung affected area than mice immunized with one dose of MVA-S ( Figure 14A).
  • Representative images of lung sections are included in Figure 14B; mice vaccinated with one dose of MVA-S(3P) only displayed focal thickening of the alveolar septae, and occasional presence of inflammatory cells within the alveoli.
  • mice immunized with one dose of MVA-S or with control MVA-WT showed more severe diffuse thickening of the alveolar septae, higher presence of mononuclear cell infiltrates within alveolar spaces, as well as the presence of larger multifocal perivascular and peribronchiolar mononuclear infiltrates (Figure 14B).
  • MVA-S(3P) One dose of MVA-S(3P) triggered in K18-hACE2 transgenic mice higher titers of S- and RBD-specific IgGs and neutralizing antibodies against different SARS- CoV-2 variants of concern (VoC) than MVA-S
  • Cells were stimulated ex vivo with S peptide pools, spanning the entire S protein, and an ICS assay was performed to measure the induction of SARS- CoV-2 S-specific CD4 + and CD8 + T cells expressing CD107a, and secreting IFN-y, TNF-a, and/or IL-2.
  • Challenged mice previously inoculated with one dose of MVA-WT were used as a control group.
  • mice were monitored for changes in body weight and mortality for 14 days after the challenge. All K18-hACE2 mice intranasally immunized with one dose of MVA-A-S or MVA-S(3P) and challenged with SARS-CoV-2 did not lose body weight (Figure 18B) and survived ( Figure 18C), whereas mice inoculated with MVA-WT and challenged with SARS-CoV-2 lost body weight (Figure 18B) and all died at 8 days postcha!lenge (Figure 18C). Mice immunized with one dose of MVA-S lost body weight during the first 6 days postchallenge (Figure 18B), but recovered and survived (Figure 18C).
  • mice per group were sacrificed at day 5 after SARS-CoV-2 virus challenge, lungs and nasal washes collected and processed, and the presence of SARS-CoV-2 subgenomic E and genomic RdRp RNA ( Figure 18D and 18E), as well as of live infectious virus ( Figure 18E and 18G) was analyzed.
  • MVA-S(3P) One intranasal dose of MVA-S(3P) was more effective than MVA-S or MVA-A-S to prevent SARS-CoV-2 replication, reducing significantly subgenomic and genomic SARS-CoV-2 RNA levels in lungs ( Figure 18D) and nasal washes (Figure 18E), in comparison to MVA-WT control infected mice.
  • no infectious virus was detected in lungs ( Figure 18F) or nasal washes ( Figure 18G) from vaccinated mice, in comparison to MVA-WT control mice, indicating that sterilizing immunity was achieved.
  • mice intranasally vaccinated with one dose of MVA-S(3P) displayed significant lower lung inflammation scores ( Figure 19A, left panel) and lesser percentages of lung area with lesions ( Figure 19A, right panel) than control MVA-WT mice.
  • mice vaccinated with MVA-S or MVA-A-S showed slightly lower levels of lung inflammation scores and lesser percentages of lung area with lesions than control MVA-WT mice ( Figure 19A), but differences were not significant.
  • mice vaccinated with one dose of MVA-S(3P) only displayed focal thickening of the alveolar septae, and occasional presence of inflammatory cells within the alveoli ( Figure 19B).
  • mice immunized with one dose of MVA-S or MVA-A-S or with control MVA-WT showed more severe diffuse thickening of the alveolar septae, higher presence of mononuclear cell infiltrates within alveolar spaces, as well as the presence of larger multifocal perivascular and peribronchiolar mononuclear infiltrates (Figure 19B).
  • MVA-S(3P) compared to control MVA- WT infected mice, one intranasal dose of MVA-S(3P) induced a significant down- regulation of several pro-inflammatory cytokines, such as IL-6, CXCL10, TNF-a, IFN-y, IL-12b, CXCL5, CCL2, CCL11 and CCL12, either in lung samples ( Figure 20A) or in nasal washes ( Figure 20B).
  • cytokines such as IL-6, CXCL10, TNF-a, IFN-y, IL-12b, CXCL5, CCL2, CCL11 and CCL12
  • MVA-S(3P) induced significantly higher titers of neutralizing antibodies against live SARS-CoV-2 (MAD6 isolate) than MVA-S or MVA-A-S at 14 days postimmunization and at 5 days postchallenge, although at day 14 postchallenge the neutralization titers were enhanced and similar in all groups (Figure 21 B), reflecting the existence of a breakthrough infection mainly in the MVA-S- and MVA-A-S-vaccinated groups and suggesting that MVA-S(3P) vaccination controlled better the infection.
  • Challenged mice previously inoculated with two doses of MVA-WT were used as a control group.
  • mice were monitored for changes in body weight and mortality for 10 days after the challenge. All K18-hACE2 mice immunized with two doses of MVA-S(3P) and challenged with SARS-CoV-2 B.1.351 VOC did not lose body weight (Figure 22B) and survived ( Figure 22C), whereas mice inoculated with MVA-WT and challenged with SARS-CoV-2 lost body weight (Figure 22B) and all died at 4 days postchallenge (Figure 22C).
  • mice per group were sacrificed at day 4 after SARS-CoV-2 virus challenge, lungs and BAL samples collected and processed, and the presence of SARS-CoV-2 subgenomic E and genomic RdRp RNA ( Figure 22D and 22E), as well as of live infectious virus ( Figure 22 E and 22G) was analyzed.
  • MVA-S(3P) prevented SARS-CoV-2 B.1.351 VOC replication, reducing significantly subgenomic and genomic SARS-CoV-2 RNA levels in lungs ( Figure 22D) and BAL ( Figure 22E), in comparison to MVA-WT control infected mice.
  • the cells were labelled with specific antibodies to identify (CD4 + and CD8 + ) T cell populations and respondent cells (expressing CD107a on the surface of the T cells as an indirect cytotoxicity marker and/or producing cytokines IFN-y, TNF- a, and IL-2) by ICS.
  • the polyfunctionality of the CD8 + T cell-mediated immune response showed that both immunization groups were characterized by a similar high polyfunctional profile, analyzed by measuring the simultaneous production pattern of cytokines (IFN-y, TNF-a, and/or IL-2) plus the cytotoxic potential thereof (CD107a as a degranulation marker).
  • the CD8 + T cell-mediated response was mainly characterized by cells which are capable of carrying out 3 functions (CD107a, IFN-g and TNF-a) ( Figure 25D).
  • SARS-CoV-2 S(3P) protein is express at higher levels than a S(2P) protein
  • mammalian expression vectors that contained recombinant DNAs coding for the soluble S protein with a T4 fibritin trimerization sequence, a Flag peptide and a His-tag at the C-terminus were used for S expression by transfection of HEK293T cells.
  • S constructs without the furin motif and with the K986P and V987P substitutions in the S2, and without (S2P) or with the mutation A942P (S3P) were transfected into cells for a comparative of protein expression.
  • the cell supernatants were collected for analysis of protein expression by sandwich ELISA using an anti-Flag antibody and a biotin-labelled antibody that recognize the RBD.
  • the results showed that the S(3P) protein was expressed about 4-fold times than the S(2P) protein (Fig. 26), indicating that the presence of a third mutation in the S protein (A942P) increases the expression levels of the full length protein in transfected cells.
  • the full-length SARS-CoV-2 S sequence inserted in vaccine candidate MVA-S(3P) described in the present examples was synthetized by GeneArt, was human codon optimized, and contains three mutations in the furin cleavage site (R682G, R683S, R685S) that avoid the cleavage of the S protein in S1 and S2, and three additional mutations in the S2 region that stabilizes the S protein in a prefusion conformation (A942P, K986P, and V987P).
  • the sequence was derived from Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1 (GenBank: MN908947.3, https://www.ncbi.nlm.nih.gov/nuccore/MN908947). The sequence is reproduced herein below as SEQ ID NO 1.
  • SEQ ID NO 1 The S nucleotide sequence reads as follows (SEQ ID NO 1):
  • S protein sequence reads as follows (SEQ ID NO 2): MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLI VNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFL MDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITR FQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDP LSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWN RKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVR
  • SEQ ID NO 3 The RBD nucleotide sequence described in the specification as SEQ ID NO 3 reads as follows (SEQ ID NO 3):
  • SEQ ID NO 4 The RBD protein sequence described in the specification as SEQ ID NO 4 reads as follows (SEQ ID NO 4):
  • SEQ ID NO 5 The E nucleotide sequence described in the specification as SEQ ID NO 5 reads as follows (SEQ ID NO 5):
  • SEQ ID NO 7 The N nucleotide sequence described in the specification as SEQ ID NO 7 reads as follows (SEQ ID NO 7):
  • SEQ ID NO 8 The N protein sequence described in the specification as SEQ ID NO 8 reads as follows (SEQ ID NO 8):
  • SEQ ID NO 9 The M nucleotide sequence described in the specification as SEQ ID NO 9 reads as follows (SEQ ID NO 9):
  • SEQ ID NO 10 The M protein sequence described in the specification as SEQ ID NO 10 reads as follows (SEQ ID NO 10): MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVT LACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLN VPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGA
  • SEQ ID NO 24 The nucleotide sequence of the E3L gene of MVA (MVA050L) described in the specification as SEQ ID NO 24 reads as follows (SEQ ID NO 24):
  • SEQ ID NO 25 The MVA E3 protein sequence described in the specification as SEQ ID NO 25 reads as follows (SEQ ID NO 25):

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Mycology (AREA)
  • Molecular Biology (AREA)
  • Communicable Diseases (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pulmonology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present invention is directed to a vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid encoding the spike (S) protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof. The present invention also relates to combination of vaccines and uses thereof.

Description

MVA-BASED VACCINE EXPRESSING A PREFUSION-STABILIZED SARS-CoV-2 S PROTEIN
TECHNICAL FIELD OF THE INVENTION The present invention is directed to a recombinant modified vaccinia virus Ankara (MVA) vector comprising a nucleic acid sequence coding for a prefusion-stabilized full- length spike (S) protein of at least one SARS-CoV-2 variant that is useful for vaccinating against SARS-CoV-2. The present invention is further directed to a vaccine composition containing said recombinant MVA as well as to a method for generating a protective immune response in a mammal against at least one SARS-CoV-2 variant.
BACKGROUND OF THE INVENTION
The emergence of the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and its high impact on global health have made imperative the development of safe and effective vaccines for this virus, the causal agent of the pandemic coronavirus disease 2019 (COVID-19). SARS-CoV-2 now adds to the list of coronavirus diseases that have threatened global health, along with the severe acute respiratory syndrome (SARS) and Middle East respiratory syndrome (MERS) coronaviruses that emerged in 2002/2003 and 2012, respectively.
Coronavirus virions are decorated with a spike (S) glycoprotein that binds to host cell receptors and mediates cell entry via fusion of the host and viral membranes. This protein is also the main target of neutralizing antibodies. However, the SARS-CoV-2 S ectodomain is unstable and difficult to produce reliably in mammalian cells, hampering the development of S-based vaccines. Prefusion stabilization techniques are aimed at increasing the recombinant expression of viral fusion glycoproteins, possibly by preventing triggering or misfolding that results from a tendency to adopt the more stable postfusion structure. Furthermore, prefusion-stabilized viral glycoproteins are also superior immunogens to their wild-type counterparts, since they represent the primary target of neutralizing antibodies.
Here, we provide an effective MVA-based, as well as vaccine regimens, capable of producing a prefusion-stabilized S protein from at least one SARS-CoV-2 variant virus that at the same time controls infection and disease progression caused by SARS-CoV- 2/COVID-19. BRIEF DESCRIPTION OF THE FIGURES DESCRIPTION OF THE INVENTION
Figure 1. Design, generation, and in vitro characterization of MVA-S(3P) vaccine candidate in permissive DF-1 cells. (A) Genome map of the vaccine candidate MVA- S(3P) [also termed MVA-CoV2-S(3P)]) expressing a prefusion-stabilized coronavirus SARS-CoV-2 S protein. The different regions of the MVA genome are indicated with capital letters and the central conserved region and the left and right terminal regions are shown. Below the map, the deleted or fragmented MVA genes are depicted as black boxes. The coronavirus SARS-CoV-2 S(3P) gene inserted within the MVA TK viral locus (J2R) of MVA-WT parental virus and driven by the sE/L virus promoter are indicated. TK-L: TK left; TK-R: TK right. An scheme of the prefusion-stabilized full-length S protein inserted in the MVA genome is included. S1 and S2 regions are indicated, together with the amino acid mutations in the furin cleavage site and changes to prolines in the S2 region. NTD: N-terminal domain; RBD: receptor binding domain; TM: transmembrane; CT: cytoplasmic tail. (B) PCR analysis of MVA TK locus. Viral DNA was extracted from DF-1 cells that were not infected (mock) or infected with 5 PFU/cell of vaccine candidates MVA-S and MVA-S(3P), or MVA-WT. Oligonucleotides which hybridize in the flanking regions of the TK locus were used for the PCR analysis of the coronavirus SARS-CoV-2 S gene inserted in the TK locus. A molecular weight marker (1 kb) with the corresponding bp sizes is indicated on the left side of the images, and the amplified DNA products are indicated with arrows on the right side. (C) Expression of the coronavirus SARS-CoV-2 S-protein. DF-1 cells were infected for 24 hours (in the absence or presence of tunicamycin) at 5 PFU/cell with vaccine candidates MVA-S and MVA-S(3P) and MVA-WT. At 24 hours post-infection cells were lysed in Laemmli 1X + b-mercaptoethanol buffer, fractionated by 7% SDS-PAGE, and the presence of the S protein was analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). A rabbit anti-VACV E3 protein antibody was used as a loading control for the amount of viral proteins. The arrows on the right side of the images indicate the S protein (glycosylated or unglycosylated), together with the VACV E3 protein, whereas the sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left side. (D) Expression of SARS-CoV-2 S protein under nonreducing conditions. DF-1 cells were infected with MVA-S and MVA-S(3P) vaccine candidates and at 24 hpi, cells were lysed under nonreducing conditions (Laemmli 1X - b-mercaptoethanol buffer), fractionated by 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). Arrows on the right indicates the SARS-CoV-2 S protein in the form of monomers or oligomers. The sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left. (E) Kinetics of expression of the coronavirus SARS-CoV-2 S protein in cell extracts (pellet) and supernatants (SN) from cells infected with vaccine candidates MVA-S and MVA-S(3P). DF-1 cells were infected with vaccine candidates MVA-S and MVA-S(3P), and MVA-WT, at 5 PFU/cell. The cell extracts and the supernatants were collected 4, 7 and 24 hours post-infection (the supernatants were first precipitated with 10% TCA), lysed in Laemmli 1X + b-mercaptoethanol buffer, fractioned with 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). The arrows on the right side indicate the S protein. The sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left.
Figure 2. In vitro characterization of vaccine candidate MVA-S(3P) in nonpermissive human HeLa cells. (A) Expression of the coronavirus SARS-CoV-2 S- protein. HeLa cells were infected for 24 hours (in the absence or presence of tunicamycin) at 5 PFU/cell with vaccine candidates MVA-S and MVA-S(3P) and MVA- WT. At 24 hours post-infection cells were lysed in Laemmli 1X + b-mercaptoethanol buffer, fractionated by 7% SDS-PAGE, and the presence of the S protein was analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). The arrows on the right side of the images indicate the S protein (glycosylated or unglycosylated), whereas the sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left side. (B) Kinetics of expression of the coronavirus SARS-CoV-2 S protein in cell extracts (pellet) and supernatants (SN) from HeLa cells infected with vaccine candidates MVA-S and MVA-S(3P). DF-1 cells were infected with vaccine candidates MVA-S and MVA-S(3P), and MVA-WT, at 5 PFU/cell. The cell extracts and the supernatants were collected 4, 7 and 24 hours post-infection (the supernatants were first precipitated with 10% TCA), lysed in Laemmli 1X + b-mercaptoethanol buffer, fractioned with 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). The arrows on the right side indicate the S protein. The sizes of standards (in kilodaltons [kDa]) (Precision Pius protein standards; Bio-Rad Laboratories) are indicated on the left. (C) Expression of SARS-CoV-2 S protein under nonreducing conditions. HeLa cells were infected with MVA-S and MVA-S(3P) vaccine candidates and at 4, 7 and 24 hpi, cells were lysed under nonreducing conditions (Laemmli 1X - b-mercaptoethanol buffer), fractionated by 7% SDS-PAGE, and analyzed by Western blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). Arrows on the right indicates the SARS-CoV-2 S protein in the form of monomers or oligomers. The sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left. Figure 3. MVA-S(3P) is stable, express S in the membrane of infected cells and replicates in permissive DF-1 cells. (A) Genetic stability of vaccine candidate MVA- S(3P). DF-1 cell monolayers were infected with the P2 stock of MVA-S(3P) at a low MOI for 8 serial passages. Then, chick DF-1 cells were the left uninfected (mock) or infected with vaccine candidate MVA-S(3P) from the different passages, or with MVA-WT, and the cells were lysed at 24 hours post-infection in Laemmli 1X + b-mercaptoethanol buffer, fractionated by 7% SDS-PAGE, and analyzed by Western Blotting using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region). A rabbit anti-VACV E3 protein antibody was used as a loading control for the amount of viral proteins. The arrows on the right side indicate the position of the S protein or the VACV E3 protein. The sizes of standards (in kilodaltons [kDa]) (Precision Plus protein standards; Bio-Rad Laboratories) are indicated on the left. (B) Flow cytometry analysis of S expression levels in cells infected with MVA-S(3P). HeLa cells were mock infected or infected at 5 PFU/cell with MVA-S, MVA-S(3P) and MVA-WT, and at 24 hpi, cells were collected and analyzed by flow cytometry using mouse polyclonal antibodies against S and RBD proteins, followed by an anti-mouse PE-conjugated antibody. The cell surface expression of S is represented in the histogram plots. (C) Viral growth kinetics of vaccine candidate MVA-S(3P). DF-1 cell monolayers were infected with MVA-WT, MVA-S, and MVA-S(3P) at 0.01 PFU/cell. Cells were collected at different times post-infection (0, 24, 48, and 72 hours) and the viral titers in the cell lysates were quantified by a plaque immunostaining assay with anti-VACV antibodies. The means and standard deviations of the results obtained from two independent experiments are shown. Figure 4. Expression of the S protein in the cell membrane of HeLa cells infected with MVA-CoV2-S(3P), and analyzed by immunofluorescence. Subcellular distribution of the SARS-CoV-2 S protein in cells infected with MVA-S and MVA-S(3P). Confocal immunofluorescence microscopy of infected and permeabilized (A) or nonpermeabilized (B) HeLa cells. Cells were infected with 0.5 PFU/cell with the indicated viruses, fixed at 24 hpi, permeabilized or nonpermeabilized, and stained with Alexa Fluor 594-conjugated WGA probe (red) and with a rabbit polyclonal anti-S antibody further detected with a rabbit Alexa Fluor 488-conjugated antibody (green). Cell nuclei were stained using DAPI (blue). Figure 5. Immunization schedule and titers of IgG anti-S and anti-RBD antibodies induced in mice after one or two doses of MVA-S and MVA-S(3P) vaccine candidates. (A) Immunization schedule. Six C57BL/6 mice per group were inoculated at days 0 and 15 (prime/boost) with the different indicated vaccine candidates (MVA-S or MVA-S(3P)). Immunization groups are indicated (n=6 mice per group), together with the time points at which animals were immunized (dose and route of administration are shown) and sacrificed to analyze the adaptive SARS-CoV-2-specific T cell and humoral immune responses. At day 10 post-prime mice were bleed to obtain serum samples. The mice were sacrificed 10 days after the boost (day 25) and the following was obtained: i) spleens of the mice for studying adaptive T cell-mediated immune responses against SARS-CoV-2 by means of ELISpot and ICS, and ii) serum samples originating from blood for studying adaptive humoral immune responses against SARS- CoV-2, by means of ELISA and a neutralization assay. PFU: Plaque forming units; i.m.: intramuscular. (B and C) Titers of binding IgG antibodies specific for the S and RBD proteins at 10 days post-prime (B) or 10 days post-boost (C). Titers were determined by ELISA in individual mice serum samples collected 10 days post-prime or 10 days postboost immunization, and were calculated as the serum dilution (Y axis) at which the absorbance at 450 nm was three times higher than the naive serum value in each of the indicated immunization regimens, shown in the X axis. Dotted line represented the detection limit. Figure 6. SARS-CoV-2 S-specific and RBD-specific lgG1, lgG2b, lgG2c, and lgG3 antibodies induced by vaccine candidate MVA-S(3P) in C57BL/6 mice immunized.
Groups of C57BL/6 mice (n=6) were immunized as represented in Figure 5A. At 10 days post-prime (A) and 10 days post-boost (B), serum samples were collected, and the levels of total coronavirus SARS-CoV-2 S-specific and RBD-specific lgG1, lgG2b, IgG2c, and igG3 in pooled sera from mice derived from each immunization group were analyzed by ELISA. Mean absorbance values (measured at 450 nm) and standard deviations of duplicate pooled serum dilutions are represented.
Figure 7. Neutralizing antibody titers against SARS-CoV-2 induced by vaccine candidate MVA-S(3P) in C57BL/6 immunized mice. Groups of C57BL/6 mice (n=6) were immunized as represented in Figure 5A. At 10 days post-prime (left panels) and 10 days post-boost (right panels), individual serum samples were collected, and the ID50 neutralizing antibody titers were evaluated using retrovirus-based pseudoparticles expressing the SARS-CoV-2 S protein (A) or live-virus microneutralization (B) assays. The ID50 titers in the retrovirus-based pseudoparticle assay were determined as the highest serum dilution which resulted in a 50% reduction of luciferase units compared with pseudotyped viruses not incubated with serum. The ID50 titers in the live-virus microneutralization assay were calculated as the reciprocal dilution resulting in 50% inhibition of cell death. Mean ID50 values and SEM for each immunization group is represented. Dotted line represented the detection limit. The NIBSC 20/136 international standard containing pooled plasma obtained from eleven individuals recovered from SARS-CoV-2 infection is included.
Figure 8. ELISpot analysis of the adaptive SARS-CoV-2 S-specific cell-mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. Six mice per group were sacrificed at 10 days post-boost, and the splenic SARS-CoV-2- specific cells secreting IFN-y were evaluated by an ELISpot assay, as described in Materials and Methods. Samples from each group of mice were analysed in triplicate, and the bars indicate the mean values and the standard deviation. The responses obtained have been obtained by subtracting the RPMI values for each condition and are represented as IFN-g positive ceils per million of splenocytes. The magnitude of SARS- CoV-2-specific cells secreting IFN-g and directed against SARS-CoV-2 S1 and S2 peptide pools is represented.
Figure 9. SARS-CoV-2 S-specific adaptive CD4+ (left) and CD8+ (right) T cell- mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. CD4+ and CD8+ T cell-mediated responses in the splenocytes of mice
(n=6) immunized with homologous (MVA/MVA) prime-boost protocol were analysed by ICS, as described in Materials and Methods 10 days after the boost. The data is depicted with its corresponding confidence intervals. (A) The total magnitude of SARS- CoV-2 S (S1 + S2)-specific adaptive CD4+ T cell-mediated (left) and CD8+ T cell- mediated (right) immune responses. The y-axis shows the percentage measured as the sum of SARS-CoV-2 S (mixture of S1 + S2 peptide pools)-specific T cells expressing CD107a and/or producing IFN-g and/or TNF-a and/or IL-2. (B) Breadth of SARS-CoV-2- specific CD4+ and CD8+ T cell adaptive immune responses. S1 or S2 peptide pool- specific adaptive CD4+ T cell-mediated (left) and CD8+ T cell-mediated (right) immune responses. The y-axis shows the percentage measured as the sum of SARS-CoV-2 S1 or S2 peptide pool-specific T cells expressing CD107a and/or producing IFN-y and/or TNF-a and/or IL-2. (C) Adaptive CD4+ T cell-mediated (left) and CD8+ T cell-mediated (right) immune responses shown as the percentage of SARS-CoV-2 S (S1 + S2)- specific cells expressing CD107a or producing IFN-g or TNF-a or IL-2.
Figure 10. Polyfunctionality of SARS-CoV-2 S-specific adaptive CD4+ and CD8+ T cell-mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. Six mice per group were sacrificed at 10 days post-boost, and the splenic SARS-CoV-2-specific CD4+ and CD8+ T cell immune responses were analysed by ICS, as described in Materials and Methods. Polyfunctional profiles of total SARS- CoV-2-specific CD4+ (A) and CD8+ (B) T cell adaptive immune responses directed against a mixture of S1, and S2 SARS-CoV-2 S peptide pools. All of the possible combinations of responses are shown on the x axis, while the percentages of T cells expressing CD107a and/or IFN-g and/or TNF-a and/or IL-2 against S1 plus S2 peptide pools are shown on the y axis. The pie charts summarize the data.
Figure 11. Phenotype profile of SARS-CoV-2 S-specific adaptive CD4+ and CD8+ T cells induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. Splenocytes of mice (n=6) immunized with a homologous (MVA/MVA) prime-boost protocol were obtained 10 days after the boost, and SARS-CoV-2 S (S1 +S2 peptide poois)-specific CD4+ T cell-mediated (A) and CD8+ T cell-mediated (B) immune responses were analysed by ICS. The y-axis indicates the percentage of SARS-CoV-2 S (S1 +S2)- specific CD4+ and CD8+ central memory T cells (TCM; CD127+, CD62L+), effector memory T cells (TEM; CD127+, CD62L-), and effector T cells (TE; CD127-, CD62L-) expressing CD107a and/or IFN-g and/or TNF-a and/or IL-2 (total response). The data is depicted with its corresponding confidence intervals. Figure 12. SARS-CoV-2 S-specific adaptive CD4+ T follicular helper (Tfh) cell- mediated immune responses induced by vaccine candidate MVA-S(3P) in C57BL/6 mice. Spienocytes of mice (n=6) immunized with a homologous (MVA/MVA) prime-boost protocol were obtained 10 days after the boost, and SARS-CoV-2 S (S protein plus S1 +S2 peptide pools)-specific CD4+ Tfh cell-mediated immune responses were analysed by ICS. The data is depicted with its corresponding confidence intervals. (A) Magnitude of total SARS-CoV-2-specific adaptive CD4+ Tfh cell immune responses directed against SARS-CoV-2 S protein plus S1 and S2 peptide pools. Percentages of CD4+ Tfh cells (CXCR5+, PD1+) expressing CD40L and/or producing IFN-g and/or IL- 21 against a mixture of SARS-CoV-2 S protein plus S1 , and S2 SARS-CoV-2 S peptide pools are represented. (B) Percentages of total SARS-CoV-2-specific CD4+ Tfh cells expressing CD40L or producing IFN-y or IL-21 against a mixture of SARS-CoV-2 S protein plus S1, and S2 SARS-CoV-2 S peptide pools. (C) Polyfunctionality of total SARS-CoV-2-specific adaptive CD4+ Tfh cells directed against a mixture of SARS-CoV- 2 S protein plus S1 and S2 peptide pools. All of the possible combinations of responses are shown on the x axis, while the percentages of T cells expressing CD40L and/or IFN- Y and/or IL-21 against SARS-CoV-2 S protein plus S1 and S2 peptide pools are shown on the y axis.
Figure 13. One dose of MVA-S(3P) protects transgenic K18-hACE2 mice from SARS-CoV-2 infection. (A) Efficacy schedule. Male and female K18-hACE2 transgenic mice (n=11 per group) were immunized by the intramuscular (i.m.) route with one dose of 1 x 107 PFU of MVA-S(3P) or MVA-S as indicated. At week 4 (day 28) mice were challenged intranasally (i.n.) with 1 x 105 PFU of SARS-CoV-2 (MAD6 isolate). MVA- WT-inoculated mice were also i.n. challenged with SARS-CoV-2 and used as a control. At day 4 postchallenge 6 mice per group were sacrificed and lungs and serum samples collected as indicated. Serum was also collected at 14 days after immunization and in mice alive at 15 days postchallenge (groups 1 and 2).(B, C) The challenged mice were monitored for change of body weights (B) and mortality (C) for 15 days. †: mice were euthanized due to loss of more than 25% of initial body weight. (D) Virus replication in lung samples. Subgenomic (E) and genomic (RdRp) SARS-CoV-2 RNA detected by RT-qPCR at 4 days after virus infection (n = 6). Mean RNA levels (in arbitrary units [A.U.]) and SEM from duplicates of each lung sample; relative values are referred to uninfected mice. (E) SARS-CoV-2 infectious virus in lung samples. Mean (PFU/g of lung tissue) and SEM from triplicates of each lung sample. Student’s t-test: **P < 0.005. Fig. 14. One dose of MVA-S(3P) reduced SARS-CoV-2 lung pathology and diminished levels of pro-inflammatory cytokines in K18-hACE2 transgenic mice.
(A) Lung inflammation scores (left) and percentage of lung area with lesions (right). Examined in lung samples (n = 6) at 4 days postchallenge. Mean and SEM of cumulative histopathological lesion scores (left) and percentage of lung area affected by inflammatory lesions (right). (B) Representative lung histopathological sections (H&E staining) from K18-hACE2 transgenic mice euthanized at day 4 postchallenge. A general view of the lung area (magnification: 4x) along with histopathological details from selected lung areas (black boxes) have been displayed (magnification: 10x). Mice vaccinated with one dose of MVA-S and MVA-WT (a,e) displayed more extensive and severe lung inflammatory lesions compared to mice immunized with one dose of MVA- S(3P) (c). In mice immunized with MVA-S and MVA-WT (b,f) lung inflammatory lesions were characterized by the presence of moderate diffuse thickening of the alveolar septae, perivascular oedema (white arrowheads), moderate presence of mononuclear cell infiltrates within alveolar spaces (black arrows), hyaline membranes and cell debris within alveoli (black arrowheads) as well as the presence of large multifocal perivascular and peribronchiolar mononuclear infiltrates (red arrows). However, in mice vaccinated with one dose of MVA-S(3P) (d) lesions were less extensive and less severe, highlighting the presence of focal thickening of the alveolar septae (red arrowhead), occasional presence of inflammatory cells within the alveoli and small focal perivascular and peribronchial mononuclear infiltrates (red arrows). (C) Identification of proinflammatory cytokines. mRNA levels detected by RT-qPCR in lungs (n = 6) obtained at 4 days postchallenge. Mean RNA levels (in A.U.) and SEM from duplicates of each lung sample; relative values are referred to uninfected mice. Student’s t-test: *P < 0.05. Fig. 15. MVA-S(3P) vaccine candidate induced high levels of humoral responses in vaccinated and challenged K18-hACE2 transgenic mice. (A) Titers of IgG antibodies specific for the S (left) and RBD (right) proteins (Wuhan strain). Determined by ELISA in individual mouse serum samples collected at day 14 postimmunization (pi) (prechallenge; n=11/group) and at days 4 (n=6/group) and 15 (n=5/group) postchallenge (pc) from K18-hACE2 mice. Mean values and SEM are represented. Dashed line represents the limit of detection. (B) SARS-CoV-2 neutralizing antibody titers. NT50 titers were evaluated in individual mouse serum samples collected at day 14 pi and at days 4 and 15 pc, using a live virus microneutralization assay (MAD6 strain, having D614G mutation). Mean NT50 values and SEM are represented. Upper dotted line represents the levels obtained with the NIBSC 20/136 international standard plasma (containing pooled plasma obtained from 11 individuals recovered from SARS- CoV-2 infection). Bottom dotted line represented the limit of detection. (C) SARS-CoV-2 neutralizing antibody titers against SARS-CoV-2 VoC. NT50 titers were evaluated in pooled mouse serum samples collected at days 14 pi (left) and 15 pc (right), using VSV- based pseudoparticles expressing the SARS-CoV-2 S protein of different VoC. Mean NT50 values and 95% confidence intervals are represented. Dashed line represents the limit of detection. Student’s t-test: **, P < 0.005; ***P < 0.001.
FIGURE 16. SARS-CoV-2 S-specific T-cell immune responses elicited in C57BL/6 mice immunized with one intranasal dose of MVA-S(3P). CD4+ and CD8+ T cell- mediated immune responses in cells derived from spleen, lungs and bronchial lymph nodes (BLN) of mice (n=6) immunized with one intranasal dose of MVA-based vaccine candidates were analysed by ICS, as described in Materials and Methods 14 days after the immunization. The data is depicted with its corresponding confidence intervals. (A) Magnitude of S-specific CD4+ (left) and CD8+ (right) T-cell immune responses evaluated at 14 days post-immunization in spleen, lungs and bronchial lymph nodes (BLN). Percentages of CD4+ or CD8+ T cells expressing CD107a and/or producing IFN-y and/or TNF-a and/or IL-2 against a mixture of S1 and S2 peptide pools in immunized mice. Cell percentages were determined by ICS from pools of cells obtained from the different tissues. (B) Polyfunctional profiles (based on expression of selected markers CD107a, IFN-g, TNF-a and IL-2) of total S-specific CD8+ T-cell immune responses directed against a mixture of S1 and S2 peptide pools in spleen, lung and BLN. (C) Magnitude of SARS-CoV-2-specific CD4+ Tfh cell immune responses directed against SARS-CoV-2 S protein plus S1 and S2 peptide pools. Percentages of CD4+ Tfh cells (CXCR5+, PD1+) expressing CD40L and/or producing IFN-g and/or IL-21 against a mixture of SARS-CoV-2 S protein plus S1 and S2 SARS-CoV-2 S peptide pools are represented. Cell percentages were determined by ICS from pools of splenocytes. (D) Polyfunctionality of SARS-CoV-2-specific CD4+ Tfh cells directed against a mixture of SARS-CoV-2 S protein plus S1 and S2 peptide pools. All of the possible combinations of responses are shown on the x axis, while the percentages of CD4+ Tfh cells expressing CD40L and/or IFN-g and/or IL-21 against SARS-CoV-2 S protein plus S1 and S2 peptide pools are shown on the y axis. FIGURE 17. SARS-CoV-2 S-specific humoral immune responses elicited in C57BL/6 mice immunized with one intranasal dose of MVA-S(3P). (A) Titers of IgG antibodies specific for the S protein (Wuhan strain). Determined by ELISA in individual mouse serum samples collected at 14 days post-immunization. Mean values and SEM are represented. Dashed line represents the limit of detection. (B) Titers of IgA antibodies specific for the S protein (Wuhan strain). Determined by ELISA in pooled mouse BAL samples collected at 14 days post-immunization. Mean values and SEM are represented. Student’s t-test: **, p < 0.005.
FIGURE 18. One intranasal dose of MVA-S(3P) protects transgenic K18-hACE2 mice from SARS-CoV-2 infection. (A) Efficacy schedule. Female K18-hACE2 transgenic mice (n=9 per group) were immunized by the intranasal (i.n.) route with one dose of 1 x 107 PFUs of MVA-S, MVA-Δ-S or MVA-S(3P) as indicated. At week 5 (day 35) mice were challenged i.n. with 1 x 105 PFUs of SARS-CoV-2 (MAD6 isolate). MVA- WT-inoculated mice were also challenged with SARS-CoV-2 and used as a control. At day 5 postchallenge 4 mice per group were sacrificed and lungs, nasal washes and serum samples collected as indicated. Serum was also collected at 14 days after immunization and at 14 days postchallenge (in groups 1 , 2 and 3). (B, C) The challenged mice were monitored for change of body weights (B) and mortality (C) for 14 days. †: mice were euthanized due to loss of more than 20% of initial body weight. (D, E) Virus replication in lung samples (D) and nasal washes (E). Subgenomic E and genomic RdRp SARS-CoV-2 RNA detected by RT-qPCR at 5 days after virus infection (n = 4/group). Mean RNA levels (in arbitrary units [A.U.]) and SEM from duplicates of each lung and nasal washes samples; relative values are referred to uninfected mice. (F, G) SARS-CoV-2 infectious virus in lung samples (F) and nasal washes (G). Mean (PFUs/g of lung tissue or PFUs per ml of nasal wash) and SEM from triplicates of each sample. Student’s t-test: *, p < 0.05; **, p < 0.005; ***, p < 0.001.
FIGURE 19. One intranasal dose of MVA-S(3P) reduced SARS-CoV-2 lung pathology in K18-hACE2 transgenic mice. (A) Lung inflammation scores (left) and percentage of lung area with lesions (right) examined in lung samples taken from mice (n=4/group) vaccinated and infected as indicated in Figure 18A, and euthanized at 5 days postchallenge. Mean and SEM of cumulative histopathological lesion scores (left) and percentage of lung area affected by inflammatory lesions (right). Unpaired t-test: **p < 0.005. (B) Representative lung histopathological sections (H&E staining) from K18-hACE2 mice euthanized at day 5 postchallenge (magnification: 10x). Mice immunized with one dose of MVA-S (a) and MVA-A-S (b) displayed moderate inflammatory lung lesions that were, in general, more severe and extensive in mice immunized with MVA-WT (control infected group; d). Among these lesions highlighted the presence of diffuse thickening of the alveolar septae, perivascular edema (red arrowheads), mononuclear cell infiltrates within alveolar spaces (black arrowheads), large multifocal perivascular and peribronchiolar mononuclear infiltrates (black arrows) and occasional haemorrhages (white arrowheads). However, mice immunized with MVA-S(3P) (c) only displayed small lung areas with mild inflammatory lesions such as focal thickening of alveolar septae, occasional presence of mononuclear cell infiltrates within alveolar spaces (black arrowheads) and mild perivascular or peribronchiolar mononuclear infiltrates (black arrows).
FIGURE 20. One intranasal dose of MVA-S(3P) diminished levels of pro- inflammatory cytokines in lung samples and nasal washes from K18-hACE2 transgenic mice. mRNA levels detected by RT-qPCR in lungs (A) and nasal washes (B) (n = 4/group) obtained at 5 days postchallenge. Mean RNA levels (in A.U.) and SEM from duplicates of each sample; relative values are referred to uninfected mice. Student’s t-test: *, p < 0.05; **, p < 0.005; ***, p < 0.001.
FIGURE 21. One intranasal dose of MVA-S(3P) induced high levels of humoral responses in vaccinated and challenged K18-hACE2 transgenic mice. (A) Titers of IgG antibodies specific for the S protein (Wuhan strain). Determined by ELISA in individual mouse serum samples collected at day 14 postimmunization (pi) (prechallenge; n=9/group) and at days 5 (n=4/group) and 14 (n=5/group) postchallenge (pc) from K18-hACE2 mice. Mean values and SEM are represented. Dashed line represents the limit of detection. (B) SARS-CoV-2 neutralizing antibody titers. NTso titers were evaluated in individual mouse serum samples collected at day 14 pi and at days 5 and 14 pc, using a live virus microneutralization assay (MAD6 strain, having D614G mutation). Mean NTso values and SEM are represented. Dotted line represented the limit of detection. (C) SARS-CoV-2 neutralizing antibody titers against SARS-CoV-2 VoC. NTso titers were evaluated in pooled mouse serum samples collected at days 14 pi (left) and 14 pc (right), using VSV-based pseudoparticles expressing the SARS-CoV-2 S protein of different VoC. Mean NT50 values and 95% confidence intervals are represented. Dashed line represents the limit of detection. Student’s t-test: *, p < 0.05;
***, p < 0.001. FIGURE 22. MVA-S(3P) protects transgenic K18-hACE2 mice from infection with SARS-CoV-2 B.1.351 variant. (A) Efficacy schedule. Female K18-hACE2 transgenic mice (n=11 per group; 22 weeks old) were immunized by the intramuscular route with two doses of 1 x 107 PFUs of MVA-S(3P) as indicated. At week 8 (day 56) mice were challenged i.n. with 1 x 105 PFUs of SARS-CoV-2 (B.1.351 variant of concern). MVA-
WT-inoculated mice were also challenged with SARS-CoV-2 and used as a control. At day 4 postchallenge 3-6 mice per group were sacrificed and lungs, BAL and serum samples collected as indicated. Serum was also collected at 14 days after prime immunization, 21 days after boost, and at days 4 and 10 days postchallenge. (B, C) The challenged mice were monitored for change of body weights (B) and mortality (C) for 10 days. †: mice were euthanized due to loss of more than 20% of initial body weight. (D, E) Virus replication in lung samples (D) and BAL (E). Subgenomic E and genomic RdRp SARS-CoV-2 RNA detected by RT-qPCR at 4 days after virus infection (n = 3-6/group). Mean RNA levels (in arbitrary units [A.U.]) and SEM from duplicates of each lung and BAL samples; relative values are referred to uninfected mice. (F, G) SARS-CoV-2 infectious virus in lung samples (F) and BAL (G). Mean (PFUs/g of lung tissue or PFUs per ml of BAL) and SEM from triplicates of each sample. Student’s t-test: **, p < 0.005;
***, p < 0.001.
FIGURE 23. MVA-S(3P) diminished levels of pro-inflammatory cytokines in lung samples from K18-hACE2 transgenic mice challenged with SARS-CoV-2 B.1.351 variant. mRNA levels detected by RT-qPCR in lungs (n = 3-6/group) obtained at 4 days postchallenge. Mean RNA levels (in A.U.) and SEM from duplicates of each sample; relative values are referred to uninfected mice. Student’s t-test: *, p < 0.05.
FIGURE 24. MVA-S(3P) induced high levels of humoral responses in vaccinated K18-hACE2 transgenic mice challenged with SARS-CoV-2 B.1.351 variant. (A)
Titers of IgG antibodies specific for the S protein (Wuhan strain). Determined by ELISA in individual mouse serum samples collected at day 14 postprime (pp), 21 postboost (pb) (prechallenge; n=11/group) and at days 4 (n=3/group) and 10 (n=3/group) postchallenge (pc) from K18-hACE2 mice. Mean values and SEM are represented. Dashed line represents the limit of detection. (B) Titers of IgG antibodies against RBD from different SARS-CoV-2 VoC. Determined by ELISA in pooled sera samples collected at days 14 postprime (left) and 21 postboost (right). FIGURE 25. Monkeypox-specific CD8+ T cell-mediated immune responses induced by MVA-S(3P) vaccine candidate in C57BL/6 mice. Monkeypox-specific CD8+ T cell-mediated responses in splenocytes of mice (n=6) immunized with homologous (MVA/MVA) prime-boost protocol (see Figure 5A) were analysed by ICS, as described in Materials and Methods 10 days after the boost. Measure against vaccinia virus E3 peptide VGPSNSPTF. The data is depicted with its corresponding confidence intervals. (A) Total magnitude of monkeypox-specific adaptive CD8+ T cell- mediated immune responses. The y-axis shows the percentage of monkeypox-specific T cells expressing CD107a and/or producing IFN-y and/or TNF-a and/or IL-2. (B) Adaptive CD8+ T cell-mediated immune responses shown as the percentage of Monkeypox-specific cells expressing CD107a or producing IFN-g or TNF-a or IL-2. (C) Phenotype profile of monkeypox-specific adaptive CD8+ T ceils. The y-axis indicates the percentage of monkeypox-specific CD8+ central memory T cells (TCM; CD127+, CD62L+), effector memory T cells (TEM; CD127+, CD62L-), and effector T cells (TE; CD127-, CD62L-) expressing CD107a and/or IFN-g and/or TNF-a and/or IL-2 (total response). The data is depicted with its corresponding confidence intervals. (D) Polyfunctional profiles of total monkeypox-specific CD8+ T cell adaptive immune responses. All of the possible combinations of responses are shown on the x axis, while the percentages of T cells expressing CD107a and/or IFN-g and/or TNF-a and/or IL-2 against vaccinia virus E3 peptide VGPSNSPTF are shown on the y axis. The pie charts summarize the data.
Figure 26. SARS-CoV-2 S(3P) protein is expressed at higher levels than a S(2P) protein. Concentration of S(3P) and S(2P) proteins obtained from transfected HEK-293 cells. Measured by ELISA. Optical density at 490 nm in the ELISA assays were corrected by the background signals determined in wells with untransfected cell supernatants. Average of two independent transfections are shown.
General definitions
It must be noted that, as used herein, the singular forms "a", "an", and "the", include plural references unless the context clearly indicates otherwise. Thus, for example, reference to "an antigenic determinant" includes one or more antigenic determinants and reference to "the method" includes reference to equivalent steps and methods known to those of ordinary skill in the art that could be modified or substituted for the methods described herein.
Unless otherwise indicated, the term "at least" preceding a series of elements is to be understood to refer to every element in the series. Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.
Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used herein the term "comprising" can be substituted with the term "containing" or "including" or sometimes when used herein with the term "having". Any of the aforementioned terms (comprising, containing, including, having), whenever used herein in the context of an aspect or embodiment of the present invention may be substituted with the term "consisting of, though less preferred.
When used herein "consisting of excludes any element, step, or ingredient not specified in the claim element. When used herein, "consisting essentially of does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
As used herein, the conjunctive term "and/or" between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by "and/or", a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term "and/or" as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term "and/or." Unless otherwise noted, the expression “at least” or “at least one of as used herein includes individually each of the recited objects after the expression and the various combinations of two or more of the recited objects unless otherwise understood from the context and use. The term "subject" as used herein is a living multi-cellular vertebrate organism, including, for example, humans, non-human mammals and (non-human) primates. The term "subject" may be used interchangeably with the term "animal" herein.
As used herein, the term "enhanced" when used with respect to an immune response against SARS-CoV-2, such as an antibody response (e.g., neutralizing antigen specific antibody response), a cytokine response or a CD8 or CD4 T cell response (e.g., immunodominant T cell response), refers to an increase in the immune response in an animal administered with recombinant MVA according to the present invention relative to the corresponding immune response observed from the animal administered with a vector that does not express any SARS-CoV-2 proteins, e.g., a MVA-WT vector.
“Modified vaccinia virus Ankara (MVA) vector” as used herein is an attenuated replication-deficient vaccinia virus that has been genetically modified to include in its genome foreign DNA (that is, DNA that does not naturally belong to poxviruses). In particular, the MVA vector of the present invention has been genetically modified to express SARS-CoV-2 protein(s). Thus, the MVA vector of the present invention refers to viral particles of MVA that comprise inside the viral particle the MVA genome, wherein at least one nucleic acid encoding an antigenic protein of at least one SARS-CoV-2 virus subtype has been introduced in the MVA genome.
As used herein, term “antigenic protein” or "antigenic determinant" refers to any molecule that stimulates a host's immune system to make an antigen-specific immune response, whether a cellular response or a humoral antibody response. Antigenic determinants may include proteins, polypeptides, antigenic protein fragments, antigens, and epitopes which still elicit an immune response in a host and form part of an antigen, homologues or variants of proteins, polypeptides, and antigenic protein fragments, antigens and epitopes including, for example, glycosylated proteins, polypeptides, antigenic protein fragments, antigens and epitopes, and nucleotide sequences encoding such molecules. Thus, proteins, polypeptides, antigenic protein fragments, antigens and epitopes are not limited to particular native nucleotide or amino acid sequences but encompass sequences identical to the native sequence as well as modifications to the native sequence, such as deletions, additions, insertions and substitutions.
The term "epitope" refers to a site on an antigen to which B- and/or T-cells respond, either alone or in conjunction with another protein such as, for example, a major histocompatibility complex ("MHC") protein or a T-cell receptor. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by secondary and/or tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, while epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 5, 6, 7, 8, 9, 10 or more amino acids - but generally less than 20 amino acids - in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., "Epitope Mapping Protocols" in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996). Preferably, a homologue or variant has at least about 50%, at least about 60% or 65%, at least about 70% or 75%, at least about 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more typically, at least about 90%, 91 %, 92%, 93%, or 94% and even more typically at least about 95%, 96%, 97%, 98% or 99%, most typically, at least about 99% identity with the referenced protein, polypeptide, antigenic protein fragment, antigen and epitope at the level of nucleotide or amino acid sequence. Preferably, the reference genome in the context of the present invention is GenBank accession number MN908947.3. Preferably, the reference protein or polypeptide in the context of the present invention is obtained from the translation of the reference genome (GenBank accession number MN908947.3). More preferably, for the S protein, the reference protein is the amino acid sequence of PDB ID 6VSB.
Techniques for determining sequence identity between nucleic acids and amino acids are known in the art. Two or more sequences can be compared by determining their "percent identity." The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
"Percent (%) amino acid sequence identity" with respect to proteins, polypeptides, antigenic protein fragments, antigens and epitopes described herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence (i.e., the protein, polypeptide, antigenic protein fragment, antigen or epitope from which it is derived), after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for example, using publically available computer software such as BLAST, ALIGN, or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximum alignment over the full-length of the sequences being compared. The same applies to "percent (%) nucleotide sequence identity", mutatis mutandis.
For example, an appropriate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, (1981), Advances in Applied Mathematics 2:482-489. This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov (1986), Nucl. Acids Res. 14(6):6745-6763. An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wis.) in the "BestFit" utility application. The default parameters for this method are described in the Wisconsin Sequence Analysis Package Program Manual, Version 8 (1995) (available from Genetics Computer Group, Madison, Wis.). A preferred method of establishing percent identity in the context of the present invention is to use the MPSRCH package of programs copyrighted by the University of Edinburgh, developed by John F. Collins and Shane S. Sturrok, and distributed by IntelliGenetics, Inc. (Mountain View, California). From this suite of packages, the Smith-Waterman algorithm can be employed where default parameters are used for the scoring table (for example, gap open penalty of 12, gap extension penalty of one, and a gap of six). From the data generated the "Match" value reflects "sequence identity." Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+ GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found at the following internet address: http://wvw.ncbi.nlm.gov/cqi-bin/BLAST.
The term "subtype" herein includes strains, isolates, clades, lineages, linages, and/or variants of any severe acute respiratory syndrome coronavirus, namely SARS-CoV-2. The terms “subtype” "strain" "clade", “lineage or linage”, "isolate" and/or “variant” are technical terms, well known to the skilled person, referring to the taxonomy of microorganisms, that is, referring to all characterized microorganisms into the hierarchic order of Families, Genera, Species, Strains. While the criteria for the members of a Family is their phylogenetic relationship, a Genera comprises all members which share common characteristics, and a Species is defined as a polythetic class that constitutes a replicating lineage and occupies a particular ecological niche. The term "strain" or "clade" describes a microorganism, for instance, a virus, which shares common characteristics with other microorganisms, like basic morphology or genome structure and organization, but varies in biological properties, like host range, tissue tropism, geographic distribution, attenuation or pathogenicity. The term “variant” describes a microorganism, in the present invention, a virus, which replicates and introduces one or more new mutations into its genome which results in differences from the original virus. In the present invention, the terms “variant” and “subtype” are synonymous and are used interchangeably. The term “lineage” or “linage” describes a cluster of viral sequences derived from a common ancestor, which are associated with an epidemiological event, for instance, an introduction of the virus into a distinct geographic area with evidence of onward spread. Lineages are designed to capture the emerging edge of a pandemic and are at a fine-grain resolution suitable to genomic epidemiological surveillance and outbreak investigation. The SARS-CoV-2 lineage nomenclature is described for example, in Rambaut A. et al. A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology. Nat Microbiol. 2020; 5(11): 1403-1407. Thus, by “at least one variant of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)” is meant at least one variant, strain, isolate, lineage or linage, and/or clade of the SARS-CoV-2 virus. The different variants of SARS-CoV-2 can be found in databases such as Emma B. Hodcroft. 2021. “CoVariants: SARS-CoV-2 Mutations and Variations of Interest” (covariants.org/variants) or O’Toole A. et al., 2020 “A dynamic nomenclature proposal for SARS-CoV-2 lineages to assist genomic epidemiology”, PANGO lineages (cov-lineages.org/).
Preferably, the term “variant”, in line with the previous definition, and also in line with the World Health Organization (WHO) website (https://www.who.int/activities/tracking- SARS-CoV-2-variants), specifically refers to different SARS-CoV-2 viral sequences with one or more mutations derived from the same ancestor or etiological virus, i.e., in this case, the SARS-CoV-2 virus. In this specific context, it is thus preferably understood that the terms “SARS-CoV-2 variant” or “SARS-CoV-2 linage or linage” does not include viral genomes from other viruses, such as SARS or MERS viruses nor viral genomes derived from said other viruses.
More preferably, the term “variant” or “linage” includes all SARS-CoV-2 viral sequences that encode for a S protein with a percentage of amino acid sequence identity of at least 90%, 91%, 92%, 93%, 94%, preferably of at least 95%, 96%, 97%, 98%, or 99% from the reference S protein of the reference strain SARS-CoV-2 Wuhan-Hu-1 (GenBank accession No QHD43416.1 or Uniprot ID: P0DTC2), when both S proteins are locally aligned, for example, by using Basic Local Alignment Search Tool (BLAST).
In the context of multiple immunization regiments, an “homologous prime-boost combination” is referred herein as the administration of at least two doses of a vaccine, wherein the vaccine is the same in every dose. By “heterologous prime-boost combination” is referred herein as the administration of at least two doses of a vaccine, wherein the first dose comprises a vaccine that is different from the vaccine comprised in the second or subsequent doses. By “different” is meant herein that either the immunogen is different (different antigen) or that, even if the antigen is the same, it is carried by a different vector, or both (different vector and different antigen). For example, in the case of different vector, a heterologous prime-boost combination may be a first dose with a DNA-based vaccine, and a second dose with a MVA-based vaccine. By “Immunogen” is referred herein to a protein or a portion thereof that is capable of inducing an immune response in a mammal, such as a mammal infected or at risk of infection with a pathogen.
The term “synthetic early/late promoter” is referred herein as a vaccinia virus promoter comprising both early and late regulatory elements, wherein said elements overlap in a region of 5 base pairs. Said promoter is widely known in the field, see e.g., Chakrabarti, S.; Sisler, J.R.; Moss, B. Compact, synthetic, vaccinia virus early/!ate promoter for protein expression. Biotechniques 1997, 23, 1094-1097. Preferably, the synthetic early/late promoter as referred herein comprises or consists of SEQ ID NO 21 or SEQ ID NO 26.
Several documents are cited throughout the text of this specification. Each of the documents cited herein (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.), whether supra or infra, are hereby incorporated by reference in their entirety. To the extent the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.
Recombinant MVA virus vaccine compositions
Vaccinia virus (VACV) is amongst the most extensively evaluated live vectors and has particular features in support of its use as a recombinant vaccine: It is highly stable, cheap to manufacture, easy to administer, and it can accommodate large amounts of foreign DNA. It has the advantage of inducing both antibody and cytotoxic T cell responses and allows presentation of antigens to the immune system in a more natural way, and it was successfully used as vector vaccine protecting against several infectious diseases in a broad variety of animal models. Additionally, vaccinia vectors are extremely valuable research tools to analyse structure-function relationships of recombinant proteins, determine targets of humoral and cell- mediated immune responses, and investigate the type of immune parameters needed to protect against a specific disease. However, VACV is infectious for humans and its use as expression vector in the laboratory has been affected by safety concerns and regulations. Furthermore, possible future applications of recombinant VACV e.g. to generate recombinant proteins or recombinant viral particles for novel therapeutic or prophylactic approaches in humans, are hindered by the productive replication of the recombinant VACV vector. Most of the recombinant VACVs described in the literature are based on the Western Reserve (WR) strain of VACV. On the other hand, it is known that this strain is highly neurovirulent and is thus poorly suited for use in humans and animals (Morita et al., Vaccine 5, 65-70 [1987]).
Concerns with the safety of standard strains of VACV have been addressed by the development of VACV vectors from highly attenuated virus strains which are characterized by their restricted replicative capacity in vitro and their avirulence in vivo. Strains of viruses specially cultured to avoid undesired side effects have been known for a long time. Thus, it has been possible, by long-term serial passages of the chorioallantoic VACV Ankara (CVA) strain on chicken embryo fibroblasts, to culture MVA (for review see Mayr, A., Hochstein-Mintzel, V. and Stickl, H. (1975) Infection 3, 6- 14; Swiss Patent No. 568 392). The MVA virus was deposited in compliance with the requirements of the Budapest Treaty at CNCM (Institut Pasteur, Collectione Nationale de Cultures de Microorganisms, 25, rue de Docteur Roux, 75724 Paris Cedex 15) on Dec. 15, 1987 under Depositary No. 1-721.
The MVA virus has been analysed to determine alterations in the genome relative to the wild type CVA strain. Six major deletions (deletion I, II, III, IV, V, and VI) have been identified (Meyer, H., Sutter, G. and Mayr A. (1991) J. Gen. Virol. 72, 1031-1038). This MVA has only low virulence, that is to say it is followed by no side effects when used for vaccination. Hence it is particularly suitable for the initial vaccination of immunocompromised subjects. The excellent properties of the MVA strain have been demonstrated in a number of clinical trials (Mayr et al., Zbl. Bakt. Hyg. I, Abt. Org. B 167, 375-390 [1987], Stickl et al., Dtsch. med. Wschr. 99, 2386-2392 [1974]). Thus,
MVA is a valuable tool as safe viral vector for expression of recombinant genes and can be used for such different purposes as the in vitro study of protein functions or the in vivo induction of antigen-specific cellular or humoral immune responses. A major advantage of MVA is to allow for high level gene expression despite being replication defective in human and most mammalian cells. MVA as a vaccine has an excellent safety track-record, can be handled under biosafety level 1 conditions and has proven to be immunogenic and protective when delivering heterologous antigens in animals, and first human candidate vaccines have proceeded into clinical trials.
Although unable to multiply in most mammalian cell lines, MVA retains its genome plasticity that allows the insertion of large amounts of foreign DNA (heterologous genes) (Sutter and Moss, 1992). Absence of pathogenicity for humans, inherent aviru!ence even in immunocompromised hosts, high-level expression of foreign antigens and adjuvant effect for immune responses make recombinant MVA (rMVA), expressing heterologous genes, an ideal vector for both prophylactic and therapeutic vaccination, as demonstrated by the wide use in prime-boost immunization strategies as demonstrated by the wide use in prime-boost immunization strategies
Indeed, recombinant MVA (rMVA)-based vaccines comprising heterologous genes and therefore expressing heterologous proteins are able to elicit both humoral and cell- mediated adaptive immune responses (Ramirez et al., 2000) and have been proved to be protective in animal models of several infectious diseases (Garcia-Arriaza et al., 2014, Journal of Virology (Chikungunya) Perez et al., 2018, Scientific Reports (Zika) Lazaro-Frias et al., 2018 (Ebola) Gomez et al., 2013; Marin et al., 2019, Journal of Virology (Hepatitis C) Garcia.-Arriaza et al., 2021 (SARS-CoV-2)). Standard procedures to generate recombinant VACV (rVACV) have been described in detail (Earl et al., 1998) and rely on in vivo homologous recombination between acceptor VACV DNA and the transfected transfer plasmid, in which the foreign gene is flanked by VACV sequences. Additional approaches for the generation of recombinant MVA are, for example, disclosed in WO 04074493, WO 03023040 and WO 9702355.
Highly immunogenic viral proteins, such as the S protein of SARS-CoV-2 virus, are usually elusive and present several mechanisms to mislead the immune system and avoid the straightforward generation of neutralizing antibodies. Some of the mechanisms used to evade the immune system of the host imply conformational changes that may also be important for viral cycle. Among them, it is particularly relevant the transition between the prefusion state of the S protein, that is naturally present in the viral particles when they are free in the media, to the postfusion state, that occurs after the binding of the S protein to the host cell receptor. The S protein is first produced as a precursor that trimerizes and is thought to be cleaved by a furin-like protease into two fragments: the receptor-binding fragment S1 and the fusion fragment S2. Binding through the receptor-binding domain (RBD) comprised in the S1 to a host cell and further proteolytic cleavage at a second site in S2 are believed to trigger dissociation of S1 and irreversible refolding of S2 into a postfusion conformation, a trimeric hairpin structure formed by heptad repeat 1 (HR1 ) and heptad repeat 2 (HR2). These large structural rearrangements bring together the viral and cellular membranes, ultimately leading to fusion of the two bilayers.
Although this mechanism is necessary for viral attachment to the cell response, antibodies against the postfusion S protein have less neutralizing capability since the S protein can only be found in said state when the virus is bound to the cellular receptor. These antibodies would thus not target efficiently the protein when the viral particles are released from an infected cell. Therefore, vaccines able to elicit neutralizing antibodies that target the prefusion state of the S protein represent an urgent need.
An important question is thus whether rMVA-based vaccines would or not be capable of generating a strong immunogenic and protective immune response against the prefusion-stabilized S protein from SARS-CoV-2 virus in a subject in need thereof. In this regard, the authors of the present invention have redesigned the S protein of SARS-CoV-2 virus by introducing modifications into the wildtype S amino acid sequence and they have found and demonstrated that a vaccine comprising an immunologically effective amount of a MVA vector expressing a prefusion-stabilized SARS-CoV-2 S protein (termed MVA-CoV2-S(3P), which will also be referred to as MVA-S(3P) throughout the text and figures) is capable of generating a strong immunogenic and protective immune response against the SARS-CoV-2 virus in a subject in need thereof, remarkably only after one dose of the vaccine. The prefusion- stabilized S protein disclosed herein comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P.
In particular, the results presented herein show that mice vaccinated with one intramuscular dose of MVA-S(3P) generated higher neutralizing antibodies and higher anti-S and anti-RBD IgG antibodies than the parental MVA-CoV2-S vector (also termed MVA-S) (Fig. 5, 7, and 15), in which the S protein does not comprise the substitutions R682G, R683S, R685S, A942P, K986P and V987P and therefore the vector MVA- CoV2-S does not produce a prefusion-stabilized S protein. Moreover, MVA-S(3P) enhances the titers of neutralizing antibodies against parental Wuhan strain and variants of concern (Fig. 15C). Interestingly, although one single dose of both vaccine candidates (MVA-CoV2-S and MVA-S(3P)) conferred full protection (100% survival) after challenge with SARS-CoV-2 virus, mice vaccinated with MVA-S(3P) did not present a reduction in body weight due to the infection, while mice vaccinated with MVA-CoV2-S suffered loss of body weight, indicating that the virus caused an infection in these animals (see Fig. 13B). Furthermore, vaccination with one dose of MVA-S(3P) was highly effective to prevent SARS-CoV-2 replication and virus yields at 4 days postchallenge in lung samples (Fig. 13D and 13E), to reduce lung pathology (Fig. 14A and 14B), and to decrease levels of proinflammatory cytokines in lungs (Fig. 14C). It is noted that the lack of body weight loss and symptoms in SARS-CoV-2 challenged animals is also relevant from a clinical and sociological point of view since the lack of symptoms indicates that the vaccinated subject is controlling viral replication at early times post infection and would thus be less contagious than subject presenting symptoms due to viral infection. These results lead to the conclusion that MVA-S(3P) expressing a prefusion-stabilized S protein not only elicits higher humoral immune response than its parental vector MVA-CoV2-S in a one dose regimen, but it is also able to fully protect the animals while avoiding signs of disease and body weight loss.
In line with the above, the study underlying the present invention has also found that the use of a homologous prime/boost vaccine combination comprising two doses of the MVA-S(3P) vector also elicited higher IgG antibody titers 10 days post prime than two doses of the MVA-S parental vector (Fig. 5B). These superior levels of IgG antibodies elicited by MVA-S(3P) were mainly due to an increase in igG1, lgG2b, IgG2c and Ig3 subtypes (Fig. 6A). Further, both vectors elicited comparable levels of IgG antibodies at 10 days post boost (Fig. 5C and 6B). Moreover, the vector MVA-S(3P) is able to generate higher neutralizing antibody titers than parental MVA-S after one dose (10 days post prime) (Fig. 7A). All these higher humoral immune responses elicited by MVA-S(3P) are in accordance with the findings described above that the vector MVA- S(3P) protects more efficiently and without the course of symptoms than MVA-S after a single dose of the vaccine prior a SARS-CoV-2 challenge. In line with this, the present invention thus provides a homologous prime/boost vaccine combination comprising:
1. a composition comprising an immuno!ogical!y effective amount of the rMVA vector provided herein; and
2. a composition comprising an immunologically effective amount of the rMVA vector provided herein; wherein one of the compositions is a priming composition and the other composition is a boosting composition. Such response is particularly strong when the composition comprises the MVA-S(3P) provided herein.
Furthermore, in view of the results obtained and presented herein, it is also plausible that a single dose (either as a prime or as a boost) of an immunologically effective amount of MVA-S(3P) combined with an immunologically effective amount of at least another immunogen also elicits protective immune responses against a lethal dose of SARS-CoV-2 virus. Indeed, it is also shown herein that a single intranasal dose of MVA- S(3P) induced in mice local and systemic SARS-CoV-2-S-specific CD4+ and CD8+ T- cell immune responses (see Fig. 16) and high titers of binding IgG antibodies and neutralizing antibodies that were directed not only against Wuhan variant, but also against other variants of concerns (see Fig. 17 and Fig. 21). Intranasal administration of one dose of MVA-S(3P) of the present invention also prevented morbidity (see Fig. 18B) and mortality (see Fig. 18C) in SARS-CoV-2 challenged K18-hACE2 mice, reducing SARS-CoV-2 virus replication in lungs and nasal washes (see Fig. 18D to 18G), thereby reducing lung pathology (see Fig. 19) and the levels of pro-inflammatory cytokines in lungs and nasal washes (see Fig. 20).
Moreover, two intramuscular doses of MVA-S(3P) of the present invention also prevented morbidity (see Fig. 22B) and mortality (see Fig. 22C) of K18-hACE2 mice challenged with SARS-CoV-2 B.1.351 (beta) variant, reducing SARS-CoV-2 virus beta variant replication in lungs and BAL (see Fig. 22D to 22G), thereby reducing the levels of pro-inflammatory cytokines in lungs (see Fig. 23). Remarkably, high titers of binding IgG antibodies that were directed not only against Wuhan variant, but also against other variants of concerns were induced (see Fig. 24).
In line with this, the present invention also provides a heterologous prime/boost vaccine combination comprising:
1. a composition comprising an immunologically effective amount of the rMVA vector provided herein; and
2. a composition comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant; wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order. Such response may be particularly strong when the composition comprising the MVA-S(3P) provided herein is given as a boost.
Thus, generally, the invention provides, for the first time, enhanced and effective vaccines or vaccine combinations for use in generating a protective immune response against infections by at least one SARS-CoV-2 variant or linage and vaccines or vaccine combinations which can be used for manufacturing of a vaccine against at least one SARS-CoV-2 variant or linage.
Thus, a first aspect of the present invention provides a vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid encoding a SARS-CoV-2 spike (S) protein, or an immunogenic fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment comprise amino acid substitutions aimed at enhancing the stability of the prefusion state of the S protein or fragment therefrom, and wherein the MVA vector regulates the expression of the nucleic acid encoding said stabilized prefusion S protein or fragment thereof.
As detailed below, the redesigned S protein encoded by the genome of MVA contains amino acid substitutions that enhance stability of the prefusion S structure. These include mutations that inactivate the S1/S2 cleavage site, and mutations in HR1 that remove any strain in the turn region between HR1 and CH, i.e., to prevent the formation of a straight helix during fusion. In some embodiments, the resigned S protein can additionally contain a truncation of the HR2 motif. Truncation of the HR2 domain leads to disruption of the HR1/HR2 fusion core and also stabilizes the prefusion S structure.
In some embodiments, the S protein or an immunogenic fragment of said S protein comprising at least one epitope comprises at least one, two, preferably three, amino acid substitutions to inactivate the S1/S2 furin cleavage site. Inactivation of this cleavage site can be achieved by a number of sequence alterations (e.g., deletions or substitutions) within or around the site. One mutation that inactivates the cleavage site without otherwise impacting the structure of the protein is substitution of residues 682 RRAR 685. Please note that, here and throughout the whole document, the amino acid numbering used as reference is the one based on cryo-EM model PDB ID 6VSB or GenBank accession number MN908947.3. Thus, in a preferred embodiment, said inactivation of the S1/S2 cleavage site is achieved by introducing at least one, two, or three of the amino acid substitutions selected from the list consisting of R682G, R683S or R685S. More preferably, the S protein or the immunogenic fragment thereof comprises at least the three amino acid substitutions R682G, R683S and R685S.
In addition, the inactivation of the cleavage site, the soluble SARS-CoV-2 immunogen polypeptides can additionally contain a double mutation in the HR1 region that remove strain in the turn region (between HR1 and CH motifs) during fusion by preventing the formation of a straight helix. Thus, in an embodiment, the S protein, or an immunogenic fragment thereof, encoded by the nucleic acid comprised in the MVA vector of the present invention further comprises other amino acid substitutions aimed at maintaining the quaternary structure of the S protein in a prefusion state or form. As referred herein, a “prefusion protein” or a “protein in a prefusion state or form” is meant a S protein or a fragment of said protein that are designed to be stabilized in a prefusion conformation, preventing structural rearrangements that usually take place when the protein interacts with its receptor or other protein. A strategy to stabilize the S protein in a prefusion conformation is eliminating the causes of metastability by amino acid substitutions in various regions of S, particularly HR1 and in HR2. In an embodiment, amino acid substitutions to proline are performed in the S protein to provide a prefusion S protein. In an embodiment, said amino acid substitutions aimed at maintaining the prefusion quaternary structure of the S protein are selected from the group including, but not limited to, T961D, G769E, L938F, F817P, A942P, S884C, A892P, A899P, A893C, T859K, Q957E, Q895P, T912P, K921P, G946P, or S975P, or any combination thereof. In some embodiments, additional mutations of the wildtype soluble S sequence can be introduced to destabilize the postfusion S structure. In some embodiments, one or more proline and/or glycine substitution can be engineered in the region of HR1 that interacts with HR2 to form the fusion core. These substitutions function to disrupt the six-helix- bundle fusion core. In various embodiments, the mutations can include A942P, S943P, A944P, A942G, S943G and A944G. In further embodiments, the substitutions function to disrupt the six-helix-bundle fusion core. In various embodiments, the mutations can include S924P, T925P, A926P, S924G, T925G, and A926G. In some embodiments, one or more extra amino acid residues can be inserted into the region of HR1 that interacts with HR2 to form the fusion core. Similarly, these insertions also function to disrupt helical pattern of the fusion core. In various embodiments, the insertions can include insertion of G or GS between any residues in A942-A944. In some embodiments, the substitutions may be double amino acid substitutions such as K986G/V987G, K986P/V987P, K986G/V987P or K986PA/987G. In a preferred embodiment, the S protein or the immunogenic fragment thereof comprise at least one, two or three of the substitutions A942P, K986P and V987P. Most preferably, the S protein or the immunogenic fragment thereof encoded by the nucleic acid comprised in the MVA vector provided herein comprise at least the three substitutions A942P, K986P and V987P. In an embodiment, the S protein or the immunogenic fragment thereof encoded by the nucleic acid comprised in the MVA vector provided herein comprises the above mentioned substitutions to avoid the furin cleavage in combination with the above mentioned substitutions to maintain the S protein in a prefusion state. Thus, in a most preferred embodiment, the vaccine composition according to the first aspect or any of its embodiments comprises an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
In a preferred embodiment, the S protein encoded by the nucleic acid comprised in the MVA vector comprises, consists or consists essentially of the full-length S protein of at least a SARS-CoV-2 variant or linage. The full-length S protein comprises or consists of amino acids 1 to 1273. In an embodiment, the S protein of at least a SARS-CoV-2 virus encoded by the nucleic acid comprised in the MVA-S(3P) vector according to the first aspect of the present invention comprises, consists, or consists essentially of SEQ ID NO: 1 or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 1.
In the context of the present invention, the nucleic acid of the vaccine composition described herein may also optionally encode antigenic domains or antigenic protein fragments rather than the entire antigenic S protein. These fragments can be of any length sufficient to be antigenic or immunogenic as long as they comprise at least the amino acid substitutions R682G, R683S, R685S, A942P, K986P and V987P. Fragments can be at least 300 amino acids long, but can be longer, such as, e.g., at least 350, 400, 500, 600, 700, 800, 900, 1000, 1200 amino acids long, or any length in between. In some embodiments, at least one nucleic acid fragment encoding an antigenic S protein fragment or immunogenic S polypeptide thereof is inserted into the genome of the recombinant viral vector of the invention. In another embodiment, about 2-6 different nucleic acids encoding different antigenic proteins are inserted into the genome of the recombinant viral vector. In some embodiments, multiple immunogenic fragments or subunits of various proteins can be inserted. For example, several different epitopes from different sites of a single protein or from different proteins of the same SARS-CoV-2 strain, or from a S protein orthologue from different strains can be expressed from the vectors.
In some embodiments, the S protein consists of a truncated protein lacking at least 5, 10, 15, 20, 15, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, or more than 400 amino acid of the full-length S protein. In some embodiments, the S protein consists of a truncated protein where the N-terminal domain has been removed. In some embodiments, the S protein consists of a truncated protein where the C-terminal domain has been removed. In some embodiments, the S protein consists of a truncated protein consisting of only the S1 and S2 subunits. In some embodiments, the S protein consists of a truncated protein where the cytosolic domain has been removed. In some embodiments, the S protein consists of a truncated protein where the transmembrane domain has been removed. In some embodiments, the S protein consists of a soluble S protein wherein the transmembrane and the cytosolic domains has been removed. Thus, a "fragment" of the S protein of at least a SARS-CoV-2 virus according to the present invention is a partial amino acid sequence of the SARS-CoV-2 S protein or a functional equivalent of such a fragment. A fragment is shorter than the full-length complete SARS-CoV-2 S protein and preferably comprises or consists of the amino acids 682-987 of the full-length S protein. A fragment of the SARS-CoV-2 S protein also includes peptides having at least 15, 20 or 25 contiguous amino acid residues having at least about 70%, at least about 80%, at least about 90%, preferably at least about 95%, more preferably at least 98% sequence identity with at least about 15, 20 or 25 contiguous amino acid residues of SEQ ID NO: 2 having about the same length as said peptides.
A fragment that "corresponds substantially to" a fragment of the SARS-CoV-2 S protein is a fragment that has substantially the same amino acid sequence and has substantially the same functionality as the specified fragment of the SARS-CoV-2 S protein. A fragment that has "substantially the same amino acid sequence" as a fragment of the SARS-CoV-2 S protein typically has more than 90% amino acid identity with this fragment. Included in this definition are conservative amino acid substitutions.
In another preferred embodiment of the first aspect of the invention, the antigenic protein is the structural protein S of SARS-CoV-2 resulting in vaccine compositions comprising the MVA-S(3P) vector, preferably the antigenic protein is the protein of SEQ ID NO 2, more preferably the antigenic protein is the protein of SEQ ID NO 2 encoded by the nucleic acid consisting of SEQ ID NO 1, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 1. In an embodiment, the S protein of at least a SARS-CoV-2 virus encoded by the nucleic acid comprised in the MVA-S(3P) vector according to the first aspect of the present invention comprises, consists, or consists essentially of SEQ ID NO: 2 or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 2 (amino acids 1 to 1273 encoded by the reference genome of GenBank accession number MN908947.3, or amino acids of the reference S protein PDB ID 6VSB).
In a preferred embodiment, the nucleic acid encoding the antigenic protein is incorporated or inserted into a non-essential region of the genome of the MVA. In an embodiment of the present invention, the nucleic acid encoding the antigenic protein is incorporated into the MVA by substituting a non-essential region of the genome of the MVA. In a preferred embodiment of the present invention, the nucleic acid encoding the S protein is incorporated or inserted into the MVA thymidine kinase (TK) locus or hemagglutinin (HA) locus. Integration of the nucleic acid encoding the antigenic protein is performed preferentially by homologous recombination of the flanking regions of a so- called transfer vector, which initially comprises the nucleic acid encoding the antigenic protein according to the invention prior to its integration into the parental MVA genome. In a preferred embodiment, the transfer vector is the pCyA vector. The pCyA vector has been previously described in WO 2014/162031 A1. In a preferred embodiment, the vaccine composition comprises an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, wherein the S protein or the fragment thereof are inserted into the TK locus of the MVA genome, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
Upon homologous recombination by means of an infection with parental virus followed by a transfection with the plasmid transfer vector, selection and purification of recombinant viruses encoding the antigenic protein is performed. In an embodiment, the intermediate MVA recombinant viruses also expresses marker genes that facilitate the tracking and selection of the desired final recombinant viruses. For instance, the intermediate recombinant MVA viruses might express b-galactosidase gene, a fluorescent protein such as the green fluorescent protein (GFP), or an antibiotic resistance gene. Methods for generating recombinant MVAs by homologous recombination by means of intermediate MVAs encoding for selectable genes are described in WO 2014/162031 A1 and WO 2016/086980 A1.
On the other hand, early expression of antigens by VACV vectors is crucial for efficient antigen-specific CD8 and/or CD4 T cell responses. The specific properties of the early elements poxviral promoters might thus be crucial for induction of an antigen-specific T cell response.
Therefore, in a further embodiment, the nucleic acid encoding for the S protein, or an immunogenic fragment thereof, comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P and of at least one SARS-CoV-2 variant or linage is operably linked and under the control of a VACV-specific promoter, an orthopox virus- specific promoter, a poxvirus-specific promoter or a synthetic promoter. A number of promoters may be used for the present invention. For the expression of the nucleic acid encoding an antigenic protein according to the invention several promoters, such the 30K and 40K promoters (US 5,747,324, A Strong Synthetic Early-Late Promoter (Sutter, et al., Vaccine (1994), 12, 1032-1040)), the P7.5 promoter (Endo et al., J. Gen. Virol. (1991) 72, 699-703), a promoter derived from the cow pox virus type A (inclusion ATI gene) (Lee et al., J. Gen. Virol. 1998), 79, 613), and the new synthetic late-early optimized (LEO) promoter (Di Pilato et al. J Gen Virol. 2013 Dec;94(Pt 12):2771-2776) or LEO160 promoter (Di Pilato et al. J Gen Virol. 2015 Aug;96(8):2360-2371) can be used. In a preferred embodiment, the promoter is the synthetic early-late (sE/L) promoter.
In another preferred embodiment, the nucleic acid encoding for the prefusion-stabilized S protein, or a fragment thereof, comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P of at least one SARS-CoV-2 variant or linage is operably linked and under the control of a synthetic promoter. Synthetic promoters are DNA sequences that do not exist in nature and which are designed to regulate the activity of genes to which they are operably linked, controlling a gene's ability to produce its encoded protein. In a preferred embodiment, the synthetic promoter drives the expression of the antigenic protein early during infection. For instance, in an embodiment, the expression of the antigenic protein can be detected as early as 3-hour post-infection. In another embodiment, the synthetic promoter may also drive the expression of the antigenic protein late during infection. In a preferred embodiment, the expression of the antigenic protein is operably linked and under the control of a synthetic promoter that drives the expression of the antigenic protein both, early and late, during viral infection.
The synthetic promoter may be comprised by one or more elements driving early expression of said antigen. The synthetic promoter may be comprised by one or more elements driving late expression of said antigen. Different types of synthetic early/!ate promoters are further described in WO 2010/102822 A1. In another embodiment, the synthetic promoter is formed by both early and late elements, referred as sE/L promoter (Chakrabarti, S.; Sisler, J.R.; Moss, B. Compact, synthetic, vaccinia virus early/late promoter for protein expression. Biotechniques 1997, 23, 1094-1097) or the LEO160 promoter (Di Pilato, M.; Sanchez-Sampedro, L; Mejias-Perez, E.; Sorzano, C.O.S.; Esteban, M. Modification of promoter spacer length in vaccinia virus as a strategy to control the antigen expression. J. Gen. Virol. 2015, 96, 2360-2371. Perez et al., 2019, Vaccines 2019, 7, 208). In another embodiment, the early and late elements are overlapping.
In a preferred embodiment, the vaccine composition comprises an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operab!y linked to an early/late promoter from VACV, preferably the synthetic early/late promoter; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof. In another preferred embodiment, the nucleic acid encoding for the prefusion-stabilized S protein, or a fragment thereof, comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P of at least one SARS- CoV-2 variant or linage is operably linked and under the control of the synthetic early/late promoter, wherein the synthetic early/late promoter comprises or consists of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26.
In a preferred embodiment, the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operably linked to an early/!ate promoter from VACV, preferably the synthetic early/late promoter; wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
Further, in order to ensure that the S protein, or fragment thereof, is correctly translated, a Kozak sequence can be added downstream the synthetic early/late promoter. The term "downstream" as used herein refers to a nucleotide sequence that is located 3’ to a reference nucleotide sequence, in this case to the synthetic early/late promoter. Thus, in some embodiments, the nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, and that is operably linked to the synthetic early/late promoter, further comprises a Kozak sequence located downstream the synthetic early/late promoter. In an embodiment, said Kozak sequence comprises or consists of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22. On the other hand, the nucleic acid inserted in MVA genome according to the invention can further encode for one or more antigenic proteins that can be any protein(s) from any SARS-CoV-2 virus variant or linage. In a preferred embodiment, the nucleic acid comprised in the MVA vector further encodes for one or more antigenic proteins selected from the group consisting of structural proteins E (envelope), receptor-binding domain (RBD), N (nucleocapsid) or M (membrane), or any combination thereof, from at least one SARS-CoV-2 variant. In an embodiment, said further antigenic proteins are inserted in a different locus of the MVA genome, preferably in the HA locus. In another embodiment, said further antigenic proteins are placed under the control of a synthetic VACV promoter, preferably the synthetic early/late promoter.
In an embodiment, the MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from a variant of concern (VOC) as defined by the Centers for Disease Control and Prevention (CDC) “SARS-CoV-2 Variant Classifications and Definitions”. The SARS-CoV-2 is observed to mutate, with certain combinations of specific point mutations proving to be more concerning than others. These mutations are the reason of the increased transmissibility, increased virulence, and possible emergence of escape mutations in new variants. The term “variant of concern” (VOC) is a designation used in newly emerged variants of SARS-CoV-2 with mutations that provide an increased transmissibility and/or morbidity and/or mortality and/or decreased susceptibility to antiviral or therapeutic drugs and/or have the ability to evade immunity and/or ability to infect vaccinated individuals, among others.
In a preferred embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage is derived from the Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947). In another embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage is derived from the United Kingdom SARS-CoV-2 variant VOC 202012/01 (Lineage B.1.1.7, also known as VOC alpha). According to WHO, on 14 December 2020, authorities of the United Kingdom reported to WHO a variant referred to by the United Kingdom as SARS-CoV-2 VOC 202012/01 (Variant of Concern, year 2020, month 12, variant 01) also known as Lineage B.1.1.7 or 501Y.V1. This variant is described in the scientific literature, see, e.g., in Wise, J. Covid-19: New coronavirus variant is identified in UK. BMJ 2020, 371 , m4857. This variant contains 23 nucleotide substitutions and is not phylogenetically related to the SARS-CoV-2 virus circulating in the United Kingdom at the time the variant was detected. Among the variant's several mutations there is one in the RBD of the S protein that changes the asparagine at position 501 to tyrosine (N501Y). Another of the mutations in the VOC 202012/01 variant, the deletion at position 69/70 was found to affect the performance of some diagnostic PCR assays with an S gene target. As of 30 December, VOC-202012/01 variant has been reported in 31 other countries/territories/areas in five of the six WHO regions.
In another embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from the South African SARS-CoV-2 variant (Lineage B.1.351, also known as VOC beta). On 18 December 2020, national authorities in South Africa announced the detection of a new variant of SARS-CoV-2 that is rapidly spreading in three provinces of South Africa. South Africa has named this variant as Lineage B.1.351 , also known as 501Y.V2. This variant is described in the scientific literature, see, e.g., Tegally et al. Emergence and rapid spread of a new severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) lineage with multiple S mutations in South Africa. medRxiv 2020. SARS-CoV-2 South African variant is characterised by three mutations K417N, E484K and N501Y in the RBD. While SARS-CoV-2 VOC 202012/01 from the UK also has the N501Y mutation, phylogenetic analysis has shown that the virus from South Africa are different virus variants. In another embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from the Brazilian SARS-CoV-2 variant VOC-202101/02 (Linage B.1.1.28, also known as VOC gamma). Brazilian variant is also known as Lineage P.1, also known as 20J/501Y.V3, Variant of Concern 202101/02 (VOC-202101/02). This variant is described in the scientific literature, see, e.g., Faria, et al. Genomic Characterisation of an Emergent SARS-CoV-2 Lineage in Manaus: Preliminary Findings. This variant of SARS-CoV-2 has 17 unique amino acid changes, ten of which are in its S protein, including these three designated to be of particular concern: N501Y, E484K and K417T. This variant of SARS-CoV-2 was first detected by the National Institute of Infectious Diseases (NIID), Japan, on 6 January 2021 in four people who had arrived in Tokyo having visited Amazonas, Brazil four days earlier. It was subsequently declared to be in circulation in Brazil and spreading around the world.
Furthermore, a California variant has been also known as VOC CAL.20C. Thus, in another embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from the Californian SARS-CoV-2 (Linage B.1.427 or B.1.429, also known as variant of interest epsilon). This variant is characterized by the mutations S131 , W152C in the N-terminal domain (NTD) of the S protein and by the L452R mutation in the RBD of the S protein. This variant was originally detected in
California (Linage B.1.427 or B.1.429).
Many other variants have been described, such as the B.1.207 variant in Nigeria, which has a mutation in the S protein (P681H) that is also found in the VOC 202012/01 variant, the B.1.617 variant in India (Linage B.1.617, Indian variant, also known as VOC delta), which has the mutations P681R, E484Q and L425R in the S protein, or the Danish variant, referred to as the “Cluster 5” variant by Danish authorities, and which has a combination of mutations not previously observed. The rising variants worldwide can be easily found by the skilled person, e.g., in the website databases such as disclosed by Emma B. Hodcroft. 2021. “CoVariants: SARS-CoV-2 Mutations and Variations of Interest.” (covariants.org/variants) or by O’Toole A. et al., 2020 “PANGO lineages” (cov-lineages.org/). It is thus to be understood that the present invention covers MVAs encoding for S proteins or fragments of said proteins that are derived from any strain or clade or variant or lineage or isolate of SARS-CoV-2.
In a preferred embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from a SARS-CoV-2 variant or linage selected from the group including, but not limited to, Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), Linage B.1.1.28 (Brazilian variant), Linage B.1.351 (South African variant), Linage B.1.427 or Linage B.1.429 (California variant), Linage B.1.617 (Indian variant), or Linage B.1.1.7 (United Kingdom variant), or Linage B.1.1.529 (Omicron variant) or any combination thereof. In a preferred embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from a SARS-CoV-2 variant selected from the group consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), Linage B.1.1.28 (Brazilian variant), Linage B.1.351 (South African variant), Linage B.1.427 or Linage B.1.429 (California variant), Linage B.1.617 (Indian variant), or Linage B.1.1.7 (United Kingdom variant), or Linage B.1.1.529 (Omicron variant), or any combination thereof. Preferably, the Indian variant or B.1.617 linage includes the Delta variant or Linage B.1.617.2. Preferably, the Omicron variant or linage B.1.1.529 includes BA.1 , BA.2, BA.3, BA.4, BA.5 and descendent lineages.
In a preferred embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage according to the first aspect or any of its embodiments is derived from a SARS-CoV-2 variant or linage selected from the group including or consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), linage B.1.1.7 (alpha VOC), linage B.1.351 (beta VOC), linage B.1.1.28 or P1 (gamma VOC), linage B.1.617.2 (delta VOC), linage B.1.1.529 (omicron VOC), or other lineages such as linage B.1.427 or Linage B.1.429 (epsilon variant of interest), or any combination thereof.
Preferably, the MVA vector provided in the first aspect of the present invention or in any of its embodiments comprises at least one nucleic acid encoding the S protein of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), or a fragment of said S protein comprising at least one epitope, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operably linked to an early/late promoter from VACV, preferably the synthetic early/late promoter; wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof. The coding sequences introduced in the MVA vector provided herein can be codon optimized for an optimal expression in human. Thus, in some embodiments, the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, preferably Wuhan variant, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment is operably linked to an early/late promoter from VACV, preferably the synthetic early/late promoter; wherein said nucleic acid is inserted into the TK locus of the MVA genome; wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof, and wherein said nucleic acid is codon optimized for humans.
Preferred combinations of embodiments are: In a preferred embodiments, the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises, from 5' to 3', at least the following sequences: i) the synthetic early/late promoter comprising or consisting of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26, ii) a Kozak sequence comprising or consisting of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22, iii) at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, preferably Wuhan variant, wherein said S protein or fragment comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P; wherein the nucleic acid encoding for the S protein or the fragment as defined in iii) is operably linked to the synthetic early/late promoter as defined in i), wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
In another most preferred embodiment, the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises, from 5' to 3', at least the following sequences: i) the synthetic early/late promoter comprising or consisting of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26, ii) a Kozak sequence comprising or consisting of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22, and iii) at least one nucleic acid encoding the S protein of at least one SARS-CoV-2 variant or linage, preferably Wuhan variant, wherein said nucleic acid comprises or consists of SEQ ID NO: 1, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 1, wherein the nucleic acid encoding for the S protein or the fragment as defined in iii) is operably linked to the synthetic early/late promoter as defined in i), wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof.
In another most preferred embodiment, the MVA vector provided in the first aspect or the present invention or in any of its embodiments comprises, preferably from 5' to 3', at least the following sequences: i) the synthetic early/late promoter comprising or consisting of SEQ ID NO: 21 or 26, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 21 or 26, ii) a Kozak sequence comprising or consisting of SEQ ID NO: 22, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 22, and iii) at least one nucleic acid encoding the S protein, wherein the amino acid protein of said S protein comprises or consists of SEQ ID NO: 2, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 2, wherein the nucleic acid encoding for the S protein or the fragment as defined in iii) is operably linked to the synthetic early/late promoter as defined in i), wherein said nucleic acid is inserted into the TK locus of the MVA genome; and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein.
In an embodiment, the nucleic acid comprised in the MVA vector comprises, consists, or consists essentially of SEQ ID NO: 23, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 23. Rational design of S-based vaccines also provides the generation of chimeric S proteins comprising the most dominant antigenic epitopes from more than one SARS-CoV-2 variants or linages. Furthermore, it is also possible to generate a synthetic, i.e., not “naturally occurring”, S protein that comprises a combination of the sequences of two or more SARS-CoV-2 variants or linages. Thus, in a possible embodiment, the S protein, or a fragment of said S protein comprising at least one epitope, comprises or consists of the sequences of two or more SARS-CoV-2 variants or linages. Preferably, the S protein, or a fragment of said S protein comprising at least one epitope, comprises or consists of a consensus sequence derived from two or more different SARS-CoV-2 variants or linages.
It is noted that the recombinant MVA viruses described herein are highly replication restricted and, thus, highly attenuated, and thus they are ideal candidates for the treatment of a wide range of mammals including humans and even immune- compromised humans. Hence, provided herein are pharmaceutical compositions and vaccines, as described above in the first aspect of the invention, suitable for inducing an immune response in a living animal body, including a human against the SARS-CoV-2 virus. The vaccines of the first aspect preferably comprise the MVA vector described herein formulated in solution in a concentration range of from 1 x 107 to 1 x 108 PFUs per dose. This is illustrated in Figures 5-15 which show that immunogenicity was induced in vaccinated mice with an intramuscular dose of 1 x 107 PFUs per dose (see immunization schedule in Figures 5 and 13). Further, as shown in Figure 13, mice were vaccinated with a single dose of 1x107 PFUs of MVA-S(3P), which indicates that this dose is sufficient to induce protective immunity that leads to 100% survival upon a lethal challenge with SARS-CoV-2. As discussed above, it is important to highlight that mice vaccinated with MVA-S(3P) did not show any weight loss nor disease symptoms, indicating that the vaccine is not only able to protect mice from a lethal challenge, but it is able to stop and/or reduce viral infection and the symptoms associated to it at early times upon challenge, as it is described in Figure 13D and 13E. Moreover, one single intramuscular dose of MVA-S(3P) reduced lung pathology and levels of proinflammatory cytokines, as shown in Figure 14. Furthermore, one single intranasal dose of 1 x 107 PFUs of MVA-S(3P) induced in mice local and systemic SARS-CoV-2-S-specific CD4+ and CD8+ T-cell immune responses (see Fig. 16) and high titers of binding IgG antibodies and neutralizing antibodies that were directed not only against Wuhan variant, but also against other variants of concerns (see Fig. 17 and Fig. 21). Intranasal administration of one dose of 1 x 107 PFUs of MVA-S(3P) of the present invention also prevented morbidity (see Fig. 18B) and mortality (see Fig. 18C) in SARS-CoV-2 challenged K18-hACE2 mice, reducing SARS-CoV-2 virus replication in lungs and nasal washes (see Fig. 18D to 18G), thereby reducing lung pathology (see Fig. 19) and the levels of pro-inflammatory cytokines in lungs and nasal washes (see Fig. 20). Moreover, two intramuscular doses of 1 x 107 PFUs of MVA-S(3P) of the present invention also prevented morbidity (see Fig. 22B) and mortality (see Fig. 22C) of K18-hACE2 mice challenged with SARS-CoV-2 B.1.351 (beta) variant, reducing SARS-CoV-2 virus beta variant replication in lungs and BAL (see Fig. 22D to 22G), thereby reducing the levels of pro-inflammatory cytokines in lungs (see Fig. 23). Remarkably, high titers of binding IgG antibodies that were directed not only against Wuhan variant, but also against other variants of concerns were induced (see Fig. 24).
The vaccine compositions provided herein in the first aspect may generally include one or more pharmaceutically acceptable and/or approved carriers, additives, antibiotics, preservatives, adjuvants, diluents and/or stabilizers. Such auxiliary substances can be water, saline, glycerol, ethanol, wetting or emulsifying agents, pH buffering substances, or the like. Suitable carriers are typically large, slowly metabolized molecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates, or the like.
For the preparation of vaccines, the recombinant MVA viruses provided herein can be converted into a physiologically acceptable form. This can be done based on experience in the preparation of poxvirus vaccines used for vaccination against smallpox as described by H. Stickl et a!., Dtsch. med. Wschr. 99:2386-2392 (1974).
For example, purified viruses can be stored at -80°C with a titer of 5 x 108 PFUs/ml formulated in about 10 mM Tris, 140 mM NaCI pH 7.4. For the preparation of vaccine shots, e.g., 102-108 or 102-109 particles of the virus can be lyophilized in 100 ml of phosphate-buffered saline (PBS) in the presence of 2% peptone and 1% human albumin in an ampoule, preferably a glass ampoule. Alternatively, the vaccine shots can be produced by stepwise freeze-drying of the virus in a formulation. This formulation can contain additional additives such as mannitol, dextran, sugar, glycine, lactose or polyvinylpyrrolidone or other aids such as antioxidants or inert gas, stabilizers or recombinant proteins (e.g., human serum albumin) suitable for in vivo administration. The glass ampoule is then sealed and can be stored between 45°C and room temperature for several months. However, as long as no need exists, the ampoule is stored preferably at temperatures below -20°C.
For vaccination or therapy, the lyophilizate can be dissolved in an aqueous solution, preferably physiological saline or Tris buffer, and administered either systemically or locally, i.e., parenteral, subcutaneous, intravenous, intramuscular, intranasal, or any other path of administration known to the skilled practitioner. The mode of administration, the dose and the number of administrations can be optimized by those skilled in the art in a known manner. However, most commonly a patient is vaccinated with a second shot about one month to six weeks after the first vaccination shot, although booster doses can also be administered years after the first dose.
In addition, for working the present invention any aviru!ent MVA vector suitable for human vaccination could be used. "Derivatives" or "variants" of MVA are also suitable for working the present invention. In preferred embodiments, the MVA vector is further modified by deletion of one or more vaccinia immunomodulatory genes; preferably one, two, or three of the genes C6L, K7R, and A46R. Most preferably, all three genes are deleted. Deletion of these genes has been shown to enhance the innate immune response triggered by the viral vector, and also adaptive antigen-specific immune responses. Thus, in an alternative embodiment of the first aspect, the present invention provides a vaccine composition comprising an immunologically effective amount of a MVA vector comprising at least one nucleic acid encoding the S protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant or linage, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof, and wherein the MVA vector is further modified by deletion of one or more vaccinia immunomodulatory genes; preferably one, two, or three of the genes C6L, K7R, and A46R.
In the context of the present invention, "derivatives" or "variants" of MVA refer to viruses exhibiting essentially the same replication characteristics as MVA but exhibiting differences in one or more parts of their genomes. These "derivatives" or "variants" of MVA must fail to reproductively replicate in vivo in humans and mice, even in severely immune suppressed mice. Tests and assays for the properties of MVA variants are described in WO 02/42480 (US 2003/0206926) and WO 03/048184 (US 2006/0159699). The term "fails to reproductively replicate" refers to a virus that has a virus amplification ratio at 4 days after infection of less than 1. Assays described in WO 02/42480 or in U.S. Patent No. 6,761 ,893 are applicable for the determination of the virus amplification ratio.
The amplification or replication of a virus is normally expressed as the ratio of virus produced from an infected cell (output) to the amount originally used to infect the cell in the first place (input) referred to as the "amplification ratio". An amplification ratio of "1" defines an amplification status where the amount of virus produced from the infected cells is the same as the amount initially used to infect the cells, meaning that the infected cells are permissive for virus infection and reproduction. In contrast, an amplification ratio of less than 1 , i.e., a decrease in output compared to the input level, indicates a lack of reproductive replication and therefore attenuation of the virus.
The advantages of MVA-based vaccine include their safety profile as well as availability for large scale vaccine production. In an embodiment, the recombinant MVA vector of any of the embodiments used for generating the recombinant virus of the present invention is characterized for being replication deficient in mammalian cells, particularly human cells. In a preferred embodiment, the recombinant MVA vector of any of the embodiments used for generating the recombinant virus is a MVA virus or a derivative having the capability of reproductive replication in vitro in chicken embryo fibroblasts (CEF) cells and in established chick cells DF-1 , but no capability of reproductive replication in human cervix adenocarcinoma cell line HeLa. Also, preferably, the recombinant MVA vector of any of the embodiments used for generating the recombinant virus is a MVA vector may be further modified by deletion of one or more vaccinia immunomodulatory genes; preferably one, two, or three of the genes C6L, K7R, and A46R. Most preferably, all three genes are deleted.
MVA vectors useful for the present invention can be prepared using methods known in the art, such as those described in WO 02/042480 and WO 02/24224, both of which are incorporated by reference herein. In another aspect, a MVA viral strain suitable for generating the recombinant viruses of the present invention may be strain MVA-572, MVA-575 or any similarly attenuated MVA strain. Also, suitable may be a mutant MVA, such as the deleted chorioallantoic vaccinia virus Ankara (dCVA). A dCVA comprises del I, del II, del III, del IV, del V, and del VI deletion sites of the MVA genome. The sites are particularly useful for the insertion of multiple heterologous sequences. The dCVA can reproductively replicate (with an amplification ratio of greater than 10) in a human cell line (such as human 293, 143B, and MRC-5 cell lines), which then enable the optimization by further mutation useful for a virus-based vaccination strategy (see WO 201 1/092029). Combination vaccines using homoloqous/heteroloqous prime-boost regimens
The Combination Vaccines and methods described herein may be used as part of a homologous prime-boost regimen. In the homologous prime-boost, a first priming vaccination is given followed by one or more subsequent boosting vaccinations. The boosting vaccinations are configured to boost the immune response generated in the first vaccination by administration of the same recombinant MVA that was used in the first vaccination.
In one exemplary embodiment a homologous prime-boost regimen may be employed wherein a MVA viral vector as defined herein in the first aspect of the invention or in any of its embodiments is administered in a first dosage. One or more subsequent administrations of a MVA viral vector as defined herein in the first aspect or any of its embodiments can be given to boost the immune response provided in the first administration. Preferably, the one or more antigenic determinants are the same or similar to those of the first administration. In a preferred embodiment, the MVA vector provided herein is administered as a boost (i.e., as a second, third, fourth, or successive vaccinations).
The MVA recombinant viral vectors according to the present invention may also be used in prime-boost regimens in combination with other immunogens (heterologous prime/boost combination), such as in combination with a DNA or RNA vector or another viral vector, such as an adenoviruses. In this case, one or more subsequent boosting vaccinations may be done with the MVA vector provided herein and not used in the prime vaccination, e.g., if another immunogenic vector is given in a prime, then subsequent boosting vaccinations may be performed with the MVA provided herein, and vice versa.
Thus, a second aspect of the invention refers to a vaccine combination (from hereinafter referred to as homologous vaccine combination) comprising:
1. a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments; and 2. a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments; wherein one of the compositions is a priming composition and the other composition is a boosting composition, preferably wherein the boosting composition comprises or consists of two or more doses of the vector of the boosting composition. Furthermore, in an alternative second aspect of the invention refers to a vaccine combination (from hereinafter referred to as heterologous vaccine combination) comprising:
1 a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments; and
2 a composition comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant or linage, preferably selected from the group consisting of viral vectors, recombinant proteins or polypeptides, nucleic acids, virus-like particles, nanoparticles, or any combination thereof, wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order. Preferably, the composition comprising the MVA vector as defined in the first aspect or any of its embodiments is administered as a boost, after a prime with a composition comprising an immunologically effective amount of an immunogen of at least one SARS-CoV-2 variant or linage. Preferably, the boost composition comprises or consists of two or more doses of the vector or immunogen of the boosting composition. It is noted that the recombinant heterologous or homologous vaccine combinations may be either monovalent, i.e., comprising only one heterologous sequence encoding an antigenic determinant of SARS-CoV-2, or multivalent, i.e., comprising at least two heterologous sequences encoding antigenic determinants of SARS-CoV-2, such as those selected from the list consisting of structural proteins S, RBD, E, N or M of SARS- CoV-2, preferably such antigenic proteins are those selected from any of SEQ ID NO 2,
SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8 and SEQ ID NO 10, respectively encoded by nucleic acid sequences SEQ ID NO 1, SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7 and SEQ ID NO 9.
In one preferred embodiment of the second aspect of the invention, the immunologically effective amount of an immunogen of at least one SARS-CoV-2 variant or linage comprises an antigenic protein or nucleic acid encoding for an antigenic protein, wherein the antigenic protein is selected from any of the group of structural proteins S, RBD, E, N or M of SARS-CoV-2, or any combination or fragments thereof. In an embodiment, the at least one immunogen of at least one SARS-CoV-2 variant or linage is a nucleotide sequence of a DNA or RNA vector that encodes for an antigenic protein of at least one SARS-CoV-2 variant or linage. In an embodiment, said nucleotide sequence encoding for an antigenic protein is preferably the structural protein S of SARS-CoV-2, or a fragment thereof such as the RBD.
As regards the heterologous vaccine compositions it is important to note that upon injection, preferably intramuscularly, of the DNA/RNA vaccine, cells, preferably muscle cells, may be efficiently transfected and produce a relatively large amount of antigen that may be secreted or otherwise released. Once the plasmid or the RNA reaches the cell, the antigen of interest is produced. Next, the transfected cell displays on its surface the foreign antigen in both major histocompatibility complex (MHC) classes I and class II molecules. The antigen-presenting cell primed with the antigen travels to the lymph nodes and presents the antigen peptide and costimulatory molecules, initiating the immune response. DNA/RNA-based vectors suitable for used as vaccines, as disclosed herein for the heterologous regimes or heterologous vaccine combinations, are known in the art. For instance, Hobernik and Bros Int J Mol Sci. 2018 Nov 15;19(11 ):3605 summarize the knowledge on the course of action of DNA vaccines and the methods for DNA vaccine immunogenicity optimization. Lee et al. Acta Biomater. 2018 Oct 15;80:31-47 relates to engineering DNA vaccines against infectious diseases.
The DNA/RNA-based vaccine vector encode for one or more antigens against which the immune response is to be elicited. Further, the DNA/RNA vector can also encode other co-stimulatory molecules, such as interleukins, cytokines, etc.
If the DNA/RNA-based vaccine is to be administrated to a mammal, the promoter operably linked to the antigen of interest would need to be recognized by mammal cellular transcription machinery. Promoters for expressing proteins in mammalian cells are also known in the art. For instance, some viral promoters might be used, such as cytomegalovirus promoter or T7 phage promoter.
Any DNA, linear or plasmid, able to express the antigen in a mammalian cell may be used to construct a DNA/RNA vaccine. Mammalian expression DNA and RNA vectors are widely known in the art.
In a preferred embodiment of the heterologous vaccine combination, the other immunogen that is combined with the MVA vector provided herein is a mammalian expression vector (a DNA plasmid vector) and produces high levels of the antigen. For instance, suitable mammalian expression plasmid vectors that can be used in the present inventions are, but not limited to, pCDNA, pCAGGS, etc. The mammalian expression vector can be grown in bacterial cells for high-yield production.
In a preferred embodiment of the heterologous vaccine combination, the other immunogen that is combined with the MVA vector provided herein is a RNA molecule. In a preferred embodiment of the heterologous vaccine combination, the other immunogen that is combined with the MVA vector provided herein is an adenovirus. In a preferred embodiment of the heterologous vaccine combination, the other immunogen that is combined with the MVA vector provided herein is a recombinant protein or polypeptide.
Methods for generating, producing and isolating DNA/RNA vaccine vectors are known in the art. In a preferred embodiment of the present invention, the DNA/RNA-based vaccine has been produced by endo-free means, for instance, by using EndoFree Plasmid Kits by Qiagen.
Vaccines and kits comprising recombinant MVA viruses
Also provided herein are vaccines and kits comprising any one or more of the recombinant MVAs described herein. The kit can comprise one or multiple containers or vials of the recombinant MVA, together with instructions for the administration of the recombinant MVA to a subject at risk of SARS-CoV-2 infection. In certain embodiments, the subject is a human. In certain embodiments, the instructions indicate that the recombinant MVA is administered to the subject in a single dose, or in multiple (i.e., 2, 3, 4, etc.) doses. In certain embodiments, the instructions indicate that the recombinant
MVA virus is administered in a single dose to naive or non-naive subjects. Thus, in a preferred embodiment, the vaccines and kits comprising recombinant MVA vectors or vaccine combinations as described in the first or second aspects or any of their embodiments comprise a single dose to be administrated to a subject in need thereof. In certain embodiments, the instructions indicate that the recombinant MVA virus is administered in a first (priming) and second (boosting) administration to naive or non- naive subjects. In certain embodiments, the instructions indicate that the recombinant MVA virus is administered as a boost to naive or non-naive subjects. Preferably, a kit comprises at least two vials or container for prime/boost immunization comprising the recombinant MVAs as described herein for a first inoculation ("priming inoculation") in a first vial/container and for an at least second and/or third and/or further inoculation ("boosting inoculation") in a second and/or further vial/container. More preferably, the vaccines and kits described herein comprise a first (priming) and second (boosting) dose of an immunologically effective amount of the recombinant MVAs as described herein, for use in homologous or heterologous prime boost inoculations.
Thus, a third aspect of the invention refers to kits comprising one, two, or more doses of any of the vaccine compositions as defined in the first aspect of the invention or any of its embodiments, or of any of the homologous or heterologous vaccine combinations of the second aspect of the invention or any of its embodiments. Preferably, the kit comprises an immunologically effective amount of a MVA-based vaccine composition, preferably MVA-S(3P) vector according to the first aspect of the invention in a first vial or container for a first administration (priming) and in a second vial or container for a second administration (boosting).
A preferred embodiment of the third aspect of the invention refers to a kit comprising an immunologically effective amount of a MVA vector according to the first aspect or any of its embodiment in a container for a first or a second or subsequent administrations, wherein the kit further comprises at least another container comprising an immunologically effective amount of another immunogen of at least one SARS-CoV-2 variant or linage for a first or a second or subsequent administrations. A preferred embodiment refers to kits comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant or linage in a first vial or container for a first administration (priming), and an immunologically effective amount of a MVA vector according to the first aspect or any of its embodiments, in a second vial or container for a second administration (boosting).
In another preferred embodiment of the third aspect of the invention, any of the kits referred to herein, comprise a third, fourth or further vial or container comprising any of the vaccine compositions indicated throughout the present invention for a third, fourth or further administration. Preferably, the MVA vector provided herein is used in a second, third, fourth, or further administrations.
In a preferred embodiment of the third aspect, the combination of the combination of compositions contained in the containers is capable of producing at least the S protein, or a fragment thereof, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P derived from at least one SARS-CoV-2 variant or linage, in the subject to be treated, and generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant or linage in a subject in need thereof.
Also comprised in this aspect, the vaccines compositions and combinations and kits provided in any of the previous aspects are used in therapy. In an additional aspect, the vaccines compositions and combinations and kits provided in any of the previous aspects are also for use as a medicament or as a vaccine for the treatment and/or prevention of a coronavirus-caused disease, preferably a SARS-CoV-2-caused disease. In an embodiment, the vaccines compositions and kits provided in any of the previous aspects are for use in generating a protective immune response against at least one SARS-CoV-2 subtype or linage, wherein the kits or vaccine composition comprise one dose of an immunologically effective amount of the vaccine compositions provided herein. Preferably, the vaccines compositions and kits provided in any of the previous aspects are for use in generating a protective immune response against at least one SARS-CoV-2 variant or linage, wherein the kits or vaccine composition comprise at least one dose of an immunologically effective amount of the vector MVA-S(3P).
In a preferred embodiment, the vaccine composition according to the first aspect or any of its embodiment or the kits of the third aspect or any of its embodiments is for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant or linage, wherein said composition is used for priming and/or for boosting said immune response, and wherein the MVA is capable of producing said S protein, or fragment thereof, in the subject to be treated. In a preferred embodiment, the vaccine composition, combination, or kits according to their respective first, second, or third aspects, or any of their related embodiments, are for use in generating or inducing an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, preferably wherein said immunogenic and/or protective immune response is generated in the subject after at least a single administration (be it as a prime or as a boost) of the vaccine composition, combinations, or kits described herein.
In an embodiment, the vaccine composition according to the first aspect, the vaccine combinations according to the second aspect or the kits according to the third aspect, or any of their related embodiments, are used to induce an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant or linage with only a single dose of an immunologically effective amount of the MVA-S(3P) of the invention, wherein preferably the single dose contains concentrations of MVA of about 1 x 107 to 2 x 108 PFUs. Preferably, said single dose of the vaccine composition or combination or the kits of the first or second or third aspects, or any of their related embodiments, is administered as a boost, preferably after a vaccination with a different immunogen (such as a RNA vaccine, DNA vaccine, protein-based vaccine, etc.). In a further preferred embodiment the vaccines, vaccine combinations and kits provided in any of the previous aspects are for use in generating a protective immune response against at least one SARS-CoV-2 variant or linage, wherein if the kits or vaccine combinations are used, the first composition is used for priming said immune response and the second composition is used for boosting said immune response or for use in generating a protective immune response against at least one SARS-CoV-2 variant or linage, wherein the second composition is used for priming said immune response and the first composition is used for boosting said immune response. In any of the vaccines, vaccine combinations and kits provided herein the boosting composition can comprise two or more doses of the vector of the boosting composition.
Thus, in a preferred embodiment, the vaccine combination according to the second aspect or any of its embodiments is for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant or linage, and wherein said combination is capable of producing said S protein, or fragment thereof, in the subject to be treated.
In a preferred embodiment, the vaccine composition according to the first aspect or the vaccine combinations according to the second aspect or any of their embodiments are used to induce an enhanced immune response against at least one SARS-CoV-2 variant or linage in a subject in need thereof, preferably in a human subject, wherein the MVA is capable of producing one or more proteins, or fragments thereof, selected from the group consisting of proteins S, E, RBD, N and/or M, or any combination thereof, derived from at least one SARS-CoV-2 variant or linage, in the subject to be treated.
As stated above, the present invention provides heterologous vaccine programs that consists of a combination vaccine and/or vaccination kit which comprises:
1. a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments, and 2. a composition comprising an immunologically effective amount of at least one immunogen of at least one SARS-CoV-2 variant or linage, wherein one of the compositions is a priming composition and the other composition is a boosting composition, in any order, and preferably wherein the boosting composition comprises two or more doses. Preferably, the MVA vector as defined in the first aspect or any of its embodiments is the boosting composition.
The present invention also provides homologous vaccination regimes using two equal non-replicating viral vectors. For homologous vaccine programs, the present invention thus provides a combination vaccine and/or vaccination kit which comprises:
1. a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments, and
2. a composition comprising an immunologically effective amount of a MVA vector as defined in the first aspect or any of its embodiments, wherein one of the compositions is a priming composition and the other composition is a boosting composition, preferably wherein the boosting composition comprises two or more doses.
In this embodiment, the combination vaccines and/or kit comprises at least two vials or containers for prime/boost immunization comprising the recombinant MVA according to the first aspect or any of its embodiments for a first inoculation ("priming inoculation") in a first vial or container and for an at least second and/or third and/or further inoculation ("boosting inoculation") in a second and/or further vial or container.
The heterologous combination vaccine and/or kit can comprise multiple containers or vials of the recombinant MVA/other immunogen, together with instructions for the administration of the recombinant MVA/other immunogen to a subject at risk of SARS- CoV-2 infection. In certain embodiments, the subject is a human. In certain embodiments, the instructions indicate that the recombinant MVA/other immunogen is administered to the subject in a single dose, or in multiple (i.e., 2, 3, 4, etc.) doses. In certain embodiments, the instructions indicate that the recombinant MVA/other immunogen virus is administered in a first (priming) and second (boosting) administration to naive or non-naive subjects. As indicated above, the other immunogen of at least one SARS-CoV-2 variant or linage is selected from the group including, but not limited to, viral vectors, recombinant proteins or polypeptides, nucleic acids, virus like particles, nanoparticles, or any combination thereof. Preferably, said immunogen is selected from the group consisting of viral vectors, recombinant proteins or polypeptides, nucleic acids, virus-like particles, nanoparticles, or any combination thereof The first and/or second composition or MVA and/or other immunogen of any combination vaccine, vaccination kit and/or any homologous or heterologous vaccine program of the invention can comprise any of the MVA vector described herein and any combination thereof.
Methods and uses of recombinant MVA viruses
Also provided herein are methods of use the vaccine compositions, as described in the first aspect of the invention or any of its embodiments, for immunizing a subject animal or for affecting an immune response in a subject against SARS-CoV-2 infection. Also covered are uses of the said recombinant vaccine composition described herein for the preparation of a medicament or pharmaceutical for the immunization of a subject animal, in particular for the preparation of a medicament or vaccine for treating and/or preventing a SARS-CoV-2-caused disease in a subject. Provided are also said vaccine compositions according to any embodiment herein for use in priming or boosting an immune response against a SARS-CoV-2 infection, preferably wherein the recombinant MVA is administered once, twice, three times or four times.
Further covered herein are vaccine combinations of any of the embodiments for use as a medicament or vaccine for inducing an enhanced immune response against a SARS- CoV-2 infection wherein the combination is capable of producing the antigenic determinant, and/or SARS-CoV-2 -like particles in the subject to be treated, preferably, wherein the combination vaccine is producing the encoded antigenic determinant in the subject to be treated.
Accordingly, a fourth aspect of the present invention provides a method of generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant or linage in a subject in need thereof, preferably in a human subject, the method comprising administering to the subject the recombinant MVA vaccine composition as described in the first aspect of the invention or any of its embodiments; or a kit or any of the vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention or any of their embodiments. In an embodiment, said method is for priming the immune response and/or for boosting said immune response.
As shown in Figs. 15B, 15C, 21 B, and 21 C, neutralizing antibody titers against SARS- CoV-2 parental Wuhan strain, D614G mutant, and VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1), and delta (B.1.167.2) were detected in serum from mice immunized with MVA-S(3P), markedly higher than the titers in MVA-S- or MVA-A-S vaccinated mice. Thus, the vaccine composition according to the first aspect or the vaccine combination according to the second aspect or the kits of the third aspect, or any of their related embodiments, are for use in generating an immunogenic and/or protective immune response that confers protection (including cross protection) against infections caused by different SARS-CoV-2 variants or linages, preferably against infections caused at least by SARS-CoV-2 Wuhan strain, D614G mutant, VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1), delta (B.1.167.2) and omicron (B.1.1.529) linages, and/or any combinations thereof.
In an embodiment, the vaccine composition according to the first aspect or the vaccine combination according to the second aspect or the kits of the third aspect or any of their related embodiments, are for use in generating an immunogenic and/or protective immune response against the S protein of at least one, two, three, four, five, six, or more SARS-CoV-2 different variants or linages, preferably selected from Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351, linage P.1, linage B.1.167.2, linage B.1.1.529, and/or any combination thereof. In an embodiment, the vaccine composition according to the first aspect or the vaccine combinations according to the second aspect or the kit of the third aspect or any of their related embodiments, are used to induce an immunogenic and/or protective immune response against the S protein of at least one SARS-CoV-2 variant or linage, wherein preferably said immunogenic and/or protective immune response is directed against at least a SARS-CoV-2 variant or linage selected from the group consisting of Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351 , linage P.1, linage B.1.167.2, linage B.1.1.529, and/or any combination thereof. Most preferably, the protective immune response elicited by the vaccine composition according to the first aspect or the vaccine combination according to the second aspect or the kits of the third aspect or any of their related embodiments, protects a subject in need thereof, preferably after a single dose, preferably administered as a prime or as a boost, against at least one or more infections caused by at least a SARS-CoV-2 virus, preferably selected from the list consisting of SARS- CoV-2 Wuhan strain, D614G mutant, VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1), delta (B.1.167.2), and/or any combination thereof. More preferably, said protective immune response protects a subject in need thereof, preferably after a single dose, preferably administered as a prime or as a boost, against at least one, two, three, four, five, six, or more infections caused by at least one SARS-CoV-2 variant or linage, preferably selected from Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351, linage P.1 , linage B.1.167.2, linage B.1.1.529, and/or any combination thereof. Further, since immunization with the MVA-
S(3P) of the invention elicited SARS-CoV-2 S-specific CD4+ and CD8+ T cell-mediated immune response with memory phenotype (see, e.g, Fig. 11), it is more than plausible that they are protective not only against a first SARS-CoV-2 infection, but also after subsequent SARS-CoV-2 infections. Thus, in an embodiment, the vaccine composition according to the first aspect or the vaccine combinations according to the second aspect or the kit of the third aspect or any of their related embodiments, are used to induce in a subject in need thereof a protective immune response against an infection caused by at least one SARS-CoV-2 variant or linage, preferably selected from the group consisting of Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351, linage P.1 , linage B.1.167.2, linage B.1.1.529, and/or any combination thereof; preferably wherein said protective immune response is capable of protecting said subject against said SARS-CoV-2 infections for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , or 12 months or years.
As used herein, the term “immunogenic and protective immune response, "protective immunity" or "protective immune response" means that the vaccinated subject is able to control an infection with the pathogenic agent against which the vaccination was done. Usually, the subject having developed a "protective immune response" develops only mild to moderate clinical symptoms or no symptoms at all. Usually, a subject having a "protective immune response" or "protective immunity" against a certain agent will not die as a result of the infection with said agent. In certain embodiments, the subject animal is a mammal. The mammal may be an adult cow, a calf, in particular a juvenile calf, a rat, rabbit, pig, mouse, but preferably a human, and the method comprises administering a dose of the recombinant MVA or combinations thereof as described in the fourth aspect of the invention. Preferably, the protective immune response, with a single dose (be it as a boost or as a prime) is capable of, or is characterized by being, sufficient to prevent a vaccinated subject from contracting an infection that leads to the morbility and/or mortality of said subject, when infected by at least one SARS-CoV-2 variant or linage. The term “infection” is herein understood, but not limited to, as the presence of replication of the virus in the body’s cells, preferably lung cells, of the host. More preferably, the term “infection” is understood as the presence of replication of the virus in the body’s cells, preferably lung cells, of the host, wherein said replication leads to the morbidity and/or mortality of said subject.
In certain embodiments of the fourth aspect of the invention, the subject is a human. In certain embodiments, the subject is an adult. In certain embodiments, the adult is immune-compromised. In certain embodiments, the adult is over the age of 10, 15, 20, 25, 30, 25, 40, 45, 50, 55, 60, 65, 70, 75, 80, or 85 years.
The recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention, may be preferably administered to the subject at a dose of 1 x 107, 5 x 107, 1 x 108 or 2 x 108 PFUs/dose.
In certain embodiments, any of the recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention, are administered to the subject at any of the doses provided herein prior to SARS-CoV-2 virus exposure as, e.g., 1 , 2, 3, or 4 weeks or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months before SARS-CoV-2 virus exposure. In certain embodiments, any of the said vaccine compositions or kits provided herein is administered to the subject at any of the doses provided herein after SARS-CoV-2 virus exposure as, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9. 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 hours or 1, 2, 3, 4, 5, 6, or 7 days after SARS-CoV-2 exposure.
In certain embodiments, the recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention, are administered to the subject in a single dose, or in multiple (i.e., 2, 3, 4, etc.) doses. In certain embodiments, the said kits or vaccine compositions provided herein are administered in a first (priming) and second (boosting) administration.
In an embodiment, a single dose of MVA viral vector as defined herein in the first aspect of the present invention may be given to induce protective immune response, either intramuscularly (as shown in Figures 13-15; vaccinated mice Group 2) or intranasally (as shown in Figures 16-21). In a further embodiment, more than one dose of an immunologically effective amount of an MVA viral vector as defined herein in the first aspect of the present invention may be given to induce protective immune response. In particular, a single dose of an immunologically effective amount of MVA-S(3P) is preferred, although two doses might be a choice for longer term immune responses.
Boosting compositions are generally administered once or multiple times weeks or months after administration of the priming composition, for example, about 1 or 2 weeks or 3 weeks, or 4 weeks, or 6 weeks, or 8 weeks, or 16 weeks, or 20 weeks, or 24 weeks, or 28 weeks, or 32 weeks or one to two years. Preferably, the initial boosting inoculation is administered 1-12 weeks or 2-12 weeks after priming, more preferably 1 , 2, 3, 4 or 8 weeks after priming. In a preferred embodiment, the initial boosting inoculation is administered 4 or 8 weeks after priming. In additional preferred embodiments, the initial boosting is conducted at least 2 weeks or at least 4 weeks after priming. In still another preferred embodiment, the initial boosting is conducted 4-12 weeks or 4-8 weeks after priming.
The recombinant MVA provided in the first aspect of the invention, or any of the kits or vaccine combinations, including the homologous or heterologous vaccination regimes, as described in any of the second or third aspects of the invention, or in any of their embodiments, can be administered systemically or locally. In certain embodiments, the said recombinant vaccine compositions are administered parenterally, subcutaneously, intravenously, intramuscularly, or intranasally, in particular intranasally or intramuscularly. Preferably, the recombinant MVA or the containers comprising the recombinant MVA are administered intranasally. In other embodiments, the said recombinant vaccine compositions are administered by any other path of administration known to the skilled practitioner. In a further preferred embodiment, the said recombinant vaccine composition is administered intramuscularly, preferably the recombinant vaccine composition is administered intramuscularly in a volume ranging between about 0.10 and 1.0 ml, preferably containing concentrations of e.g., about 1 x 107 to 2 x 108 PFUs/ml. Preferably, the said recombinant vaccine composition is administered in a volume ranging between 0.25 and 1.0 ml. More preferably, the said recombinant vaccine composition is administered in a volume of about 0.5 ml. Recombinant MVA viruses for use against poxyiruses
As shown in Fig. 25, the MVA vector of the present invention also elicits an immune response against the poxviral E3 protein, which is a host range protein encoded by the E3L gene comprised in VACV genome. The E3 protein is typical from poxviruses, and thus not only the MVA virus encodes for it, but also other poxviruses such as monkeypox or smallpox. This means that an immune response generated against said E3 protein elicited by one or more MVA immunizations would also target E3 protein from monkeypox or smallpox viruses. Therefore, the MVA vectors described herein provide dual immunogenicity: they elicit an immunogenic and/or protective response against at least one SARS-CoV-2 variant or linage, and at the same time they elicit an immune response against a poxvirus, such as the monkeypox or smallpox viruses.
In view of this, in a fifth aspect, the present invention provides an MVA vector expressing the E3 protein of poxviruses for use in generating an immunogenic and/or protective immune response against at least a poxvirus, preferably against smallpox and/or monkeypox virus. In a preferred embodiment, the MVA vector expressing the poxviral E3 protein for use according to the fifth aspect is for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the poxviral E3 protein, or a fragment of said protein, wherein preferably said vector is used for priming and/or for boosting said immune response, and wherein the MVA is capable of producing said poxviral E3 protein, or fragment thereof, in the subject to be treated. In an embodiment, the MVA vector used according to the fifth aspect comprises at least one nucleic acid that encodes for the E3 protein of poxviruses, preferably operably linked and under the promoter of the wildtype promoter of E3L gene. All of the embodiments related to vaccine compositions, combinations, and kits indicated throughout the present specification in connection to the prevention and/or treatment of SARS-CoV-2, are herein incorporated by reference to the context of MVA vectors in accordance with the fifth aspect of the present invention. In an embodiment, the nucleotide sequence of the poxviral E3 protein comprises or consists of SEQ ID NO: 24, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 24. In an embodiment, the amino acid sequence of the poxviral E3 protein comprises or consists of SEQ ID NO: 25, or a sequence with at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity over the full length with SEQ ID NO: 25.
Since the MVA vector defined above (MVA-S3P) in the composition of the first aspect also encodes for the poxviral E3 protein, a further aspect of the present invention refers to the use of said MVA-S(3P) virus in generating an immunogenic and/or protective immune response against at least a poxvirus, preferably against smallpox and/or monkeypox virus. In a preferred embodiment, the MVA vector for use not only expresses the poxviral E3 protein, but also expresses the S protein of at least one SARS-CoV-2 variant or linage, wherein said S protein comprises at least the amino acid substitutions R682G, R683S, R685S, A942P, K986P and V987P as defined using the amino acid numbering of the reference Wuhan S protein PDB ID 6VSB.
In another embodiment, the vaccines compositions and/or combinations and/or kits provided in any of the previous aspects and their related embodiments are for use as a medicament or as a vaccine for the treatment and/or prevention of a poxvirus-caused disease. Preferably, the vaccines compositions, combinations and/or kits provided in any of the previous aspects and their related embodiments are for use in generating a protective immune response against at least a poxvirus, wherein the kits or vaccine composition or combinations comprise at least one dose of an immunologically effective amount of the vector MVA wild type or MVA-S(3P). Preferably, the vaccines compositions and combinations and/or kits provided in any of the previous aspects or in any of their related embodiments are for use as bivalent vaccines to generate an immunogenic and/or protective immune response against both at least a poxvirus and/or at least one SARS-CoV-2 variant or linage, wherein the kits or vaccine composition comprise at least one dose of an immunologically effective amount of the compositions of the first aspect or any of its embodiments. Preferably, said immunogenic and/or protective immune response is at least against the poxviral E3 protein and/or against at least the S protein from at least one SARS-CoV-2 variant or linage. Preferably, the vaccine composition of the first aspect or any of its embodiments is used for priming and/or for boosting an immune response, wherein the MVA vector is capable of producing a S protein comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, or fragment thereof, and the poxviral E3 protein, in the subject to be treated. Preferably, said immunogenic and/or protective immune is achieved after a single administration of the vaccine compositions or combinations.
In a preferred embodiment, the vector of the fifth aspect may be used to induce an enhanced immune response against at least one SARS-CoV-2 variant or linage and/or against at least a poxvirus in a subject in need thereof, preferably in a human subject, wherein the MVA is capable of producing one or more proteins of said viruses, preferably the S protein of at least a SARS-CoV-2 variant or linage comprising at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and the poxviral E3 protein. Also provided herein are methods of use the vaccine compositions as described in the first aspect of the invention or any of its embodiments, or the vaccine combinations as defined in the second aspect or any of its embodiments, or the kits as defined in the third aspect or any of its embodiments, for immunizing a subject or for enhancing or affecting or improving an immune response in said subject against at least one variant of SARS-CoV-2 virus and/or against at least a poxvirus. Provided are also said vaccine compositions and combinations and kits for use in priming or boosting an immune response against a poxviral infection, preferably smallpox and/or monkeypox infection, and/or against a SARS-CoV-2 infection, preferably wherein the recombinant MVA is administered at least once, twice, three times or four times.
Thus, the vaccine of the first aspect comprising a MVA comprising a heterologous nucleotide sequence encoding the S protein of at least a SARS-CoV-2 variant or linage, wherein said S protein comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P defined using the amino acid numbering of the reference Wuhan S protein PDB ID 6VSB, provides a coronavirus and a poxvirus vaccine capable of inducing both cellular and humoral responses sufficient to confer protective immunity to one or subsequent SARS-CoV-2 virus infections, as well as to one or subsequent poxvirus infections.
Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the appended claims.
The following clauses are also included in the present invention: 1. A vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid encoding the Spike (S) protein, or a fragment of said S protein comprising at least one epitope, of at least one SARS-CoV-2 variant, wherein said S protein or fragment thereof, comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P, and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein, or the fragment thereof. 2. The vaccine composition according to clause 1, wherein the nucleic acid encoding for the S protein, or a fragment thereof, of at least one SARS-CoV-2 variant is inserted into the thymidine kinase (TK) locus of the MVA genome.
3. The vaccine composition according to any of clauses 1 and 2, wherein the nucleic acid encoding for the S protein, or a fragment thereof, of at least one SARS-CoV-2 variant is operably linked to an early/late promoter from Vaccinia Virus (VACV), preferably the synthetic early/late promoter.
4. The vaccine composition according to any of clauses 1 to 3, wherein the nucleic acid encoding for the S protein, or a fragment thereof, of at least one SARS-CoV- 2 variant is inserted into the TK locus of the MVA genome and is operably linked to an early/late promoter from VACV, preferably the synthetic early/late promoter.
5. The vaccine composition according to any of clauses 1 to 4, wherein the nucleic acid comprised in the MVA vector further encodes for one or more antigenic proteins selected from the group consisting of structural proteins E (envelope), receptor-binding domain (RBD), N (nucleocapsid) or M (membrane), or any combination thereof, from at least one SARS-CoV-2 variant.
6. The vaccine composition according to clauses 1 to 5, wherein at least one SARS-CoV-2 variant is selected from the group consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate (GenBank accession number: MN908947), Linage B.1.1.28 (Brazilian variant), Linage B.1.351 (South African variant), Linage B.1.427 or Linage B.1.429 (California variant), Linage B.1.617 (Indian variant) or Linage B.1.1.7 (United Kingdom variant), or any combination thereof.
7. The vaccine composition according to any of clauses 1 to 6, wherein the vaccine further comprises one or more pharmaceutically acceptable carriers, additives, antibiotics, preservatives, adjuvants, diluents and/or stabilizers.
8. A vaccine combination comprising: a. a first composition comprising an immunologically effective amount of a MVA vector as defined in any clauses 1 to 7; and b. a second composition comprising an immunologically effective amount of a MVA vector as defined in any of clauses 1 to 7; wherein one of the compositions is a priming composition and the other composition is a boosting composition. A vaccine combination comprising: a. a first composition comprising an immunologically effective amount of a MVA vector as defined in any of clauses 1 to 7; and b. a second composition comprising an immunologically effective amount of at least one immunogen derived from at least one SARS-CoV-2 variant; wherein one of the compositions is a priming composition and the other composition is a boosting composition. The vaccine combination according to clause 9, wherein the at least one immunogen derived from at least one SARS-CoV-2 variant is selected from the group consisting of viral vectors, recombinant proteins or polypeptides, nucleic acids, virus-like particles, nanoparticles, or any combination thereof. The vaccine composition according to any of clauses 1 to 7, for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant, wherein said composition is used for priming and/or for boosting said immune response, and wherein the MVA is capable of producing said S protein, or fragment thereof, in the subject to be treated. The vaccine combination according to any of clauses 8 to 10, for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant, and wherein said combination is capable of producing said S protein, or fragment thereof, in the subject to be treated.
13. The vaccine composition according to any of clauses 1 to 7 or the vaccine combination according to clauses 8 to 10, for use to induce an enhanced immune response against at least one SARS-CoV-2 variant in a subject in need thereof, preferably in a human subject, wherein the MVA is capable of producing one or more proteins, or fragments thereof, selected from the group consisting of proteins S, E, RBD, N and/or M, or any combination thereof, derived from at least one SARS-CoV-2 variant, in the subject to be treated.
14. The vaccine composition for use according to any of clauses 11 to 13 wherein the MVA vector/s of the vaccine composition/s is/are to be administered once, twice, three or more times.
15. The vaccine composition or combination for use according to any of clauses 11 to 14, wherein said composition or combination is administered via the intramuscular or intranasal route.
16. The vaccine composition or combination for use according to any of clauses 11 to 15, wherein said composition or combination are administered as a boosting composition at least 2 weeks after administering a priming composition.
17. The vaccine composition or combination for use according to any of clauses 11 to 15, wherein said composition or combination are administered as a boosting composition 2-12 weeks, preferably 2, 3 or 4 weeks, after administering the priming composition.
18. A kit comprising one, two, or more doses of the vaccine composition as defined in any of clauses 1 to 7, or the vaccine combination as defined in any of clauses 8 to 10.
19. A kit comprising an immunologically effective amount of a MVA vector according to any of clauses 1 to 7 in a first container for a first administration (priming) and in a second container for a second administration (boosting). A kit comprising an immunologically effective amount of a MVA vector according to any of clauses 1 to 7 in a container for a first or a second administration, wherein the kit further comprises at least another container comprising an immunologically effective amount of another immunogen derived from at least one SARS-CoV-2 variant for a first or a second administration. A kit comprising an immunologically effective amount of an immunogen derived from at least one SARS-CoV-2 variant in a first container for a first administration (priming), and an immunologically effective amount of a MVA vector according to any of clauses 1 to 7 in a second container for a second administration (boosting). The kit according to any of clauses 18 to 21, comprising in a third, fourth or further containers a MVA vector according to any of clauses 1 to 8 for a third, fourth or further administration. The kit according to clauses 18 to 22, for use in generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant in a subject in need thereof, preferably in a human subject. The kit according to clause 23, wherein the combination of compositions contained in the containers is capable of producing at least the S protein, or a fragment thereof, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P derived from at least one SARS-CoV-2 variant, in the subject to be treated, and generating an immunogenic and/or protective immune response against at least one SARS-CoV-2 variant in a subject in need thereof. The kit for use according to any of clauses 23 or 24, wherein said compositions comprised in the containers are administered via the intramuscular or intranasal route. The kit for use according to any of clauses 23 to 25, wherein the boosting composition is administered at least 2 weeks after administering the priming composition. 27. The kit for use according to any of clauses 28 to 25, wherein the boosting composition is administered 2-12 weeks, preferably 2, 3 or 4 weeks, after administering the priming composition.
28. A method of generating an immunogenic and/or protective immune response against the SARS-CoV-2 virus in a subject in need thereof, preferably in a human subject, the method comprising administering to the subject the vaccine compositions according to any of clauses 1 to 7 or any of the vaccine combinations according to any of clauses 8 to 10.
29. The method according to clause 28, wherein said method comprises administering the vaccine compositions according to any of clauses 1 to 7 for priming said immune response and/or for boosting said immune response.
30. The method according to clause 28, wherein said compositions or combinations of compositions contained in the containers are administered via the intramuscular or intranasal route.
31. The method according to any of clauses 28 to 30, wherein the boosting composition is administered at least 2 weeks after administering the priming composition.
32. The method according to any of clauses 28 to 31, wherein the boosting composition is administered 2-12 weeks, preferably 2, 3 or 4 weeks, after administering the priming composition.
33. The method according to any of clauses 28 to 32, wherein the boosting composition is administered two or more times to the subject.
34. A method for generating an immune response against at least one SARS-CoV-2 variants in a subject in need thereof, preferably a human subject, comprising administering to the subject any the vaccine composition according to any of clauses 1 to 7 or any of the vaccine combinations according to any of clauses 8 to 10. 35. The method according to clause 34, wherein said method comprises administering the vaccine compositions according to any of clauses 1 to 8 for priming said immune response and/or boosting said immune response. 36. The method according to clause 33 or 34, wherein said compositions or combinations of compositions comprised in the containers are administered via the intramuscular or intranasal route.
37. The method according to any of clauses 34 to 36, wherein the boosting composition is administered at least 2 weeks after administering the priming composition.
38. The method according to any of clauses 34 to 36, wherein the boosting composition is administered 2-12 weeks, preferably 2, 3 or 4 weeks, after administering the priming composition.
39. The method according to any of clauses 34 to 38, wherein the boosting composition is administered two or more times to the subject. 40. A method of inducing an enhanced immune response against at least one SARS-
CoV-2 variant in a subject in need thereof, preferably in a human subject, comprising administering to the subject the vaccine composition according to any of clauses 1 to 7 or any of the vaccine combinations according to any of clauses 8 to 10.
41. The method according to clause 40, wherein said compositions or combinations of compositions comprised in the containers are administered via the intramuscular or intranasal route. Examples
MATERIALS AND METHODS
1. Materials
1.1. Culture media DF-1 (a spontaneously immortalized chicken embryo fibroblast [CEF] cell line, ATCC catalog no. CRL-12203) and HeLa cells (a human epithelial cervix adenocarcinoma; ATCC catalog no. CCL-2) were grown in Dulbecco’s modified Eagle’s medium (DMEM) (Gibco) supplemented with non-essential amino acids (1X, Sigma-Aldrich) and L- glutamine (2 mM, Merck) and with 10 % fetal calf serum (FCS) (Gibco). Opti-MEM medium (Gibco) was used as a transient culture medium during plasmid transfection. DMEM was used as a medium for absorbing the virus and was removed after 1 hour, and DM EM-2 % FCS was used as a medium for incubating infections. The solid infection medium was used to select the recombinant virus plaques and consisted of a 1:1 ratio of DMEM 2X-4 % FCS and 1.9 % previously melted agarose (Conda). Vero-E6 cells (ATCC catalog no. CRL-1586) were maintained in complete medium (DMEM supplemented with 10 mM HEPES [Gibco-Life Technologies], 1 * nonessential amino acids [Gibco-Life Technologies], penicillin [100 U/ml; Sigma-Aldrich], streptomycin [100 mg/ml; Sigma-Aldrich], and 10% heat inactivated fetal bovine serum [FBS, Gibco-Life Technologies]). All the cells were kept in a humidified incubator at 37°C and 5 % CO2. 1.2. Bacteria
The bacterial strains used for plasmid growth and transformations during cloning were chemically competent Escherichia coii DFI5a cells (CNB) and electrocompetent Escherichia coli DH10B cells (New England Biolabs). The bacteria were cultured in Luria-Bertani (LB) medium supplemented with 1 % bacto-tryptone (BD Biosciences), 1 % NaCI (Sigma-Aldrich), and 0.5 % yeast extract (BD Biosciences) at pH 7 in the presence of ampicillin (100 pg/ml, Merck) or kanamycin (100 pg/ml, Merck) (Green MR, Sambrook J. 2012. Molecular Cloning: a laboratory manual, 4 ed. Cold Spring Harbor Laboratory Press, New York, USA)
1.3. Coronavirus SARS-CoV-2 S antigen (SEQ ID NO 1 and SEQ ID NO 2) The SARS-CoV-2 antigen used to generate the recombinant MVA-CoV2-S(3P), also referred as abbreviated MVA-S(3P) vaccine candidate, is a prefusion-stabilized full- length SARS-CoV-2 S gene (Wuhan seafood market pneumonia virus isolate Wuhan- Hu-1. GenBank accession number: MN908947.3). The nucleotide sequence of this S protein was edited with codons optimized for humans by GeneArt (Thermo Fisher Scientific), and contains three mutations in the furin cleavage site (R682G, R683S, R685S) that avoid the cleavage of the S protein in S1 and S2, and three additional mutations in the S2 region that stabilizes the S protein in a prefusion conformation (A942P, K986P, and V987P).
1.4. Virus
1.4.1. MVA-based virus
The parental MVA used for generating MVA-CoV2-S(3P) vaccine candidate was a wild- type MVA (MVA-WT). The S gene was inserted in the viral TK locus (gene J2R) to generate the MVA-CoV2-S(3P) vaccine candidate. The S gene is under the control of the synthetic early/late viral promoter (pE/L, also called sE/L).
1.4.2. SARS-CoV-2 virus
SARS-CoV-2 strain MAD6 (kindly provided by Jose M. Honrubia and Dr. Luis Enjuanes, CNB-CSIC, Madrid, Spain) is a virus isolated from a patient from Hospital 12 de Octubre in Madrid. The virus was isolated, plaque cloned three times and amplified at CNB-CSIC. Full-length virus genome was sequenced, and it was found to be identical to SARS-CoV-2 reference sequence (Wuhan-Hu-1 isolate, GenBank: MN908947), except the silent mutation C3037>T, and two mutations leading to amino acid changes: C14408>T (in nsp12) and A23403>G (D614G in S protein).
SARS-CoV-2 B.1.351 VOC was obtained from the European Virus Archive Global (EVA-GLOBAL) (Human 2019-nCoV-hCoV-19/France/PDL-IPP01065/2021, clade 20H/501Y.V2/Beta, V2 (B.1.351)) and was then amplified at the CNB-CSIC in Vero-E6 cells. 1.5. Plasmid transfer vector used to generate recombinant MVA-CoV2-S(3P)
A plasmid transfer vector pCyA was used for inserting the coronavirus SARS-CoV-2 prefusion-stabilized S(3P) gene into the MVA genome. The cells were first infected with the parental MVA-WT virus and then transfected with this plasmid. The recombinant MVA virus was subsequently selected after several consecutive plaque purification steps. The process whereby a heterologous gene is inserted into the MVA genome is called homologous recombination, a type of genetic recombination in which nucleotides sequences are exchanged between two similar or identical DNA molecules. In this case, recombination occurs between the genetic sequences of the transfer plasmid and the viral genome. In order to insert the heterologous genes into the MVA genome, the transfer plasmid must contain the following elements:
- Flanking regions of the desired insertion area: These are sequences including the left (L) and right (R) regions of the MVA TK gene such that they allow recombination processes whereby the antigens of interest are inserted in the TK locus.
- Antigen of interest: This must be located between the L and R flanking regions of the TK gene, such that as a consequence of recombination, the antigen of interest is inserted in the viral genome. This antigen was inserted into the plasmid multiple cloning site (MCS) under the control of the VACV synthetic early/late (sE/L) promoter cloned into that same site.
- Selectable marker gene in cell culture: This is located in the area adjacent to the genes of the antigens of interest and within the flanking regions, such that it is inserted into the viral genome next to the genes of interest. Another area of recombination (L flanking region) necessary for the later removal of the marker gene by additional recombination processes is found to be repeated between the antigen of interest and the marker. Recombinant MVAs containing only the antigen of interest are therefore generated, which is necessary for use as vaccine candidates in humans. In this invention, the LacZ (b-galactosidase) marker gene was used to select in cell culture the intermediary recombinant viruses forming blue lysis plaques, after insertion in the TK locus.
- Selectable gene in bacterial culture: To clone and grow plasmids, the ampicillin resistance gene (b-Lactamase) is included in such plasmids in order to select the bacteria transformed with that gene.
The plasmid transfer vector used to introduce the coronavirus SARS-CoV-2 S protein gene into the MVA TK locus is briefly described below:
- pCvA-S(3P): Plasmid transfer vector pCyA-S was used to generate MVA-S(3P) recombinant virus and was developed by the CNB. It directs the insertion of the coronavirus SARS-CoV-2 prefusion-stabilized S gene sequence, under the control of the VACV sE/L promoter, in the TK locus of the parental MVA-WT virus. We provided the pCyA vector to GeneArt (Thermo Fisher Scientific) for optimization of codons, synthesis of the prefusion-stabilized S gene of SARS- CoV-2 and insertion into the plasmid vector. More specifically, the S gene was introduced between the VACV TK-L and TK-R flanking regions, under the control of the VACV sE/L promoter, in plasmid pCyA-20 MCS (Gomez et al., 2013, J Virol 87:7282-7300). Furthermore, this plasmid also contains the selectable marker genes for ampicillin and b-galactosidase (LacZ gene). Polymerase chain reaction (PCR) and sequencing techniques confirmed that plasmid pCyA-S(3P)
(11 ,322 bp) had been generated correctly.
1.6. Mice
Female mice of strain C57BL/6JOIaHsd (Envigo Laboratories) 6-8 weeks of age at the start of the experiment were used for the immunogenicity studies. These tests were approved by the Ethics Committee for Animal Testing (CEEA, Comite Etico de Experimentacion Animal) of the CNB (Spanish National Center for Biotechnology), and by the Division of Animal Protection of the Comunidad de Madrid (PROEX 49/20), in accordance with national and international guidelines and Spanish Royal Decree (RD 53/2013), and were carried out in the animal facility of the National Center for Biotechnology (CNB; Madrid, Spain) in a pathogen-free area.
Male and female transgenic humanized K18-hACE2 mice, expressing human ACE2, were obtained from the Jackson Laboratory (034860-B6.Cg-Tg(K18-ACE2)2Prlman/J) and efficacy experiments were performed at the BSL-3 laboratory of CISA-INIA (Madrid, Spain). The experiments performed in K18-hACE2 humanized transgenic mice at the CNB-CSIC and CISA-INIA were approved by the Ethical Committee of Animal Experimentation (CEEA) of the CNB-CSIC and CISA-INIA (Madrid, Spain) and by the Division of Animal Protection of the Comunidad de Madrid (PROEX 169.4/20 and 161.5/20). Animal procedures were conformed to international guidelines (European Union (EU) Directive 2010/63EU and Recommendation 2007/526/EC) and to the Spanish law under the Royal Decree (RD 53/2013).
2. Reagents
2.1. Oligonucleotides
The following table (Table 1) shows the different oligonucleotides used for recombinant virus cloning, sequencing, and generation processes and those used in the PCR for detecting mycoplasma contamination.
Table 1. Oligonucleotides. Targets of the corresponding restriction enzymes are shown in bold. F = Forward (sense), R = Reverse (antisense).
2.2. Peptides and proteins 2.2.1. Peptides Various coronavirus SARS-CoV-2 S peptides were used for the stimulation of splenocytes isolated from mice immunized with vaccine candidates:
SARS-CoV-2 S peptide pools: These peptides are grouped into two mixtures, S1 (158 peptides) and S2 (157 peptides) (JPT). They are overlapping peptides of the coronavirus SARS-CoV-2 S-protein formed by 15 amino acids (15-mers), 11 of which are overlapping. Each peptide pool (S1 or S2) is at a concentration of 500 pg/ml. 2.2.2. Proteins
The coronavirus SARS-CoV-2 S and RBD soluble proteins were used in enzyme-linked immunosorbent assays (ELISA) at a concentration of 2 pg/ml. Those proteins were provided by Dr. Jose Maria Casasnovas (CNB, Madrid). The S sequence (residues 1 to 1 ,208; Wuhan-Hu-1 strain, GenBank accession number MN908947.3) contained a T4 fibritin trimerization sequence, a Flag epitope, and an 8xHistag at the C-terminus. In the S protein, the furin-recognition motif (RRAR) was replaced by the GSAS sequence, and it also contained the A942P, K986P, and V987P substitutions in the S2 portion. The S protein was purified by nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography from transfected cell supernatants and it was transferred to HEPES buffered saline (HBS), pH 7.5, during concentration or by size- exclusion chromatography (SEC).
The RBD proteins with the S residues 332-534 were produced with an N-terminal HA- tag (YPYDVPDYA) and fused to either a T4 fibritin trimerization sequence, a Flag epitope and an 8xHis-tag (RBD-TFH), or to the human IgGi Fc region (RBD-Fc) at its C-terminus. RBD-Fc proteins with RBD substitutions in VoC were also produced: alpha (B.1.1.7; N501Y), beta (B.1.351; K417N-E484K-N501Y), gamma (P.1.; K417T-E484K- N501Y), delta (B.1.617.2; L452R-T478K), kappa (B.1.617.1; L452R-E484Q) and zeta (P.2; E484K). The RBD-TFH and RBD-Fc proteins were purified by affinity chromatography with Ni-NTA and IgSelect (GE Healthcare) columns, respectively.
2.3. Antibodies
The antibodies used in this invention are summarized in the following table (Table 2):
Table 2. Primary and secondary antibodies, a = anti. 3. Methodology
3.1. DNA manipulation techniques
The DNA manipulation techniques used were carried out according to the methodology described in the book Molecular cloning: a laboratory manual (Green MR, Sambrook J.
2012. Molecular Cloning: a laboratory manual, 4 ed. Cold Spring Harbor Laboratory
Press, New York, USA).
3.1.1. DNA purification
The methodology used for DNA purification differed according to the source of the genetic material:
- Purification of plasmid DNA from bacterial cultures: To extract plasmid DNA from a bacterial culture, the bacteria were previously grown in LB and then DNA was then extracted by means of different commercial kits. The purification of plasmid DNA during the molecular cloning process was performed using the Qiagen Plasmid Mini kit (Qiagen), from 2 ml of positive bacterial clone cultures, following the manufacturer’s instructions. Larger amount of purified plasmid DNA were obtained (from 200-ml bacterial cultures) for use in transfections and infections- transfections in cell cultures using the Qiagen Plasmid Maxi kit (Qiagen), following the manufacturer's protocol. The plasmid DNAs used for in vivo experiments were purified by means of the Qiagen Plasmid endo-free Mega kit (Qiagen) from 500-ml bacterial cultures, following the manufacturer’s recommendations.
- Purification of DNA fragments: The purification of DNA from agarose gels or PCR reactions was carried out with the Wizard® Genomic DNA purification Kit (Promega), following the manufacturer’s recommendations. The purification of these DNA fragments was performed during the plasmid cloning processes and for sequencing regions of interest in plasmids and recombinant viruses to verify that they are generated correctly.
- Purification of genomic DNA of cells infected in culture: This technique was used to obtain the total DNA of cells infected with the recombinant viruses and to check for purity and that such viruses were generated correctly. For that purpose, the infected cells were collected when a cytopathic effect was observed and centrifuged at 3000 revolutions per minute (rpm) for 5 min at room temperature. The supernatant was removed, the precipitate was resuspended in 50 mM Tris- HCI pH 8, and proteinase K (200 pg/ml, Roche) in its corresponding buffer was added. After 1 hour of incubation at 55°C, RNAse A (40 pg/ml, PanReac AppliChem) was added, and it was incubated for 30 min at 37°C. Then saturated NaCI was added. It was mixed by inverting the tube and centrifuged at 13000 rpm for 10 min at room temperature. The supernatant was collected, mixed with isopropanol at a ratio of 1 :0.7 to precipitate the DNA, and centrifuged at 13,000 rpm for 10 min at room temperature. The precipitate was washed with 75 % ethanol and centrifuged again at 13,000 rpm for 10 min at room temperature. Lastly the supernatant was carefully removed and the precipitated DNA was left to dry at room temperature, after which it was resuspended in sterile distilled water. In all cases, DNA concentrations were measured in a NanoDrop® ND-1000 full- spectrum spectrophotometer (Thermo Fisher Scientific). Isolated DNA was later used for different experiments, including PCR, sequencing, transfections, infections- transfections, and in vivo assays in mice.
3.1.2. Polymerase chain reaction (PCR) The PCR technique was used to amplify DNA fragments for later cloning or to check for the gene insertion in transfer plasmids or in the recombinant MVA genome. The polymerase used was Phusion® High Fidelity (New England Biolabs) with its corresponding buffers and reagents and following the manufacturer’s recommendations. About 10-100 ng of template DNA together with 0.4 mM of the corresponding oligonucleotides, 1-2.5 units of Phusion® High Fidelity polymerase with the corresponding buffer, and 0.2 mM of each of the four deoxynucleotide triphosphates (dNTPs) (Roche Diagnostics GmbH) were used for each reaction. The temperature used for annealing was selected according to the oligonucleotides used, and the extension time used depended on the length of the fragment to be amplified. The reactions were carried out in a 96-well VeritiTM thermocycler (Applied Biosystems).
3.1.3. DNA detection
To separate the different DNA fragments, the electrophoresis technique in 1 % agarose gel (Conda), with 1 % SYBR Safe (Invitrogen) as an intercalating agent was used. The DNA fragments were then viewed by means of the Gei Doc 2000 UV light transilluminator system (Bio-Rad) and QuantityOne software (Bio-Rad).
3.1.4. Gene cloning into plasmids transfer vectors
Coronavirus SARS-CoV-2 S gene was cloned into transfer plasmid pCyA to generate plasmid transfer vector pCyA-S by GeneArt (Thermo Fisher Scientific).
3.2. Protein manipulation techniques
3.2.1. Protein analysis by means of sodium dodecyl sulfate-polyacrylamide gel (SDS-PAGE) electrophoresis and membrane immunodetection (Western blot)
The protein samples of the cell extracts and supernatants were analyzed by means of one-dimensional sodium dodecyl sulfate-polyacrylamide gel (SDS-PAGE) electrophoresis according to standard protocols previously described (Green MR, Sambrook J. 2012. Molecular Cloning: a laboratory manual, 4 ed. Cold Spring Harbor Laboratory Press, New York, USA). In detail, the infected or transfected cell samples were collected, centrifuged at 2,000 rpm for 5 min at room temperature, and the precipitate was resuspended in Laemmli IC-b-mercaptoethanol loading buffer. The cell supernatants were also centrifuged at 2,000 rpm for 5 min at 4°C to separate them from T cells that might be present. Then the proteins were precipitated from the supernatant with 10 % trichloroacetic acid (TCA) (Sigma-Aldrich), centrifuged at 13,000 rpm for 15 min at room temperature, and the precipitate was resuspended in Laemmli 1C-b- mercaptoethanol. After that, both the cell extract and supernatant samples were denatured at 95°C for 10 min and were loaded in 7 % polyacrylamide gels in the presence of SDS. The proteins were separated by means of one-dimensional electrophoresis at 100 V and at room temperature for about 90 min.
Once electrophoresis ended, the SDS-PAGE gels were transferred to nitrocellulose membranes (GE Healthcare), following the wet system protocol recommended by the manufacturer (Mini Trans-Blot® Cell, Bio-Rad). The gel and previously hydrated nitrocellulose membrane were arranged between two Whattman-3MM® filter papers (GE Healthcare), which were also hydrated. They were then mounted in the transfer system in the presence of the transfer buffer, and the transfer was performed at a current intensity of 100 V for 50 min. Once this ended, checking for the presence of proteins was performed by staining the membrane with the reversible Ponceau S stain (0.2 % Ponceau in 3 % TCA; Sigma-Aldrich). The nitrocellulose membrane was then blocked with a 5 % skim milk powder solution prepared in PBS 1X-0.05 % Tween20 (Sigma-Aldrich) (PBS-T) at room temperature for 1 hour with gentle stirring. Next, the corresponding primary antibodies, prepared at the desired dilution in the blocking buffer, were added and incubated under stirring at 4°C overnight. After four washes with PBS-T, the membrane was incubated with the appropriate secondary antibody (suitably diluted in the same blocking buffer) for 1 hour at room temperature and was then washed again four times with PBS-T. The membranes were developed with the ECL® luminol system (Amersham), exposing Carestream Kodak BioMax XAR autoradiography film (Kodak) or directly in the ChemiDoc™ Imaging System (Bio-Rad). The proteins bands were analyzed and quantified by means of Image Lab software (Bio-Rad).
3.2.2. Expression of SARS-CoV-2 S protein from recombinant MVA-S and MVA- S(3P) by flow cytometry
Monolayers of HeLa cells were mock infected or infected at 5 PFU/cell with MVA-WT, MVA-S, or MVA-S(3P). At 24 hpi, cells were collected by scraping and centrifuged at 2,000 rpm for 5 min, and the cellular pellets were resuspended in phosphate-buffered saline (PBS) staining solution (1X PBS, 0.5% bovine serum albumin [BSA], 1% FCS, 0.065% sodium azide, 2 mM EDTA) and added to a 96-well plate at a rate of 200,000 cells per well. Then, Fc block (BD Pharmingen) was added for 20 min at 4°C. For the staining, mouse monoclonal antibodies against S and RBD proteins were added to the cells for 30 min at 4°C, and then anti-mouse IgG fluorescein isothiocyanate (FITC)- conjugated antibodies (diluted 1 :100; eBioscience) were added to the cells as secondary antibodies for 20 min in the dark at 4°C. Finally, cells were fixed with 4% paraformaldehyde (PFA) for 20 min in the dark at 4°C and were acquired using a Gallios flow cytometer (Beckman Coulter). Data were analyzed using FlowJo software (version 8.5.3; Tree Star, Ashland, OR).
3.2.3. Expression of prefusion-stabilized SARS-CoV-2 S(3P) protein versus a S protein with only 2 prolines
Mammalian expression vectors that contained recombinant DNAs coding for the soluble S protein with a T4 fibritin trimerization sequence, a Flag peptide and a His-tag at the C- terminus were used for S expression by transfection of HEK293T cells. S constructs without the furin motif and with the K986P and V987P substitutions in the S2, and without (S2P) or with the mutation A942P (S3P) were transfected into cells for protein expression. Four days after transfection, the cell supernatants were collected for analysis of protein expression by sandwich ELISA using an anti-Flag antibody and a biotin-labelled antibody that recognize the RBD. Optical density at 490 nm in the ELISA assays were corrected by the background signals determined in wells with untransfected cell supernatants. Two independent transfections were performed. 3.3. Virus manipulation techniques
3.3.1. Viral infections
All the viruses were kept at -70°C and thawed at 37°C in a bath prior to use. Once thawed, they were stirred with a vortex and sonicated with a 3-cycle 10-second sonication and 10-second pause program (Misonix Incorporated S-3000 Sonicator, Cole-Parmer). The viruses were then added to the cell monolayer with the minimum volume of (serum-free) DMEM needed to cover the cell monolayer at the desired MOI. After 1 hour of adsorption at 37°C, the inoculum was removed and fresh DMEM-2 % FCS medium was added. The time the different infections were maintained varied with the objective of the infection, and the manner in which the cells were collected also varied.
3.3.2. Generation of recombinant MVA-S(3P) virus
In this invention, a recombinant MVA virus expressing coronavirus SARS-CoV-2 prefusion-stabilized S protein [MVA-S(3P)j was generated in DF-1 cells according to the previously described standard infection/transfection protocol (Earl et al., 2001, Curr Protoc Mol Biol, 16:16 17), with certain modifications. To generate vaccine candidate MVA-S(3P), MVA-WT was used as the parental virus, as previously described (Garcia- Arriaza et al., 2014, J Virol 88:3527-3547).
In detail, the DF-1 cell monolayer cultured in p60 dishes (Nunc) at 80-90 % confluence was infected at a MOI of 0.05 PFU/cell with MVA-WT parental virus. In the meantime, a mixture of DNA-lipofectamine 2000 was prepared by mixing 10 pg of the corresponding transfer plasmid with the suitable volume of lipofectamine 2000 (Invitrogen) in Opti- MEM (Gibco) (1.5 pi lipofectamine 2000/pg of DNA) for 20 min at room temperature to form DNA-liposome complexes. After 1 hour of adsorption of the virus, the inoculum was removed, the cells were washed two times with Opti-MEM and incubated with 1 ml of the DNA-lipofectamine mixture for 4-6 hours at 37°C and 5 % CO2. Next the transfection medium was removed, the cells were washed two times with Opti-MEM and incubated with DMEM-2 % FCS medium at 37°C and 5 % CO2. When a cytopathic effect was observed (usually after 3 days), the cells were collected, centrifuged at 1 ,500 rpm for 5 min at room temperature, and resuspended in 500 pi of serum-free DMEM. The cells were then frozen (at -70°C) and thawed (at 37°C) three times, stirring with a vortex between each freeze-thaw cycle to lyse them and release the virus into the supernatant, which was obtained after centrifuging at 3,000 rpm for 5 min at room temperature. The virus was then used to infect confluent monolayers of DF-1 cells grown in 6-well plates (M6) (Nunc) at different serial dilutions (from 101 to 106) in serum-free DMEM. After 1 hour of infection, the inoculum was removed and replaced with 3 ml of solid infection medium consisting of a mixture of 1.9 % (previously melted) agarose (Conda) with DMEM 2X-4 % FCS medium at a 1 :1 ratio. After 48 hours of infection, 1 ml of the 1.9 % agarose-DMEM 2X-4 % FCS 1:1 mixture and 1.2 mg/ml of X-Gal substrate (Sigma-Aldrich) was added to view the lysis plaques. After 24 hours, the blue plaques that were more isolated from other lysis plaques were selected. The selected lysis plaques were obtained with a 150-mm glass Pasteur pipette (Deltalab) and added to 500 pi of serum-free DMEM. After three freeze-thaw cycles and subsequent stirring with a vortex and sonication, these plaques were used as an inoculum to infect monolayers of confluent cells in 24-well plates (M24) (Nunc) as explained in section 3.3.1. These infections were performed to re-grow the virus, and they were collected when a cytopathic effect was observed. These regrown plaques were next used to re-infect monolayers of confluent cells in M24 plates, and once a cytopathic effect was observed, these cells were collected and lysed for PCR and Western Blot analysis to check that the recombinant MVA virus was generated correctly. Oligonucleotides TK-L and TK-R were used in the PCR to amplify the antigens inserted in the TK locus (oligonucleotides described in Table 1). Anti-S-protein rabbit polyclonal antibody (described in Table 2) was used to analyze expression of the S protein by Western blot.
Once the presence of the antigen and its correct expression by the different plaques were confirmed, one of them was selected and used as an inoculum to infect monolayers of confluent cells in M6 plates at dilutions from 10_1 to 106. This purification process was carried out three times selecting blue plaques, and three more times selecting colorless plaques. A purified recombinant virus containing the antigen of interest in the TK locus and without the LacZ marker, which was lost through homologous recombination, is therefore ultimately obtained.
Three types of viral stocks are distinguished in this invention. The initial viral stock (stock P1) consists of the generated recombinant virus originating from cell monolayers infected with the final plaque and collected after observing a cytopathic effect. Once having verified the expression of the antigen of interest by means of Western Blot and the purity of the recombinant virus by means of PCR and sequencing, it was used to generate the working viral stock (stock P2). For that purpose, 5 p150 plates (Nunc) containing confluent DF-1 cells were infected at an MOI of 0.05 PFU/cell and cells were collected when a cytopathic effect was observed. Stock P2 was used in all the experiments for characterizing the virus in vitro. Lastly, for the in vivo assays, the purified viral stock (stock P3) was generated from stock P2 (described in section 3.3.4.).
3.3.3. Characterization of the recombinant MVA-S(3P) virus The experiments performed to characterize the recombinant MVA-S(3P) virus include titration of the viruses, viral growth kinetics, and stability analysis of the inserted S antigen. As mentioned above, stock P2 was used to perform these characterization experiments.
Viral titration Titration of the MVA-S(3P) virus was carried out according to the previously described standard protocols (Ramirez et ai., 2000, J. Virol, 74:923-933). DF-1 cells seeded in M6 plates were infected in duplicate with serial dilutions of the virus in serum-free DMEM, as described in section 3.3.1. The medium was removed 30-40 hours post-infection and the cells were fixed for 3 min using a 1:1 mixture of methanol and acetone and the titer was determined by means of an immunostaining assay which allows detecting and counting lysis plaques formed by the virus. The monolayers were thereby incubated with a rabbit anti-VACV WR polyclonal primary antibody (diluted 1:1.000 in PBS-3 % FCS; CNB) for 1 hour at room temperature; it was then washed three times with PBS 1X and incubated for 1 hour at room temperature with the HRP-conjugated goat anti- rabbit secondary antibody (diluted 1 :1.000 in PBS-3 % FCS; Sigma-Aldrich). After three additional washes with PBS 1X, the plates were developed using 1 mg/ml of 3,3’- diaminobenzidine tetrahydrochloride (DAB; Sigma-Aldrich), as the HRP substrate, with 30 % hydrogen peroxide (Sigma-Aldrich) and 3 % nickel sulfate (N1SO4) (Sigma- Aldrich). After counting the lysis plaques, the titer was referenced as PFU/ml. Replication kinetics
To evaluate the replication capacity of the recombinant MVA-S(3P) virus and analyze if the insertion of the S gene affects their replication capacity, monolayers of DF-1 cells were infected with each virus at an MOI of 0.01 PFU/cell, in duplicate. After 1 hour of adsorption, the inocuium was removed and was added to the DMEM-2 % FCS infection medium monolayer. The cells were collected at different times post-infection (0, 24, 48, and 72 hours), subjected to three freeze-thaw cycles (stirred with a vortex between each cycle), and kept at -70°C until titration. Lastly, the viruses were sonicated and titrated using the method described in the preceding section.
Genetic stability analysis
The genetic stability of vaccine candidates MVA-S(3P) was analyzed. Monolayers of DF-1 cells were infected with MVA-S(3P) recombinant virus at an MOI of 0.05 PFU/cell. The cells were collected 72 hours post-infection, frozen-thawed three times, and briefly sonicated. The cell extracts were then centrifuged at 1,500 rpm for 5 minutes, and the supernatant was used for a new round of infection at a low MOI. The same method was repeated eight times. Expression of the coronavirus SARS-CoV-2 S protein was analyzed by means of Western blot (see section 3.2.1.) after infecting DF-1 cells with the viral stocks from each passage. 3.3.4. Virus purification
Purified virus stocks (stock P3) were used for the in vivo assays according to the method first described by Joklik (Joklik, 1962, Virology, 18:9-18) and modified by Esteban (Esteban, 1984, Virology, 133:220-227). In summary, 30 p150 plates containing confluent CEF cells were infected with a stock P2 of MVA-S(3P) at an MOI of 0.01 PFU/cell. The cells were collected when a cytopathic effect was observed (usually after 3 days), centrifuged at 1 ,500 rpm for 5 min at 4°C, and the precipitate was washed with PBS and resuspended in 10 mM Tris-HCI buffer pH 9. The infected cells were then lysed by means of three sonication cycles, stirring with a vortex, and centrifugation to release the viral particles into the supernatant. Next, this supernatant was centrifuged for 1 hour at 20,000 rpm at 4°C in the SW28 rotor (Beckman) on a 36 % sucrose pad in 10 mM Tris-HCI pH 9. The obtained precipitate was resuspended in 10 mM Tris-HCI pH 9 and centrifuged again on another 36 % sucrose pad under the same conditions. Lastly, the precipitate obtained in this second centrifugation was resuspended in 10 mM Tris-HCI pH 9, aliquoted, and frozen at -70°C until use. The purified virus was titered in duplicate and checked for the absence of mycoplasma contamination (through PCR with mycoplasma-specific oligonucleotides; see Table 1), bacteria (by means of growth in LB agar plates), and fungi (by means of growth in blood agar plates, Oxoid). Furthermore, checking for the correct expression of the S antigen of stock P3 was performed by means of PCR and Western blot before use in the in vivo assays.
3.4. In vivo immunological techniques
3.4.1. Immunization protocols In assays for analyzing adaptive immune responses 6 female C57BL/6 mice per group were inoculated by intramuscular route using a homologous prime-boost immunization protocol, which consisted of a first inoculation with 1 x 107 PFU of vaccine candidates MVA-S and MVA-S(3P), followed by a 1 x 107 PFU booster dose of the same vaccine candidates MVA-S and MVA-S(3P) 2 weeks later. The mice were sacrificed 10 days after the booster dose. All the preparations of the inocula were performed in endotoxin- free PBS (Gibco). Intramuscular immunization was performed in the triceps of both hind legs in a total volume of 100 pi of PBS (50 mI/leg), using a BD Micro-Fine (30 G) x 8 mm insulin syringe (BD Biosciences).
Moreover, 6 female C57BL/6 mice per group were inoculated with a single dose of 1 x 107 PFU of vaccine candidates MVA-S, MVA-A-S and MVA-S(3P) and control MVA-WT virus by intranasal route in 50mI of PBS. The mice were sacrificed 14 days after the immunization.
At the end of each immunization study the corresponding animals were sacrificed using CO2, blood samples were drawn and spleens, lungs and bronchial lymph nodes (BLN) removed, as appropriate in each experiment.
3.4.2. Analysis of the adaptive T cell-mediated immune response by means of ELISpot
The ELISpot assay was used to detect S antigen-specific IFNy-secreting T cells. First, 96-well nitrocellulose-bottom plates (Millipore) were covered with 75 mI/well of a solution of the rat anti-mouse IFNy monoclonal antibody (Pharmingen, San Diego, California) at a concentration of 6 pg/ml in PBS. After incubating overnight at room temperature, the wells were washed three times with RPMI medium and blocked with RPMI-10 % FCS for at least one hour at 37°C in 5 %C02 atmosphere. Moreover, the spleens of each group of immunized animals were collected in RPMI-10 % FCS medium and processed together to obtain the splenocytes as previously described (Garcia-Arriaza et al., 2013, PLoS One, 8:e66894; Najera et al., 2010, PLoS One, 5:e11406). In summary, the spleens were homogenized by means of mechanical disintegration through a 40-pm cell strainer (Falcon). The disintegrated cells were centrifuged for 5 min at 1 ,500 rpm at 4°C and washed with RPMi-10 % FCS. Next, the erythrocytes were lysed by adding 0.1 M NH4CI (2 ml/spleen) for 5 min in ice. After this time, the cells were washed three times with RPMI-10 % FCS to eliminate fat and resuspended in 12 ml of RPMI-10 % FCS, and the number of living splenocytes was counted by means of staining with trypan blue (4 % in water; Sigma-Aldrich).
To evaluate the specific response to the different antigens, 106 splenocytes per condition were re-stimulated with 1 pg/ml of the S1 or S2 peptide pool. As a control of the response to the MVA vector, 106 splenocytes were stimulated with 2.5 pg/ml of VACV E3 peptide. The plates were incubated with the peptides for 48 hours at 37°C in 5 % CO2 atmosphere, washed five times with PBS-T, and incubated with 2 pg/ml of biotinylated rat anti-mouse IFNy monoclonal antibody XMG1.2 (Pharmingen) diluted in PBS-T, for 2 hours at room temperature. The plates were then washed five times with PBS-T and a 1 :800 dilution of HRP-conjugated streptavidin (0.5 mg/ml; Sigma-Aldrich) was added. After 1 hour at room temperature, it was washed three times with PBS-T and two times with PBS, and finally 1 pg/ml of the DAB substrate (Sigma-Aldrich), resuspended in 50 mM Tris-CI pH 7.5 and 0.015 % H2O2, was added to develop the plates. The reaction was stopped by washing the plate with abundant water and once it was dry, the spots were counted using the ELISpot Reader System -ELR02- plate reader (AID Autoimmun Diagnostika GmbH) with the aid of AID ELISpot reader system software (Vitro).
3.4.3. Analysis of the adaptive cell-mediated immune response by means of flow cytometry
3.4.3.1. Analysis of the specific responses of CD4+ and CD8+ T cells
To study the response of SARS-CoV-2-specific T cells generated (see section 3.4.1.), 6 mice per group were immunized and sacrificed 10 days after the last immunization. Moreover, animals immunized with one single intranasal dose were sacrificed at 14 days postimmunization. After sacrificing the animals, spleens, lungs or bronchial lymph nodes were removed from the immunized animals in RPMI-10 % FCS medium and processed as described in the preceding section. The cells were then resuspended in RPMI-10 % FCS medium with 2 pl/ml of Monensin 1X (Thermo Fisher Scientific), 2 pl/ml of brefeldin A (BFA) ( Protein Transport Inhibitor BD GolgiPlug, BD Biosciences), and a 1 :300 dilution of anti-CD107a-FITC antibody. 1-4 x 106 cells were added in M96 conical bottom wells and were incubated for 6 hours in the presence of 1 pg/ml of the S1 or S2 peptide pool, or with 5 pg/ml of VACV E3 peptide to determine the response to the MVA vector or to monkeypox virus. As controls, the cells were stimulated with 2 mI/ml of LAC (Leukocyte Activation Cocktail, BD Biosciences) and Monensin 1X. After 6 hours of stimulation, the cells were washed with IB buffer and incubated with Violet Dye (0.5 mI/ml, Invitrogen) for 20 min in the dark at 4°C to evaluate cell viability. Next, two washes were performed with IB buffer and the cells were incubated for 20 min in the dark at 4°C with 50 mI of the primary surface antibodies (described in the Table 2) diluted as indicated for each batch. The cells were then washed two times and 100 mI of Cytofix/Cytoperm (BD Biosciences) was added per well for 20 min in the dark to 4°C for fixing and permeabilizing the cells, and they were then left in IB buffer overnight at 4°C in the dark. A wash was performed the next day with Permwash 1X (BD Biosciences) and 25 m I of Fc Block diluted 1 :100 in Permwash 1X were added for 5 min at 4°C in the dark. Next, 25 mI of the antibodies needed for intracellular cytokine staining (ICS) were added to the 25 mI of Fc Block, at different dilutions in Permwash 1X according to the batch of each antibody (see Table 2), with incubation being performed for 20 min at 4°C in the dark. Lastly, two washes were performed with Permwash 1X and the cells resuspended in 200 mI of IB buffer to later be analyzed by means of flow cytometry in a Gallios cytometer (Beckman Coulter) and by means of the FlowJo program ( Tree Star, Ashland, Oregon). The analysis strategy was performed by selecting the living cells expressing CD3 on their surface; then those expressing CD4, CD8, CD127, or CD62L; and finally those secreting the different cytokines (IFN-y, TNF-a, and IL-2) or expressing degranulation marker CD107a.
3.4.3.2. Analysis of the specific responses of follicular helper T cells
To analyze the response of follicular helper T cells (Tfh) against SARS-CoV-2, spleens were extracted from sacrificed animals and processed as explained above. The splenocytes were then resuspended in RPMI-10% FCS medium with 1 mI/ml of BFA (BD Biosciences), 1 mI/ml of Monensin 1X (eBioscience), and a 1 :100 dilution of the anti- CD154 (CD40L)-PE antibody. Next, 4 x 106 splenocytes were stimulated with 5 pg/ml of S-protein and 1 pg/ml of S1 and S2 peptide pools for 6 hours at 37°C in a conical- bottom 96-well plate. The cells were then stained with Fixable Viability Stain (FVS) 520 (BD Biosciences) for 20 min at 4°C in the dark to analyze cell viability. The splenocytes were then washed two times with IB buffer and stained for 20 min at 4°C in the dark with 50 mI of the antibodies specific against the surface markers (described in Table 2), using the dilutions recommended by the manufacturer. Next, the splenocytes were again washed two times with IB buffer, fixed, and permeabilized with the BD Cytofix/Cytoperm ™ kit (BD Biosciences) for 20 min at 4°C in the dark, and they were left in IB buffer overnight at 4°C in the dark. The cells were washed the next day with Permwash 1X (BD Biosciences) and the Fc receptors were blocked with 25 pi of Fc Block (diluted to 1:100 in Permwash 1X) for 5 min at 4°C in the dark. Next, 25 pi of the antibodies (diluted in Permwash 1X at the dilution indicated by the manufacturer) required for ICS (see Table 2) were added on 25 mI of Fc Block, incubating for 20 min at 4°C in the dark. Finally, the splenocytes were washed two times in Permwash 1X, resuspended in 200 mI of IB buffer, and passed through a Gallios flow cytometer (Beckman Coulter). The analysis was performed with the FlowJo software ( Tree Star, Ashland, Oregon). The analysis strategy was performed by selecting living cells expressing CD3, CD4, and CD44 on their surface, followed by cells expressing CXCR5, PD1 , and CD154 (CD40L), and finally cells secreting the different cytokines (IFN-y, IL-4, and IL-21).
3.4.4. Analysis of the humoral immune response The humoral immune response was determined by analyzing the levels of IgG antibodies in the sera of immunized mice and the capacity of these antibodies to neutralize the SARS-CoV-2 virus. Moreover, levels of IgA antibodies in bronchoalveolar lavages (BAL) were also analyzed. To obtain the sera, blood was collected from the animals by submandibular bleeding or after sacrificing them by means of intracardiac puncture. Next, the blood samples were maintained at 37°C for 1 hour and kept at 4°C overnight. The tubes of blood were centrifuged the next day at 3600 rpm for 20 min at 4°C and the serum was obtained, inactivated at 56°C for 30 min and kept at -20°C until use. BAL samples were obtained in 700 mI of RPM I, after the sacrifice of the mice, inactivated at 56°C for 30 min and kept at -20°C until use. Serial dilutions of each individual serum sample (or group of sera) or group of BAL samples were then performed to measure the titers of coronavirus SARS-CoV-2 S-protein-specific and RBD-specific antibodies by means of ELISA, or to measure their SARS-CoV-2 neutralizing capacity. These techniques are explained in the following sections.
3.4.4.1. Enzyme-linked immunosorbent assay (ELISA) ELISA assays were performed to analyze the levels of antibodies in the serum of immunized animals. NUNC MaxiSorp™ 96-well plates (Thermo Fisher Scientific) were coated with 2 pg/ml of the coronavirus SARS-CoV-2 S and RBD proteins in PBS and incubated at 4°C overnight. The plates were washed three times the next day with PBS- T and blocked for 2 hours at room temperature with 5% skim milk prepared in PBS-T. After this time elapsed, the plates were washed three times with PBS-T, 50 pi of the serial dilutions of the serum or BAL samples diluted in PBS with 1 % skim milk and 0.01% Tween20 were added, and the plates were incubated for 1.5 hours at room temperature. Next, the plates were again washed three times with PBS-T and incubated with 50 pi of HRP-conjugated mouse anti-lgG, -lgG1, -lgG2b, -lgG2c, -lgG3 or -IgA antibodies (diluted to 1:1000 in PBS with 1% skim milk and 0.01% Tween20) for 1 hour at room temperature. Finally, after another washing step, the plates were developed by adding 100 mI of TMB substrate (Sigma-Aldrich) and the reaction was stopped by adding 50 mI of 1 M H2SO4. Absorbance was read at 450 nm by means of an EZ Read 400 microplate reader (Biochrom). Total IgG titers were measured as the last dilution that gives an absorbance at least 3 times higher the absorbance of a naive serum.
Purified RBD-Fc proteins without (WT, Wuhan) or with mutations in VoC (alpha, beta, gamma, delta, kappa and zeta) were used in ELISA assays to determine the RBD- specific IgG antibody titers. Similar amounts of plastic-bound RBD-Fc proteins were used, as determined with an anti-HA antibody (2.5-0.0025 pg/ml) that recognized an HA tag at the RBD N-terminus. Differences in the HA antibody signal at 450 nm were used to standardize the anti-mouse IgG binding to RBD variants with respect to the WT before IgG titer determination.
3.4A.2. Neutralization assays The capacity of the sera obtained from mice immunized with vaccine candidates MVA-S and MVA-S(3P), to neutralize the SARS-CoV-2 S virus was determined using retrovirus- based pseudoparticles expressing the SARS-CoV-2 S protein. Pseudotyped viruses were produced by transfection of a mammalian DNA expression plasmid expressing the full-length S protein (DNA-S), together with packaging plasmids (kindly provided by Dr. F. L. Cosset (INSERM, Lyon)) in HEK-293T cells. Vero E6 cells were seeded in 96-well plates at 15,000 cells/well. Twenty-four hours post-seeding, a mix of retrovirus-based pseudoparticles expressing SARS-CoV-2 S protein and mice serum samples (different serial dilutions) were preincubated for 1 hour at 37°C and then added to the cells in triplicates. The DMEM-2%FCS medium was replaced 24 h after infection, and then, 24 hours later, cells were lysed in passive lysis buffer (Promega, Madison, Wl) and the luciferase activity was measured in a luminometer (Thermo Appliskan Multimode Microplate Reader, Thermo Fisher Scientific). The ID50 titers were determined as the highest dilution of serum which resulted in a 50% reduction of luciferase units compared with serum samples from control group (pseudotyped viruses not incubated with serum).
Furthermore, live-virus SARS-CoV-2 neutralization antibody titers were assessed by a microneutralization test (MNT), using SARS-CoV-2 MAD6 strain in a BSL-3 laboratory at the CNB-CSIC. Serum samples were inactivated at 56°C for 30 min and then serially diluted two-fold in duplicate in serum-free DMEM and incubated at a 1:1 ratio with 100 TCID50 (50% Tissue Culture Infectious Dose) of SARS-CoV-2 MAD6 isolate at 37° C for 1 hour. The virus/serum mixture were added to VeroE6 cell monolayers, seeded in 96-well plates (40.000-50.000 cells per well), and incubated at 37° C, in a 5% CO2 incubator for 3 days. Then, cells were fixed with 4% formaldehyde and stained with crystal violet. ID50 titers were calculated as the reciprocal dilution resulting in 50% inhibition of cell death. A WHO International Standard containing pooled plasma obtained from eleven individuals recovered from SARS-CoV-2 infection was used for the calibration and harmonisation of serological assays detecting anti-SARS-CoV-2 neutralizing antibodies (NIBSC code: 20/136).
In addition, capacity of serum samples to neutralize different SARS-CoV-2 VoC was tested by using SARS-CoV-2 pseudotyped Vesicular Stomatitis Virus (VSV) expressing S protein. SARS-CoV-2 S-protein pseudotyped rVSV-luc recombinant viruses (PSV) were produced as described elsewhere. SARS-CoV-2 S variants used were S_614D, S_614G, alpha (B.1.1.7), beta (B.1.351), gamma (P.1) and delta (B.1.617.2). SARS-
CoV-2 S mutant D614G was generated by site-directed mutagenesis (Q5 Site Directed Mutagenesis Kit; New England Biolabs) following the manufacturer’s instructions and using as an input DNA a pcDNA3.1 expression vector encoding SARS-CoV-2 S_614D. SARS-CoV-2 VoC alpha (B.1.1.7; GISAID: EPI_ISL_608430), beta (B.1.351; GISAID: EPI _ISL_712096), gamma (P.1 ; GISAID: EPI_ISL_833140) and delta (B.1.617.2;
GISAID: EPIJSL 1970335) were optimized, synthesized and cloned into pcDNA3.1 by GeneArt (Thermo Fisher Scientific, GeneArt GmbH, Regensburg, Germany).The neutralization activity of serum samples was tested by triplicates at several two-fold dilutions. For neutralization experiments, viruses-containing transfection supernatants were normalized for infectivity to a MOI of 0.5-1 and incubated with the dilutions of serum samples at 37°C for 1 hour in 96-well plates. After the incubation time, 2 x 104 Vero-E6 cells were seeded onto the virus-serum mixture and incubated at 37°C for 24 hours. Cells were then lysed, assayed for luciferase expression and NT50 titers were calculated. NT50 titers were calculated using a nonlinear regression model fit with settings for log agonist/inhibitor versus normalized response curves, in GraphPad Prism v8.
3.5. Efficacy studies in K18-hACE2 transgenic mice
Male and/or female K18-hACE2 mice (9 weeks old at the beginning of the study) immunized with one intramuscular dose of MVA-S and MVA-S(3P) were used to evaluate the efficacy of MVA-S(3P) vaccine candidate. Groups of animals (n = 11) received one dose of 1 c 107 PFU of MVA-S or MVA-S(3P) by the i.m. route in 100 pi of PBS (50 mI/leg) at week 0. Mice primed with the same dose of non-recombinant MVA- WT were used as a control group. At week 4 mice were lightly anesthetized with isoflurane and infected intranasally with 1 c 105 PFU of SARS-CoV-2 MAD6 in a total volume of 50 mI of PBS.
Moreover, female K18-hACE2 mice (9 weeks old at the beginning of the study) immunized with one intranasal dose of MVA-S, MVA-A-S and MVA-S(3P) were used to evaluate the efficacy of MVA-S(3P) vaccine candidate. Groups of animals (n = 9) received one dose of 1 c 107 PFU of MVA-S, MVA-A-S or MVA-S(3P) by the i.n. route in 50 mI of PBS at week 0. Mice primed with the same dose of non-recombinant MVA-WT were used as a control group. At week 5 mice were lightly anesthetized with isoflurane and infected intranasally with 1 c 105 PFU of SARS-CoV-2 MAD6 in a total volume of 50 m! of PBS. Furthermore, female K18-hACE2 mice (22 weeks old at the beginning of the study) immunized with two intramuscular doses of MVA-S(3P) were used to evaluate the efficacy of MVA-S(3P) vaccine candidate. Groups of animals (n = 11) received two doses of 1 x 107 PFU of MVA-S(3P) by the i.m. route in 100 mI of PBS (50 mI/leg) at weeks 0 and 4. Mice primed with the same doses of non-recombinant MVA-WT were used as a control group. At week 8 mice were lightly anesthetized with isoflurane and infected intranasally with 1 c 105 PFU of SARS-CoV-2 beta VOC (B.1.351) in a total volume of 50 mI of PBS.
Mice were monitored daily for body weight change and survival for 10-15 days postchallenge. Animals with more than a 25% of weight loss were euthanized. At days 4-5 postchallenge, three-six mice per group were euthanized, and lungs, BAL, nasal washes and serum samples were collected. One lung was divided longitudinally in two, with one part placed in RNALater stabilization reagent (Sigma-Aldrich) and stored at - 80°C until RNA extraction, and the other part stored also at -80°C until analysis of virus yields. Blood was collected from the animals by submandibular bleeding, maintained at 37°C for 1 hour, kept at 4°C overnight, and centrifuged at 3600 rpm for 20 min at 4°C to obtain the serum samples, which was then inactivated at 56°C for 30 min and kept at - 20°C until use. All experiments with SARS-CoV-2 were performed in a Biosafety Level 3 (BSL-3) Laboratory at the CISA-INIA.
3.5.1. Analysis of SARS-CoV-2 RNA and cytokines by quantitative RT-PCR (RT- qPCR)
Lungs from K18-hACE2 mice used in the efficacy studies were harvested at 4-5 days post-challenge and stored in RNALater (Sigma-Aldrich) at -80°C until homogenized with a gentleMACS dissociator (Miltenyi Biotec) in 2 ml of RLT buffer (Qiagen) plus b- mercaptoethanol (Sigma-Aldrich) and aliquoted. Moreover, nasal washes and BAL samples were also obtained. Then, 600 pi of homogenized lung tissue or 50 pi of nasal washes and BAL samples were used to isolate total RNA using the RNeasy minikit (Qiagen), according to the manufacturer's specifications. First-strand cDNA synthesis and subsequent real-time PCR were performed in one step using NZYSpeedy One-step RT-qPCR Master Mix (NZYTech) according to the manufacturer’s specifications using ROX as reference dye. SARS-CoV-2 viral RNA and RNA level of several cytokines were determined using previously validated set of primers and/or probes specific for the SARS-CoV-2 subgenomic RNA for the protein E, genomic RNA for the RdRp protein, each cytokine gene tested, and the cellular 28S rRNA for normalization. Data were acquired with a 7500 real-time PCR system (Applied Biosystems) and analyzed with 7500 software v2.0.6. Relative RNA arbitrary units (A.U.) were quantified relative to the negative group (uninfected mice) and were performed using the 2-AACt method. All samples were tested in triplicate. Moreover, for lung cytokine profile analysis by RT-qPCR, reverse transcription of 4000 ng of RNA isolated as described above from lung homogenates of K18-hACE2 mice was performed with the QuantiNova reverse transcription kit (Qiagen), according to the manufacturer’s recommendations. RT-qPCR was performed with a 7500 real-time PCR system (Applied Biosystems) using Power SYBR green PCR Master Mix (Applied Biosystems), as previously described. The mRNA expression levels of cytokines IP-10, IL-12b, CCL11, and IFN-y genes were analyzed by real-time PCR with specific oligonucleotides (sequences are available upon request). Specific gene expression was expressed relative to the expression of the cellular 28S ribosomal RNA gene in fold change units using the 2-AACt method. All samples were tested in triplicate. 3.5.2. Analysis of SARS-CoV-2 virus yields by plaque assay
Lungs from K18-hACE2 mice used in the efficacy studies were harvested at 4-5 days post-challenge, weighted, and stored directly at -80°C until homogenized with a gentleMACS dissociator (Miltenyi Biotec) in 2 ml of PBS buffer and aliquoted. Moreover, nasal washes and BAL samples were also analyzed. Then, undiluted and serial ten-fold dilutions of homogenized lung tissue, nasal washes or BAL samples were added in triplicate to Vero-E6 cell monolayers seeded in 12-well plates at 5 x 105 cells/well and after 1 hour of adsorption the inoculum was removed and plates were incubated at 37°C, 5% C02 in 2:1 DMEM 2X-4% fetal bovine serum (FBS):2% Agar. After 4 days, cells were fixed for 1 hour with 10% formaldehyde (Sigma-Aldrich), and then the agarose was removed and plaques were visualized by adding 0.5% crystal violet (Sigma-Aldrich). SARS-CoV-2 titers were determined in PFUs per gram of lung tissue or in PFUs/ml of nasal wash or BAL.
3.5.3 Lung histopathology The entire left lung lobe was removed from each K18-hACE2 mouse and immersion- fixed in zinc formalin (Sigma-Aldrich) for 48 hours. After fixation period, samples were routinely processed and embedded in paraffin blocks that were then sectioned at 4 pm thickness on a microtome, mounted onto glass slides and routinely stained with haematoxylin and eosin (H&E). Lung sections were microscopically evaluated using an Olympus BX43 microscope by a single veterinary pathologist who was blinded to the identity and group of individual mice. To assess the character and severity of histopathological lesions, the histopathological parameters evaluated were the follows: capillary endothelial cell activation; alveolar haemorrhages; alveolar oedema; perivascular oedema; alveolar septal thickening (interstitial pneumonia); alveolar damage and hyaline membranes in alveoli; inflammatory cell infiltration in alveoli; bronchi/bronchioles with epithelial necrosis, detached epithelium or inflammatory cells in the lumen (bronchitis/bronchiolitis); peribronchial/peribronchiolar and perivascular mononuclear infiltrates; pneumocytes hyperplasia; cytopathic effect or syncytia; squamous metaplasia; uniform interstitial fibrosis; organized fibrotic tissue around the bronchi/bronchioles or intrabronchiolar (bronchiolitis obliterans) and pleural thickening. The histopathological parameters were graded following a semi-quantitative scoring system as follows: (0) no lesion; (1) minimal lesion; (2) mild lesion; (3) moderate lesion; (4) severe lesion. The cumulative scores of histopathological lesions provided the total score per animal. In each experimental group, the individual scores were used to calculate the group average. In addition, H&E-stained sections were visually scored 0-6 based on the percentage of lung area affected by inflammatory lesions as follows: 0% of the lung injured (score 0); < 5% (score 1); 6-10% (score 2); 11-20% (score 3); 21-30% (score 4); 31-40% (score 5); > 40% (score 6). In each experimental group, the individual scores were used to calculate the group average.
3.5.4 Statistical procedures
For statistical analysis one-way ANOVA of transform data followed by post-hoc Student’s t-test comparisons was used to establish the differences between two groups. Statistical analysis of the ICS assay results was realized as previously described (Garcia-Arriaza et al., 2013, PLoS One, 8:e66894; Najera et a!., 2010, PLoS One, 5:e11406), using an approach that corrects measurements for background response, calculating confidence intervals and p values. The statistical significances are indicated as follows: *, p < 0.05; **, p < 0.005; ***, p < 0.001. RESULTS
In this invention, a new MVA viral vector-based vaccine have been designed and developed against the coronavirus SARS-CoV-2 causing the COVID-19 pandemic. Once generated, this recombinant MVA virus have been characterized in vitro and their capacity to stimulate adaptive SARS-CoV-2-specific T cell and humoral immune responses in vivo in immunized mice has been analysed, as well as its efficacy in humanized K18-hACE2 mice.
1. Design, generation and in vitro characterization of vaccine candidate MVA- S(3P) expressing a prefusion-stabilized SARS-CoV-2 S protein
To generate novel vaccines against SARS-CoV-2, the causative agent of COVID-19 pandemic, that could stimulate SARS-CoV-2-specifc T- and B-cell immune responses, we have developed a new MVA-based vaccine candidate expressing the SARS-CoV-2 full-length prefusion-stabilized S structural gene (Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1 , Genbank number: MN908947.3) [termed MVA-S(3P)] (see Materials and Methods). Vaccine candidate MVA-S(3P) was generated following the insertion of the complete sequence of the coronavirus SARS-CoV-2 S gene (prefusion- stabilized) in the genome of the parental virus MVA-WT. The expression of the SARS- CoV-2 S gene is under the transcriptional control of a synthetic early/late (sE/L) promoter. MVA-CoV2-S(3P) vaccine candidate express a human codon optimized full- length S protein that contains three mutations in the furin cleavage site (R682G, R683S, R685S) that avoid the cleavage of the S protein in S1 and S2, and three additional mutations in the S2 region that stabilizes the S protein in a prefusion conformation (A942P, K986P, and V987P) (Figure 1A).
Figure 1A shows a diagram of the generated vaccine candidate MVA-S(3P). The methodology used for generating this vaccine candidate has been described above in Materials and Methods. The correct insertion of the coronavirus SARS-CoV-2 S gene and the purity of the generated vaccine candidate MVA-S(3P) was confirmed by means of PCR and sequencing, after amplifying the DNA obtained from DF-1 cells that were not infected (mock) or infected with 5 PFU/cell of MVA-WT, MVA-S, and MVA-S(3P). Oligonucleotides (described in Table 1 of Materials and Methods) which hybridize in the flanking regions of the MVA TK gene ( J2R gene) were used in the PCR, and the obtained results confirmed the presence of the S gene in MVA-S and MVA-S(3P), without contamination with the parental MVA-WT (Figure 1B). The TK locus of parental virus MVA-WT was amplified as PCR control, with the TK gene being amplified. The correct presence of the S gene inserted in the TK locus was also confirmed by means of DNA sequencing.
To demonstrate that MVA-S(3P) constitutively express the prefusion-stabilized SARS- CoV-2 S protein, we performed a Western blot analysis of cell extracts from MVA- infective permissive chicken DF-1 cells infected at a MOI of 5 PFU/cell for 24 h with MVA-S (expressing a full-length non-stabilized S protein), MVA-S(3P), or MVA-WT and leave in the presence or absence of tunicamycin, an inhibitor of protein N-g!ycosylation, to analyze the glycosylation pattern of SARS-CoV-2 S protein expressed from MVA, using specific antibodies that recognize the SARS-CoV-2 S protein. The results proved that MVA-S and MVA-S(3P) vaccine candidates correctly expressed the SARS-CoV-2 S protein (of an expected molecular weight of about 180 kDa, corresponding to the full- length glycosylated S protein) at 24 h postinfection (hpi), being detected using a rabbit polyclonal antibody against SARS-CoV-2 (against SARS-CoV-2 S1 region) (Figure 1C). Furthermore, tunicamycin treatment inhibited SARS-CoV-2 S glycosylation and a single band of about 130 kDa, corresponding to the full-length unglycosylated S protein was detected (Figure 1C).
Next, we analyzed the ability of the SARS-CoV-2 S protein expressed from MVA-S(3P) recombinant to form oligomers, and compared to MVA-S. Thus, at 24 hpi, we collected cell extracts under nonreducing conditions (without b-mercaptoethanol) from DF-1 cells infected at a MOI of 5 PFU/cell with MVA-S, and MVA-S(3P), and then we analyzed by Western blotting the expression of SARS-CoV-2 S protein, using a rabbit polyclonal antibody against SARS-CoV-2 (Figure 1D). Immunoblots showed that under nonreducing conditions, the SARS-CoV-2 S protein expressed from MVA-S and MVA- S(3P) recombinants existed mainly as high-molecular-mass oligomers; presumably trimers (Figure 1D).
The secretion of the S protein in the supernatant was then analysed at different times post-infection. Cell extracts, or supernatants were collected from DF-1 cells infected with vaccine candidates MVA-S and MVA-S(3P), and with parental virus MVA-WT, at an MOI of 5 PFU/cell at 4, 7 and 24 hours post-infection. Next, the expression of the S protein in cell extracts and the secretion of said protein in the extracellular medium was analysed by means of Western blot (Figure 1 E). The results showed that the expression of the S protein was detected from 4 hours post-infection in the cell extracts originating from vaccine candidates MVA-S and MVA-S(3P) (Figure 1E). However, the expression of the S protein in the supernatants was not detected (Figure 1 E) because the S-protein inserted in the MVA genome is a transmembrane protein.
Moreover, we also analyzed the expression of the S protein in non-permissive HeLa cells infected with MVA-S and MVA-S(3P), and the results showed a similar pattern of S expression to the one described in permissive DF-1 cells (Figures 2A, 2B, 2C).
In conclusion, vaccine candidates MVA-S and MVA-S(3P), efficiently express the coronavirus SARS-CoV-2 S protein.
2. In vitro characterization of vaccine candidate MVA-S(3P)
2.1. Vaccine candidate MVA-S(3P) is stable in cell culture
To confirm that vaccine candidate MVA-S(3P) is stable and can be maintained in cultured cells without the loss of the S gene, DF-1 cells were infected with MVA-S(3P) with a low MOI for 8 consecutive serial passages, and the expression of the S-protein was determined by means of Western Blot. The results showed that MVA-S(3P) efficiently expressed the S protein for all the passages, which demonstrates that vaccine candidate MVA-S(3P) is genetically very stable (Figure 3A).
2.2. Vaccine candidate MVA-S(3P) expresses high levels of S protein in the cell membrane
To further quantify and determine differences in S expression levels between the MVA- S and MVA-S(3P) recombinants, we next analyzed by flow cytometry the S expression at 24 hpi in HeLa cells mock infected or infected with MVA-S, MVA-S(3P) and MVA-WT (Figure 3B). The resuits showed that MVA-S(3P) expressed higher levels of the S protein in the cell membrane than MVA-S, either using antibodies against the S or the RBD proteins (Figure 3B).
2.3. Vaccine candidate MVA-S(3P) replicates well in permissive cells To determine if the expression of the coronavirus prefusion-stabilized SARS-CoV-2 S protein affects MVA replication in cell culture, DF-1 cells were infected with vaccine candidates MVA-S and MVA-S(3P), and parental virus MVA-WT, and cell extracts were collected at different times post-infection (0, 24, 48, and 72 hours), and the amount of virus present was determined. The results showed that the viral growth kinetics of vaccine candidates MVA-S and MVA-S(3P), was similar (Figure 3C), and similar to parental MVA.-WT, which demonstrates that the expression of the prefusion-stabilized S protein does not negatively affect MVA vector replication in permissive conditions. Moreover, similarly to parental MVA-WT virus and as expected, MVA-S and MVA-S(3P) does not replicate in human HeLa cells (data not shown). 2.4. Vaccine candidate MVA-S(3P) expresses a transmembrane S protein
Furthermore, the S protein expressed by MVA-S(3P) is present in the cell membrane, similar to what happen with MVA-S (Figure 4). In permeabilized cells, large amounts of S protein were detected in the cytoplasm of cells infected with MVA-S or MVA-S(3P) (Figure 4A). Remarkably, in nonpermeabilized cells, we observed S protein cell surface expression, which colocalized with the wheat germ agglutinin (WGA) cell membrane probe (Figure 4B). These results further confirm SARS-CoV-2 S protein expression in cells infected with both MVA-S and MVA-S(3P) vaccine candidates and showed that it was located at the cell surface and cytoplasm.
3. Analysis of the SARS-CoV-2-specific adaptive immune response of vaccine candidate MVA-S(3P) in C57BL/6 mice after homologous (MVA/MVA) immunization protocols
The immunogenicity of vaccine candidate MVA-S(3P) in C57BL/6 mice was then evaluated in comparison to MVA-S using homologous (MVA/MVA) prime-boost immunization regimens, and the coronavirus SARS-CoV-2 S-protein-specific adaptive cell-mediated immune responses and humoral immune responses induced by those vaccine candidates were analysed in detail. Therefore, 6 C57BL/6 mice per group were immunized with two doses of each vaccine candidate MVA-S or MVA-S(3P). At 10 days after the first dose, animals were bleed to obtain serum samples, and on day 10 after the boost mice were sacrificed for measuring adaptive SARS-CoV-2-specific cell- mediated immune responses and humoral immune responses (Figure 5A) (see Materials and Methods).
3.1. Immunization of C57BL/6 mice with MVA-S(3P) vaccine candidate induces higher levels of binding IgG antibodies against SARS-CoV-2 S and RBD proteins and of SARS-CoV-2-specific neutralizing antibodies than MVA-S after administration of one dose
Next, the total levels of coronavirus SARS-CoV-2 S-protein-specific and S-protein receptor binding domain (RBD)-specific IgG antibodies, the levels of subclasses thereof, i.e., lgG1, lgG2b, lgG2c, and lgG3, and the neutralizing antibodies present in the sera of C57BL/6 mice immunized with MVA-S and MVA-S(3P), were analyzed by means of ELISA 10 days after the prime and 10 days after the second immunization (boost). The animals immunized with MVA-WT were used as a control group.
The results showed that after one dose higher levels of binding IgG antibodies against S and RBD proteins were elicited by MVA-S(3P), compared to MVA-CoV2-S (Figure 5B). However, both vaccines induced similar binding IgG antibodies against S and RBD after the second dose (Figure 5C). The presence of antibodies against the RBD region suggest that those antibodies could be neutralizing antibodies, as this domain is the main region recognized by neutralizing antibodies. The analysis of the levels of IgG isotypes against S and RBD proteins showed that both vaccine candidates induced higher lgG2c titers than lgG1 , leading to a lgG2c/lgG1 ratio higher than 1, indicate of a Th1 -like protective humoral response (Figure 6)
Finally, similarly, compared to MVA-S, MVA-S(3P) induced higher titers of neutralizing antibodies after one dose, but both vaccine candidates elicited similar titers of neutralizing antibodies after the second dose (Figure 7).
In conclusion, vaccine candidate MVA-S(3P) induced higher levels of total IgG, lgG1 , lgG2b, lgG2c, and lgG3 antibodies against SARS-CoV-2 S- and RBD proteins, and higher neutralizing antibodies than MVA-S, after one dose, but similar after two doses.
3.1. Immunization of C57BL/6 mice with two doses of vaccine candidates MVA-S and MVA-S(3P) induces similar high levels of SARS-CoV-2 S-specific cells secreting IFN-g
The coronavirus SARS-CoV-2 S-protein-specific adaptive cell-mediated immune response was first analysed by means of ELISpot (see Materials and Methods) 10 days after the boost in C57BL/6 mice (n = 6/group) immunized with two doses of MVA-S or MVA-S(3P). As a control group, mice were immunized with two doses of MVA-WT. Splenocytes originating from the spleens of each group were stimulated ex vivo with a panel of peptide pools covering the complete sequence of the coronavirus SARS-CoV-2 S-protein (S1 and S2 peptide pools). The samples were stimulated with RPMI as a negative control. After 48 hours of stimulation, the cells were labeled with antibodies to identify IFN-y-secreting cells specific for these peptides (Figure 8).
The results showed that two doses of vaccine candidates MVA-S and MVA-A-S(3P), induced similar high levels of S-specific IFN-y-secreting cells (Figure 8), with the cellular response being directed to a greater extent against S1 peptide pools (data not shown). 3.2. Immunization of C57BL/6 mice with two doses of vaccine candidates MVA-S and MVA-S(3P) induces similar strong, broad, and polyfunctional SARS-CoV-2 S- specific adaptive CD4+ and CD8+ T cell-mediated immune responses
Next, splenocytes originating from the spleens of each immunization group were stimulated ex vivo with a panel of peptide pools covering the complete sequence of the coronavirus SARS-CoV-2 S-protein (S1 and S2 peptide pools). The samples were stimulated with RPMI as a negative control. After 6 hours of stimulation, the cells were labelled with specific antibodies to identify (CD4+ and CD8+) T cell populations and respondent cells (expressing CD107a on the surface of the T cells as an indirect cytotoxicity marker and/or producing cytokines IFN-y, TNF-a, and IL-2) by ICS. The results showed that two doses of MVA-S or MVA-S(3P) induced similar levels of coronavirus SARS-CoV-2 S-protein (S1 + S2)-specific adaptive CD4+ T cell-mediated (Figure 9A, left) and CD8+ T cell-mediated (Figure 9A, right) immune responses, with the levels of specific CD8+ T cells being greater than the levels of CD4+ T cells in both groups. The detailed analysis of the response showed that, in both immunization groups, the coronavirus SARS-CoV-2 S-protein-specific CD4+ T cells and CD8+ T cells are similarly directed to a greater extent against S1 peptide pools, and also CD4+ T cells directed against S2 region are detected (Figure 9B).
These aforementioned responses can also be observed through the analysis of the percentages of S-protein (S1+S2)-specific CD4+ T cells (Figure 9C, left) or CD8+ T cells (Figure 9C, right) secreting each the cytokines (IFN-g, TNF-a, or IL-2) or expressing the cytotoxicity marker, CD107a. It must be pointed out that specific CD8+ T cell responses are characterized by a low IL-2 secretion. Finally, the polyfunctionality of the CD4+ and CD8+ T cell-mediated immune response generated by both immunization groups was analyzed by measuring the simultaneous production pattern of cytokines (IFN-y, TNF-a, and/or IL-2) plus the cytotoxic potential thereof (CD107a as a degranulation marker). The coronavirus SARS-CoV-2 S-protein (S1 +S2)-specific cell-mediated responses generated by both immunization groups were characterized by a similar high polyfunctionality (Figure 10). The CD4+ T cell-mediated response was mainly characterized by cells which are capable of carrying out all 4 functions (secreting all 3 cytokines and expressing the marker, CD107a) (Figure 10A). On the other hand, the CD8+ T cell-mediated response was mainly characterized by cells which are capable of carrying out 3 functions (CD107a, IFN-g and TNF-a) (Figure 10B).
In conclusion, two doses of vaccine candidates MVA-S or MVA-S(3P) are capable of inducing in mice similar robust, broad and polyfunctional coronavirus SARS-CoV-2 S- protein-specific adaptive CD4+ and CD8+ T cell-mediated immune responses. 3.3. Immunization of C57BL/6 mice with two doses of vaccine candidates MVA-S and MVA-S(3P) induces similar adaptive SARS-CoV-2 S-specific CD4+ and CD8+ T cell-mediated immune response with effector memory phenotype
Next, we determined the phenotype of the adaptive SARS-CoV-2-specific CD4+ and CD8+ T cells by measuring the expression of CD127 and CD62L surface markers, which defined different memory subpopulations: T central memory (TCM, CD127+/CD62L+), T effector memory (TEM, CD127+/CD62L ), and T effector (TE, CD1277CD62L ) cells, and determined the sums of the individual responses expressing CD107a, IFN-g, TNF-a, and/or IL-2 obtained for the S1, and S2 peptide pools (Figure 11). The results showed that in both vaccinated groups, adaptive SARS- CoV-2-specific CD4+ (Figure 11 A) and CD8+ (Figure 11 B) T cells were mainly of the TEM phenotype (Figure 11) and with a similar magnitude in both groups.
3.4. Immunization of C57BL/6 mice with two doses of vaccine candidates MVA-S and MVA-S(3P) induces adaptive SARS-CoV-2 S-specific CD4+ T follicular helper (Tfh) cell-mediated immune response Next, the proportion of coronavirus SARS-CoV-2 S-specific CD4+ T follicular helper (Tfh) cells was analyzed by means of ICS 10 days after the boost in C57BL/6 mice immunized with two doses of MVA-S or MVA-S(3P), as described above.
Splenocytes isolated from the spleen were stimulated ex vivo with a combination of the coronavirus SARS-CoV-2 S-protein, together with the S1 and S2 peptide pools covering the complete sequence of said protein. The samples were stimulated with RPMI as a negative control. After 6 hours of stimulation, the cells were labelled with specific antibodies to identify the population of S-specific Tfh cells (CD4+, CXCR5+, and PD1+) expressing the marker CD40L (marker related to T cell effector functions) and/or producing the cytokines IFN-y and/or IL-21.
The results showed that in both vaccinated groups SARS-CoV-2-specific CD4+ Tfh cells expressing CD40L and/or secreting IFN-g and/or IL-21 were induced (Figure 12A), with MVA-S inducing higher magnitude than MVA-S(3P).
The pattern of SARS-CoV-2-specific CD4+ Tfh cells showed that in both vaccinated groups most of the CD4+ Tfh secreted IFN-g and IL-21, followed by the presence of CD40L (Figure 12B).
Finally, the polyfunctionality of the Tfh cell-mediated immune response generated by both immunization groups was analyzed by measuring the simultaneous production pattern of cytokines (IFN-g and/or IL-21) plus the marker, CD40L. The coronavirus SARS-CoV-2 S-protein-specific Tfh cell-mediated responses generated by both immunization groups were characterized by a high polyfunctionality (Figure 12C). The Tfh cell-mediated response was mainly characterized by cells which are capable of carrying out all 2 functions (secreting IFN-g and IL-21), followed by cells capable of carrying out 3 functions (secreting the 2 cytokines and expressing the marker, CD40L) (Figure 12C). In conclusion, vaccine candidates MVA-S and MVA-S(3P) induce Tfh cell- mediated responses.
4. Analysis of the efficacy of MVA-S(3P) in humanized K18-h ACE2 mice
4.1 One single dose of MVA-S(3P) prevented morbidity and mortality in SARS- CoV-2 -challenged K18-hACE2 transgenic mice, reducing SARS-CoV-2 virus replication, lung pathology and levels of pro-inflammatory cytokines
Next, we evaluated the ability of one single dose of MVA-S(3P) to protected against SARS-CoV-2 infection. Thus, for morbidity and mortality evaluation, groups of K18-hACE2 mice (n = 11 ) were immunized with one dose (1 c 107 PFU by the intramuscular route) of MVA-S or MVA-S(3P) at week 0 and then challenged at week 4 with 1 x 105 PFU of SARS-CoV-2 (MAD6 isolate) by the intranasal route (Figure 13A). Mice primed with MVA-WT were used as control group.
To evaluate the vaccine efficacy, mice were monitored for changes in body weight and mortality for 15 days after the challenge. All K18-hACE2 mice immunized with one dose of MVA-S(3P) and challenged with SARS-CoV-2 did not lose body weight (Figure 13B) and survived (Figure 13C), whereas mice immunized with one dose of MVA-S lost body weight during the first 4 days postchallenge (Figure 13B), but recovered and survived (Figure 13C). On the other hand, mice inoculated with MVA-WT and challenged with SARS-CoV-2 lost body weight (more than 25%) (Figure 13B) and all died at 6-7 days postchallenge (Figure 13C).
To determine the effect of vaccination in SARS-CoV-2 virus replication, six mice per group were sacrificed at day 4 after SARS-CoV-2 virus challenge, lungs collected and processed, and the presence of SARS-CoV-2 subgenomic E and genomic RdRp RNA (Figure 13D) as well as of live infectious virus (Figure 13E) was analyzed. One dose of MVA-S(3P) was more effective than MVA-S to prevent SARS-CoV-2 replication, reducing significantly subgenomic and genomic SARS-CoV-2 RNA levels (Figure 13D) in comparison to MVA-WT control infected mice, as well as the infectious virus yields with respect to the MVA-S vaccinated mice and MVA-WT control infected mice (Figure 13E). Histopathological evaluation of lungs at 4 days postchallenge (n=6/group) showed that mice vaccinated with one dose of MVA-S(3P) exhibited lower lung inflammation scores (Figure 14A, left panel) and lower percentages of lung area with lesions (Figure 14A, right panel) than control MVA-WT mice, and significantly lower lesions and lung affected area than mice immunized with one dose of MVA-S (Figure 14A). Representative images of lung sections are included in Figure 14B; mice vaccinated with one dose of MVA-S(3P) only displayed focal thickening of the alveolar septae, and occasional presence of inflammatory cells within the alveoli. However, mice immunized with one dose of MVA-S or with control MVA-WT showed more severe diffuse thickening of the alveolar septae, higher presence of mononuclear cell infiltrates within alveolar spaces, as well as the presence of larger multifocal perivascular and peribronchiolar mononuclear infiltrates (Figure 14B).
In addition, the effect of vaccination on the pro-inflammatory cytokine pattern induced in infected mice was evaluated at 4 days postchallenge by measuring by RT- qPCR the mRNA levels of key cytokines on lung homogenates (Figure 14C). Compared to control infected mice or mice immunized with one dose of MVA-S, one dose of MVA- S(3P) induced a significant down-regulation of IL-12b, CCL11 , IP-10, and IFN-y mRNA levels (Figure 14C). 4.2. One dose of MVA-S(3P) triggered in K18-hACE2 transgenic mice higher titers of S- and RBD-specific IgGs and neutralizing antibodies against different SARS- CoV-2 variants of concern (VoC) than MVA-S
Next, we evaluated SARS-CoV-2-specific humoral responses induced in transgenic K18-hACE2 mice vaccinated with one dose of MVA-S(3P) or MVA-S, after vaccine immunization and postchallenge.
K18-hACE2 mice immunized with one dose of MVA-S(3P) induced significantly higher titers of S- and RBD-specific IgG antibodies at 14 days post immunization than MVA-S-vaccinated mice (Figure 15A). Similar differences were detected 4 days after SARS-CoV-2 infection; nonetheless, the two vaccinated groups showed comparable IgG titers against S and RBD at day 15 postchallenge (Figure 15A), reflecting an expansion effect due to the infection, which was more considerable in the MVA-S- vaccinated group.
Consistently and similarly to IgG antibody titers, one dose of MVA-S(3P) induced significantly higher titers of neutralizing antibodies against live SARS-CoV-2 than MVA- S at 14 days postimmunization and at 4 days postchallenge, although at day 15 postchallenge the neutralization titers were enhanced and similar in both groups (Figure 15B), reflecting again the existence of a breakthrough infection.
Remarkably, at 14 days postimmunization similar neutralizing antibody titers against SARS-CoV-2 parental Wuhan strain, D614G mutant, and the VoC alpha (B.1.1.7), gamma (P.1) and delta (B.167.2) were detected in serum from mice immunized with MVA-S(3P), markedly higher than the titers in MVA-S-vaccinated mice (Figure 15C, left). Nonetheless, the beta (B.1.351) VoC was neutralized poorly with all the serum samples (Figure 15C, left), with 5.44-fold and 9.36-fold reduction of neutralization versus the parental Wuhan strain in serum samples from MVA-S(3P)- and MVA-S-vaccinated mice, respectively. SARS-CoV-2 infection markedly boosted neutralization titers against the Wuhan strain, D614G mutant, and all VoC at day 15 postchallenge in both vaccinated groups, but titers induced by MVA-S vaccination were higher than those elicited by MVA-S(3P), suggesting that MVA-S(3P) vaccination controlled better the infection (Figure 15C, right). Moreover, after challenge neutralization against parental Wuhan strain and the different VoC was similar in serum samples from MVA-S(3P)- and MVA-S-vaccinated mice (Figure 15C, right). 5. Analysis of the SARS-CoV-2-specific adaptive immune response of vaccine candidate MVA-S(3P) in C57BL/6 mice after immunization with one single intranasal dose
5.1. One single intranasal dose of MVA-S(3P) induced in C57BL/6 mice local and systemic SARS-CoV-2 -specific CD4+ and CD8+ T-cell immune responses and CD4+ Tfh cell responses
Next, to evaluate the SARS-CoV-2-specific immunogenicity induced after intranasal administration of MVA-S(3P), C57BL/6 mice (n=6/group) were immunized intranasal!y with one single dose of 1 x 107 PFUs of MVA-S, MVA-A-S, or MVA-S(3P), and 14 days post-immunization, animals were euthanized and SARS-CoV-2 S-specific T-cell immune responses were evaluated locally (in lungs and bronchial lymph nodes) or systemically (in spleen). Animals vaccinated with non-recombinant MVA-WT were used as a control group. Cells were stimulated ex vivo with S peptide pools, spanning the entire S protein, and an ICS assay was performed to measure the induction of SARS- CoV-2 S-specific CD4+ and CD8+ T cells expressing CD107a, and secreting IFN-y, TNF-a, and/or IL-2.
All vaccinated groups elicited similar S-specific CD4+ and CD8+ T-cell responses, with a higher overall response mainly mediated by the CD8+ T-cell compartment and a CD4+ Th1-skewed profile, being the responses of a higher magnitude in the local compartment (lungs) than systemically (spleen) (Figure 16A). Furthermore, all vaccinated mice triggered similar highly polyfunctional CD8+ T cells, either locally or systemically (Figure 16B).
Next, the proportion of SARS-CoV-2 S-specific CD4+ Tfh cells was analyzed by ICS in splenocytes obtained from the same C57BL/6 mice immunized mice. The results showed that in all vaccinated groups similar SARS-CoV-2-specific CD4+ Tfh cells expressing CD40L and/or secreting IFN-g and/or IL-21 were induced (Figure 16C), This response was highly polyfunctional in all vaccinated groups, with all CD4+ Tfh cells carrying out 3 functions (secreting IFNy and IL-21 cytokines and expressing the marker CD40L) (Figure 16D). 5.2 One single intranasal dose of MVA-S(3P) elicited high titers of systemic S- specific IgG antibodies and mucosal S-specific IgA antibodies
Next, to evaluate the ability of MVA-S(3P) administered intranasally to elicit systemic humoral immune responses against SARS-CoV-2, we determined the presence of S- specific binding IgG antibodies in the serum of immunized mice at 14 days post immunization. All vaccinated groups induced high titers of IgG antibodies against the S protein, with MVA-S(3P) inducing significant higher titers than MVA-S or MVA-A-S (Figure 17A). Moreover, in all vaccinated groups, S-specific lgG1, lgG2c, and lgG3 antibodies were induced with lgG2c > lgG1 > lgG3 and lgG2c/lgG1 ratios above 1, indicative of a Th1- like protective immune response (Table 3).
Next evaluated the capacity of MVA-S(3P) administered intranasally to elicit mucosal humoral immune responses against SARS-CoV-2, by analysing by ELISA the presence of S-specific binding IgA antibodies in the BAL of immunized mice at 14 days post immunization. All vaccinated groups induced IgA antibodies against the S protein, with MVA-S(3P) inducing significant higher titers than MVA-S or MVA-A-S (Figure 17B).
Table 3. Isotype analysis of anti-S IgG antibodies in immunized C57BL/6 and transgenic K18-hACE2 mice, a Mean titer of lgG1, lgG2c and lgG3 isotype antibodies against SARS-CoV-2 S protein, and ratio lgG2c/lgG1, from duplicates of pooled sera samples obtained from the different immunization regimens studied. 6. Analysis of the efficacy of MVA-S(3P) in humanized K18-hACE2 mice after immunization with one single intranasal dose
6.1 Intranasal administration of one single dose of MVA-S(3P) prevented morbidity and mortality in SARS-CoV-2 -challenged K18-hACE2 transgenic mice, reducing SARS-CoV-2 virus replication in lungs and nasal washes After the demonstration that intranasal inoculation of one single dose of MVA-S(3P) induced a robust T-cell and humoral immunogenicity against SARS-CoV-2 in C57BL/6 mice, we next evaluated the efficacy triggered by intranasal administration of one dose of MVA-S(3P) in transgenic K18-hACE2 mice. Thus, K18-hACE2 mice (n = 9/group) were intranasally immunized with one dose of MVA-S, MVA-A-S or MVA-S(3P), and challenged 5 weeks later with a lethal dose of SARS-CoV-2 (MAD6 isolate containing D614G mutation) by intranasal route (Figure 18A). Challenged mice previously inoculated with one dose of MVA-WT were used as a control group.
To evaluate the vaccine efficacy, mice were monitored for changes in body weight and mortality for 14 days after the challenge. All K18-hACE2 mice intranasally immunized with one dose of MVA-A-S or MVA-S(3P) and challenged with SARS-CoV-2 did not lose body weight (Figure 18B) and survived (Figure 18C), whereas mice inoculated with MVA-WT and challenged with SARS-CoV-2 lost body weight (Figure 18B) and all died at 8 days postcha!lenge (Figure 18C). Mice immunized with one dose of MVA-S lost body weight during the first 6 days postchallenge (Figure 18B), but recovered and survived (Figure 18C).
Next, to determine the effect of intranasal vaccination in SARS-CoV-2 virus replication, four mice per group were sacrificed at day 5 after SARS-CoV-2 virus challenge, lungs and nasal washes collected and processed, and the presence of SARS-CoV-2 subgenomic E and genomic RdRp RNA (Figure 18D and 18E), as well as of live infectious virus (Figure 18E and 18G) was analyzed. One intranasal dose of MVA-S(3P) was more effective than MVA-S or MVA-A-S to prevent SARS-CoV-2 replication, reducing significantly subgenomic and genomic SARS-CoV-2 RNA levels in lungs (Figure 18D) and nasal washes (Figure 18E), in comparison to MVA-WT control infected mice. Remarkably, no infectious virus was detected in lungs (Figure 18F) or nasal washes (Figure 18G) from vaccinated mice, in comparison to MVA-WT control mice, indicating that sterilizing immunity was achieved.
6.2 Intranasal administration of one single dose of MVA-S(3P) reduced lung pathology and levels of pro-inflammatory cytokines
Next, we evaluated the impact of intranasal vaccination on lung pathology and levels of pro-inflammatory cytokines. Histopathologica! evaluation of lungs at 5 days postchallenge (n=4/group) showed that mice intranasally vaccinated with one dose of MVA-S(3P) displayed significant lower lung inflammation scores (Figure 19A, left panel) and lesser percentages of lung area with lesions (Figure 19A, right panel) than control MVA-WT mice. On the other hand, mice vaccinated with MVA-S or MVA-A-S showed slightly lower levels of lung inflammation scores and lesser percentages of lung area with lesions than control MVA-WT mice (Figure 19A), but differences were not significant. Representative images of lung sections showed that mice vaccinated with one dose of MVA-S(3P) only displayed focal thickening of the alveolar septae, and occasional presence of inflammatory cells within the alveoli (Figure 19B). However, mice immunized with one dose of MVA-S or MVA-A-S or with control MVA-WT showed more severe diffuse thickening of the alveolar septae, higher presence of mononuclear cell infiltrates within alveolar spaces, as well as the presence of larger multifocal perivascular and peribronchiolar mononuclear infiltrates (Figure 19B).
Next, the effect of intranasal vaccination on the pro-inflammatory cytokine pattern induced in infected mice was evaluated at 5 days postchallenge by measuring by RT- qPCR the mRNA levels of key cytokines on lung homogenates (Figure 20A) or nasal washes (Figure 20B). Remarkably, the results showed that compared to control MVA- WT infected mice, one intranasal dose of MVA-S(3P) induced a significant down- regulation of several pro-inflammatory cytokines, such as IL-6, CXCL10, TNF-a, IFN-y, IL-12b, CXCL5, CCL2, CCL11 and CCL12, either in lung samples (Figure 20A) or in nasal washes (Figure 20B). 6.3 One intranasal dose of MVA-S(3P) triggered in K18-hACE2 transgenic mice high titers of S-specific IgGs and neutralizing antibodies against different SARS- CoV-2 variants of concern
Next, we evaluated SARS-CoV-2-specific humoral responses induced in transgenic K18-hACE2 mice vaccinated with one intranasal dose of MVA-S, MVA-A-S or MVA- S(3P), after vaccine immunization and postchallenge.
K18-hACE2 mice immunized with one intranasal dose of MVA-S(3P) induced significantly higher titers of S-specific IgG antibodies at 14 days post immunization than MVA-S- or MVA-A-S-vaccinated mice (Figure 21 A). Similar differences were detected 5 days after SARS-CoV-2 infection; nonetheless, all vaccinated groups showed comparable IgG titers against S at day 14 postchallenge (Figure 21 A), reflecting an expansion effect due to the infection in the MVA-S- and MVA-A-S-vaccinated groups.
Analysis of IgG isotypes against S protein at the prechallenge and postchallenge time points showed superior titers of lgG2c than lgG1 and lower titers of lgG3 antibodies in all immunization regimens, leading to a lgG2c/lgG1 ratio higher than 1 (Table 3), which is indicative of a Th1-type protective humoral response.
Consistently and similarly to IgG antibody titers, one dose of MVA-S(3P) induced significantly higher titers of neutralizing antibodies against live SARS-CoV-2 (MAD6 isolate) than MVA-S or MVA-A-S at 14 days postimmunization and at 5 days postchallenge, although at day 14 postchallenge the neutralization titers were enhanced and similar in all groups (Figure 21 B), reflecting the existence of a breakthrough infection mainly in the MVA-S- and MVA-A-S-vaccinated groups and suggesting that MVA-S(3P) vaccination controlled better the infection.
Remarkably, at 14 days postimmunization similar neutralizing antibody titers against SARS-CoV-2 parental Wuhan strain, D614G mutant, and VoCs alpha (B.1.1.7), beta (B.1.351), gamma (P.1) and delta (B.167.2) were detected in serum from mice immunized with MVA-S(3P), markedly higher than the titers in MVA-S- or MVA-A-S vaccinated mice (Figure 21 C, left). SARS-CoV-2 infection markedly boosted neutralization titers against the Wuhan strain, D614G mutant, and all VoC at day 14 postchallenge in all vaccinated groups, with similar titers induced by all vaccinated groups (Figure 21 C, right). 7. Analysis of the efficacy of MVA-S(3P) in humanized K18-hACE2 mice immunized with two doses of MVA-S(3P) by intramuscular dose and challenged with SARS-CoV-2 B.1.351 variant of concern
7.1 Intramuscular administration of two doses of MVA-S(3P) prevented morbidity and mortality in K18-hACE2 transgenic mice challenged with SARS-CoV-2 - B.1.351 variant of concern, reducing SARS-CoV-2 virus replication in lungs and BAL
Next, we evaluated whether MVA-S(3P) could protect transgenic K18-hACE2 mice against a SARS-CoV-2 infection with a VOC. Thus, K18-hACE2 mice (n = 11 /group; 22 weeks old) were intramuscularly immunized with two doses of MVA-S(3P) at weeks 0 and 4, and challenged 4 weeks later with a lethal dose of SARS-CoV-2 (B.1.651 VOC) by intranasal route (Figure 22A). Challenged mice previously inoculated with two doses of MVA-WT were used as a control group.
To evaluate the vaccine efficacy, mice were monitored for changes in body weight and mortality for 10 days after the challenge. All K18-hACE2 mice immunized with two doses of MVA-S(3P) and challenged with SARS-CoV-2 B.1.351 VOC did not lose body weight (Figure 22B) and survived (Figure 22C), whereas mice inoculated with MVA-WT and challenged with SARS-CoV-2 lost body weight (Figure 22B) and all died at 4 days postchallenge (Figure 22C). Next, to determine the effect of vaccination in SARS-CoV-2 virus replication, three mice per group were sacrificed at day 4 after SARS-CoV-2 virus challenge, lungs and BAL samples collected and processed, and the presence of SARS-CoV-2 subgenomic E and genomic RdRp RNA (Figure 22D and 22E), as well as of live infectious virus (Figure 22 E and 22G) was analyzed. MVA-S(3P) prevented SARS-CoV-2 B.1.351 VOC replication, reducing significantly subgenomic and genomic SARS-CoV-2 RNA levels in lungs (Figure 22D) and BAL (Figure 22E), in comparison to MVA-WT control infected mice. Remarkably, no infectious virus was detected in lungs (Figure 22F) or BAL (Figure 22G) from vaccinated mice, in comparison to MVA-WT control mice, indicating that sterilizing immunity was achieved. 7.2 Intramuscular administration of two doses of MVA-S(3P) reduced levels of pro-inflammatory cytokines
Next, the effect of vaccination on the pro-inflammatory cytokine pattern induced in infected mice was evaluated at 4 days postchallenge by measuring by RT-qPCR the mRNA levels of key cytokines on lung homogenates (Figure 23). Remarkably, the results showed that compared to control MVA-WT infected mice, MVA-S(3P) induced a down-regulation of several pro-inflammatory cytokines, such as IL-10, CXCL10, TNF-a, IFN-Y, !L-12b and CXCL5 (Figure 23). 7.3 Intramuscular administration of two doses of MVA-S(3P) triggered in K18- hACE2 transgenic mice high titers of S-specific IgGs against different SARS-CoV- 2 variants of concern
Next, we evaluated SARS-CoV-2-specific humoral responses induced in transgenic K18-hACE2 mice vaccinated with MVA-S(3P), after vaccine immunization and postchallenge.
K18-hACE2 mice immunized with MVA-S(3P) induced high titers of S-specific IgG antibodies at 14 days postprime, which were enhanced at 21 postboost, and maintained at high levels at 4 and 10 days postchallenge (Figure 24A). Remarkably, at 14 days postprime and 21 days postboost, binding IgG antibodies detecting RBD from several VOC were induced in mice immunized with MVA-S(3P) (Fig. 24B).
8. Immunization of C57BL/6 mice with two doses of vaccine candidates MVA-S and MVA-S(3P) induces monkeypox-specific CD8+ T cell-mediated immune responses
Next, the immunogenicity of vaccine candidate MVA-S(3P) against monkey poxvirus was evaluated in C57BL/6 mice using homologous (MVA/MVA) prime-boost immunization regimens, as described in Figure 5A. Thus, splenocytes from the spleens of each immunization group were stimulated ex vivo with a vaccinia virus E3 peptide (VGPSNSPTF). The samples were stimulated with RPMI as a negative control. After 6 hours of stimulation, the cells were labelled with specific antibodies to identify (CD4+ and CD8+) T cell populations and respondent cells (expressing CD107a on the surface of the T cells as an indirect cytotoxicity marker and/or producing cytokines IFN-y, TNF- a, and IL-2) by ICS.
The results showed that two doses of MVA-S or MVA-S(3P) induced similar levels of monkeypox-specific CD8+ T cell-mediated immune responses (Figure 25A). These aforementioned responses can also be observed through the analysis of the percentages of monkeypox-specific CD8+ T cells secreting each the cytokines (IFN-y, TNF-a, or IL-2) or expressing the cytotoxicity marker, CD107a (Figure 25B), and the percentage of CD8+ T-cell memory populations (Figure 25C). Finally, the polyfunctionality of the CD8+ T cell-mediated immune response showed that both immunization groups were characterized by a similar high polyfunctional profile, analyzed by measuring the simultaneous production pattern of cytokines (IFN-y, TNF-a, and/or IL-2) plus the cytotoxic potential thereof (CD107a as a degranulation marker). The CD8+ T cell-mediated response was mainly characterized by cells which are capable of carrying out 3 functions (CD107a, IFN-g and TNF-a) (Figure 25D).
In conclusion, two doses of vaccine candidates MVA-S or MVA-S(3P) are capable of inducing in mice similar robust, and polyfunctional monkeypox-specific adaptive CD8+ T cell-mediated immune responses.
9. SARS-CoV-2 S(3P) protein is express at higher levels than a S(2P) protein
With the objective of studying the impact of the A942P amino acid substitution in the S protein, mammalian expression vectors that contained recombinant DNAs coding for the soluble S protein with a T4 fibritin trimerization sequence, a Flag peptide and a His-tag at the C-terminus were used for S expression by transfection of HEK293T cells. S constructs without the furin motif and with the K986P and V987P substitutions in the S2, and without (S2P) or with the mutation A942P (S3P) were transfected into cells for a comparative of protein expression. Four days after transfection, the cell supernatants were collected for analysis of protein expression by sandwich ELISA using an anti-Flag antibody and a biotin-labelled antibody that recognize the RBD. The results showed that the S(3P) protein was expressed about 4-fold times than the S(2P) protein (Fig. 26), indicating that the presence of a third mutation in the S protein (A942P) increases the expression levels of the full length protein in transfected cells. These results explain the extraordinary capacity of the vector of the present invention to elicit a protective immune response: it is known that induction of a strong humoral and cellular immune response against a foreign gene product expressed by, e.g., a VACV vector, may be hampered by the fact that the foreign gene product has to compete with all of the more than 150 antigens of the VACV vector for recognition and induction of specific antibodies and T cells. Therefore, the ability of a vector to express very efficiently an heterologous antigen, such as the S protein of SARS-CoV-2 virus, is desired to ensure that the immune response against said antigen is not masked by the immune response against other proteins of the vector backbone. SEQUENCE LISTING
The full-length SARS-CoV-2 S sequence inserted in vaccine candidate MVA-S(3P) described in the present examples was synthetized by GeneArt, was human codon optimized, and contains three mutations in the furin cleavage site (R682G, R683S, R685S) that avoid the cleavage of the S protein in S1 and S2, and three additional mutations in the S2 region that stabilizes the S protein in a prefusion conformation (A942P, K986P, and V987P). The sequence was derived from Wuhan seafood market pneumonia virus isolate Wuhan-Hu-1 (GenBank: MN908947.3, https://www.ncbi.nlm.nih.gov/nuccore/MN908947). The sequence is reproduced herein below as SEQ ID NO 1.
- The S nucleotide sequence reads as follows (SEQ ID NO 1):
ATGTTCGTGTTTCTGGTGCTGCTGCCTCTGGTGTCCAGCCAGTGTGTGAACCTGAC CACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCGTGTAC T ACCCCGACAAGGT GTT CAGAT CCAGCGT GCT GCACT CT ACCCAGGACCT GTT CC TGCCTTTCTTCAGCAACGTGACCTGGTTCCACGCCATCCACGTGTCCGGCACCAAT GGCACCAAGAGATT CGACAACCCCGT GCTGCCCTT CAACGACGGGGT GT ACTTT G CCAGCACCGAGAAGT CCAACAT CAT CAGAGGCT GGAT CTT CGGCACCACACT GGA CAGCAAGACCCAGAGCCTGCTGATCGTGAACAACGCCACCAACGTGGTCATCAAA GT GTGCGAGTT CCAGTT CTGCAACGACCCCTT CCT GGGCGT CTACTACCACAAGA ACAACAAGAGCT GGAT GGAAAGCGAGTT CCGGGT GTACAGCAGCGCCAACAACT G CACCTTCGAGTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGC AACTT CAAGAACCTGCGCGAGTT CGT GTT CAAGAACAT CGACGGCT ACTT CAAGAT CT ACAGCAAGCACACCCCT AT CAACCT CGT GCGGGAT CTGCCT CAGGGCTT CT CT GCTCTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGA CACTGCTGGCCCTGCACAGAAGCTACCTGACACCTGGCGATAGCAGCAGCGGAT GGACAGCT GGT GCCGCCGCTT ACT AT GT GGGCT ACCT GCAGCCT AGAACCTT CCT GCTGAAGTACAACGAGAACGGCACCATCACCGACGCCGTGGATTGTGCTCTGGAT CCT CT GAGCGAGACAAAGT GCACCCT GAAGT CCTT CACCGT GGAAAAGGGCATCT ACCAGACCAGCAACTTCCGGGTGCAGCCCACCGAATCCATCGTGCGGTTCCCCAA T AT CACCAAT CTGT GCCCCTT CGGCG AGGT GTT CAATGCCACCAGATT CGCCTCTG T GTACGCCTGGAACCGGAAGCGGAT CAGCAATT GCGT GGCCGACT ACT CCGT GCT GT ACAACT CCGCCAGCTT CAGCACCTT CAAGT GCTACGGCGT GT CCCCTACCAAG CT GAACGACCT GT GCTT CACAAACGT GTACGCCGACAGCTT CGT GAT CCGGGGAG ATGAAGTGCGGCAGATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTA CAAGCT GCCCGACGACTT CACCGGCT GT GT GATT GCCT GGAACAGCAACAACCT G
GACTCCAAAGTCGGCGGCAACTACAATTACCTGTACCGGCTGTTCCGGAAGTCCA
ATCTGAAGCCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCAC
CCCTTGTAACGGCGTGGAAGGCTTCAACTGCTACTTCCCACTGCAGTCCTACGGC
TTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCT
TCGAACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCT
CGT GAAGAACAAAT GCGT GAACTT CAACTT CAACGGCCT GACCGGCACCGGCGT G
CTGACAGAGAGCAACAAGAAGTTCCTGCCATTCCAGCAGTTTGGCCGGGATATCG
CCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCAC
CCCTT GCAGCTT CGGCGGAGT GT CT GT GAT CACCCCT GGCACCAACACCAGCAAT
CAGGTGGCAGT GCT GT ACCAGGACGT GAACT GTACCGAAGT GCCCGT GGCCATT C
ACGCCGAT CAGCT GACACCTACAT GGCGGGT GTACT CCACCGGCAGCAATGT GTT
T CAGACCAGAGCCGGCT GT CT GAT CGGAGCCGAGCACGT GAACAATAGCT ACGAG
TGCGACATCCCCATCGGCGCTGGCATCTGTGCCAGCTACCAGACACAGACAAACA
GCCCCGGGAGTGCAAGTTCTGTGGCCAGCCAGAGCATCATTGCCTACACAATGTC
T CT GGGCGCCGAGAACAGCGT GGCCTACT CCAACAACT CTAT CGCT AT CCCCACC
AACTT CACCAT CAGCGT G ACCAC AG AG AT CCT GCCT GTGT CCAT G ACCAAG ACCA
GCGT GGACT GCACCAT GTACAT CTGCGGCGATT CCACCGAGTGCT CCAACCTGCT
GCTGCAGTACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCC
GT GGAACAGGACAAGAACACCCAAGAGGT GTT CGCCCAAGT GAAGCAGAT CTACA
AGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGAT
CCTAGCAAGCCCAGCAAGCGGAGCTTCATCGAGGACCTGCTGTTCAACAAAGTGA
CACTGGCCGACGCCGGCTTCATCAAGCAGTATGGCGATTGTCTGGGCGACATTGC
CGCCAGGGATCTGATTTGCGCCCAGAAGTTTAACGGACTGACAGTGCTGCCTCCT
CT GCT GACCGAT GAGAT GAT CGCCCAGT ACACAT CT GCCCT GCTGGCCGGCACAA
TCACAAGCGGCTGGACATTTGGAGCTGGCGCCGCTCTGCAGATCCCCTTTGCTAT
GCAGAT GGCCTACCGGTT CAACGGCAT CGGAGT GACCCAGAAT GT GCT GT ACGAG
AACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACA
GCCTGAGCAGCACACCAAGCGCCCTGGGAAAGCTGCAGGACGTGGTCAACCAGA
ATGCCCAGGCACTGAACACCCTGGTCAAGCAGCTGTCCTCCAACTTCGGCGCCAT
CAGCT CT GT GCT GAACGATATCCT GAGCAGACT GGACCCACCTGAAGCCGAGGT G
CAGATCGACAGACTGATCACCGGAAGGCTGCAGTCCCTGCAGACCTACGTTACCC
AGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCCAATCTGGCCGCCACCAA
GATGT CT GAGT GT GT GCT GGGCCAGAGCAAGAGAGT GGACTTTT GCGGCAAGGG
CT ACCACCT GAT GAGCTT CCCT CAGT CTGCCCCTCACGGCGT GGT GTTTCT GCAC GT GACATACGT GCCCGCT CAAGAGAAGAATTT CACCACCGCT CCAGCCAT CT GCC ACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCA TTGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAAC ACCTT CGT GT CT GGCAACT GCGACGT CGT GAT CGGCATT GT GAACAAT ACCGT GTA CGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGATAAGTACTTT AAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCA GCGT CGT GAACAT CCAGAAAGAGAT CGACCGGCT GAACGAGGT GGCCAAGAAT CT GAACGAGAGCCTGATCGACCTGCAAGAACTGGGGAAGTACGAGCAGTACATCAAG TGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGG TCACAATCATGCTGTGTTGCATGACCAGCTGCTGTAGCTGCCTGAAGGGCTGTTGT AGCTGTGGCAGCTGCTGCAAGTTCGACGAGGACGATTCTGAGCCCGTGCTGAAG GGCGTGAAACTGCACTACACCTGAGCGGCCGC
- The S protein sequence reads as follows (SEQ ID NO 2): MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLI VNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFL MDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITR FQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDP LSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWN RKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPG QTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEI YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKK STNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDIT PCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTR AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPGSASSVASQSIIAYTMSLGAENSVA YSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRAL TGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVT LADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWT FGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTPSALG KLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQT YVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLH VTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFV SGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKE IDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCS
CLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
- The RBD nucleotide sequence described in the specification as SEQ ID NO 3 reads as follows (SEQ ID NO 3):
ATGGAAACCGACACACT GCTGCT GT GGGT GOT GCTTTTGT GGGT GCCAGGCAGCA CAGGCGATTACCCCGGGTCT AGATT CCCCAACAT CACCAAT CT GT GCCCCTT CGG CGAGGT GTT CAAT GCCACAAGATTT GCCAGCGT GTACGCCT GGAACCGGAAGAGA AT CAGCAACTGCGT GGCCGACTACAGCGT GOT GT ACAATAGCGCCAGCTT CAGCA CCTT CAAGT GCTACGGCGT GTCCCCTACCAAGCT GAACGACCT GT GCTT CACCAAT GT GTACGCCGACAGCTT CGT GAT CAGAGGCGACGAAGTT CGGCAGAT CGCTCCT G GACAGACAGGCAAGAT CGCCGATT ACAACTACAAGCT GCCCGACGACTT CACCGG CT GCGT GAT CGCCT GGAAT AGCAACAACCT GGACAGCAAAGT CGGCGGCAACTAC AACT ACCT GTACCGGCT GTT CCGGAAGT CCAACCT GAAGCCTTT CGAGCGGGACA TCAGCACCGAGATCTATCAGGCCGGCAGCACCCCTTGTAATGGCGTGGAAGGCTT CAACTGCTACTTCCCACTGCAGTCCTACGGCTTCCAGCCTACAAACGGCGTGGGC TACCAGCCTTATAGAGTGGTGGTGCTGAGCTTCGAACTGCTGCATGCCCCTGCTA CCGTGTGTGGCCCT AAG AAGT CCACCAACT GA
- The RBD protein sequence described in the specification as SEQ ID NO 4 reads as follows (SEQ ID NO 4):
METDTLLLWVLLLWVPGSTGDYPGSRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIA
DYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGS
TPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTN
- The E nucleotide sequence described in the specification as SEQ ID NO 5 reads as follows (SEQ ID NO 5):
ATGT ACAGCTT CGT GT CCGAGGAAACCGGCACACTGAT CGT GAACAGCGTGCTGC T GTT CCT GGCCTT CGTGGT GTT CCTGCT GGTTACCCT GGCTAT CCT GACAGCCCT G AGACT GT GCGCCT ACT GCTGCAACAT CGT GAACGT GT CCCT CGT GAAGCCCAGCT T CT ACGT GTACAGCAG AGT G AAG AACCT G AACTCC AGCAGGGTGCCCGACCT GCT GGTCTAA - The E protein sequence described in the specification as SEQ ID NO 6 reads as follows (SEQ ID NO 6):
MYSFVSEETGTLIVNSVLLFLAFWFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSR
VKNLNSSRVPDLLV
- The N nucleotide sequence described in the specification as SEQ ID NO 7 reads as follows (SEQ ID NO 7):
ATGAGCGACAACGGCCCTCAGAATCAGCGGAACGCCCCTAGAATCACATTTGGCG
GCCCTAGCGATAGCACCGGCAGCAATCAGAATGGCGAGAGAAGCGGCGCCAGAA
GCAAACAGAGAAGGCCTCAGGGCCTGCCTAACAACACCGCCTCTTGGTTTACAGC
CCTGACACAGCACGGCAAAGAGGACCTGAAGTTTCCTAGAGGCCAGGGCGTGCC
CATCAACACCAATAGCAGCCCTGATGACCAGATCGGCTACTACAGACGGGCCACC
AGAAGAATTAGAGGCGGCGACGGCAAGATGAAGGATCTGAGCCCCAGATGGTACT
TCTACTACCTCGGAACAGGACCCGAGGCCGGACTTCCTTATGGCGCCAACAAGGA
TGGCATCATCTGGGTTGCAACAGAAGGCGCCCTGAACACCCCTAAGGACCACATC
GGAACCAGAAAT CCCGCCAACAATGCCGCCATT GT GOT GCAGTT GCCACAGGGCA
CAACCCTGCCTAAGGGCTTTTATGCCGAGGGCTCTAGAGGCGGAAGCCAGGCCTC
TAGCAGAAGCAGCAGCAGAAGCCGGAACTCCAGCAGAAATAGCACCCCTGGAAG
CTCCAGAGGCACATCTCCTGCCAGAATGGCCGGAAATGGCGGAGATGCTGCTCTT
GCTCTGCTGCTCCTGGATCGGCTGAACCAGCTGGAAAGCAAGATGTCTGGAAAGG
GCCAGCAGCAACAGGGCCAGACCGTGACAAAAAAATCTGCCGCCGAGGCCAGCA
AGAAGCCCAGACAGAAGAGAACCGCCACCAAGGCCTACAACGTGACCCAGGCCTT
TGGAAGAAGAGGCCCAGAGCAGACCCAGGGCAATTTCGGCGATCAAGAGCTGAT
CAGACAGGGCACCGACTACAAGCACTGGCCTCAGATTGCCCAGTTTGCCCCTAGC
GCCT CCGCCTT CTTT GGCAT GTCT AGAAT CGGCAT GGAAGTGACCCCTAGCGGCA
CCTGGTTGACATACACAGGCGCCATCAAGCTGGACGACAAGGACCCCAACTTCAA
GGACCAAGT GAT CCT GOT GAACAAGCACAT CGACGCCTACAAGACATT CCCT CCA
ACCGAGCCTAAGAAGGACAAGAAGAAGAAGGCCGACGAGACACAGGCCCTGCCA
CAGAGACAGAAAAAACAGCAGACAGTGACCCTGCTGCCTGCCGCTGATCTGGACG
ATTTTTCCAAGCAGCTGCAGCAGTCCATGAGCAGCGCAGATAGCACACAGGCCTG
A - The N protein sequence described in the specification as SEQ ID NO 8 reads as follows (SEQ ID NO 8):
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTA LTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYY LGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGF YAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRL NQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQT QGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLD DKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAAD LDDFSKQLQQSMSSADSTQA
- The M nucleotide sequence described in the specification as SEQ ID NO 9 reads as follows (SEQ ID NO 9):
ATG G CCG AT AG C AAT G G C ACC AT C ACCGT G G AAG AACT G AAG AAACT G CTG G AAC AGTGGAACCT CGT GAT CGGCTT CCT GTT CCT GACCT GGAT CT GCCTGCT GCAGTT CGCCTACGCCAACCGGAACAGATT COT GT AT AT CAT CAAGCT GAT CTTT CT GTGGC TGCT GT GGCCCGTGACACT GGCCT GTTTT GT GOT GGCCGCCGT GTACAGAAT CAA CT GGAT CACCGGCGGAAT CGCCATTGCCAT GGCTT GT CTT GT GGGCCT GAT GTGG CTGAGCTACTTTATCGCCAGCTTCCGGCTGTTCGCCCGGACCAGATCCATGTGGT CCTT CAAT CCCGAGACAAACAT CCT GCT GAACGT GCCCCT GCACGGCACCATT CT GACAAGACCT CT GCTGGAAAGCGAGCT GGTT AT CGGCGCCGT GAT CCT GAGAGGA CACCTGAGAATTGCCGGCCACCACCTGGGCAGATGCGATATCAAGGACCTGCCTA AAGAAATCACAGTGGCCACCAGCAGAACCCTGTCCTACTATAAGCTGGGCGCCTC TCAGAGAGTGGCCGGCGATAGCGGATTTGCCGCCTACAGCAGATACCGGATCGG CAACT ACAAGCT GAACACCGACCACAGCT CCAGCAGCGACAAT AT CGCACT GCTG GTGCAGTGA
- The M protein sequence described in the specification as SEQ ID NO 10 reads as follows (SEQ ID NO 10): MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVT LACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLN VPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGA
SQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ
- The synthetic early/late promoter described in the specification as SEQ ID NO 21 and including a spacer sequence read as follows:
- 5' AAAATT G AAA TTTTA TTTTTTTTTTTT GGAA TA TAAA L4GCTAGCTCGAG 3'
- wherein the early motif is indicated in bold, the late motif is indicated in italics, and the underlined region represents the nucleotides shared by early and late motifs. - The synthetic early/late promoter without spacer sequence reads as follows (SEQ ID
NO 26):
5' AAAATT G AAA TTTTA TTTTTTTTTTTT G GAA TA TAAATA
- The Kozak sequence described in the specification as SEQ ID NO 22 read as follows: GCCACC - The full locus inserted in the MVA vector of the present invention read as follows (SEQ
ID NO: 23):
AAAATT GAAATTTT ATTTTTTTTTTTT GGAAT AT AAATAGCTAGCTCGAGGCCACC ATGTT CGT GTTT CT GGT GCTGCT GCCT CT GGT GT CCAGCCAGT GT GT GAACCTGAC CACCAGAACACAGCT GCCT CCAGCCT ACACCAACAGCTTT ACCAGAGGCGT GT AC TACCCCGACAAGGTGTTCAGATCCAGCGTGCTGCACTCTACCCAGGACCTGTTCC TGCCTTTCTTCAGCAACGTGACCTGGTTCCACGCCATCCACGTGTCCGGCACCAAT GGCACCAAGAGATTCGACAACCCCGTGCTGCCCTTCAACGACGGGGTGTACTTTG CCAGCACCGAGAAGT CCAACAT CAT CAGAGGCT GGATCTTCGGCACCACACT GGA CAGCAAGACCCAGAGCCTGCT GAT CGT GAACAACGCCACCAACGT GGT CAT CAAA GTGTGCGAGTTCCAGTTCTGCAACGACCCCTTCCTGGGCGTCTACTACCACAAGA ACAACAAGAGCTGGATGGAAAGCGAGTTCCGGGTGTACAGCAGCGCCAACAACTG CACCTTCGAGTACGTGTCCCAGCCTTTCCTGATGGACCTGGAAGGCAAGCAGGGC AACTT C AAG AACCT GCGCGAGTT CGTGTT CAAG AACAT CGACGGCT ACTT CAAG AT CTACAGCAAGCACACCCCTATCAACCTCGTGCGGGATCTGCCTCAGGGCTTCTCT GCTCTGGAACCCCTGGTGGATCTGCCCATCGGCATCAACATCACCCGGTTTCAGA CACTGCTGGCCCTGCACAGAAGCTACCTGACACCTGGCGATAGCAGCAGCGGAT GGACAGCTGGTGCCGCCGCTTACTATGTGGGCTACCTGCAGCCTAGAACCTTCCT GCT GAAGT ACAACGAGAACGGCACCAT CACCGACGCCGT GGATT GTGCT CT GGAT CCT CT GAGCGAGACAAAGT GCACCCT GAAGT CCTT CACCGT GGAAAAGGGCATCT ACCAGACCAGCAACTT CCGGGT GCAGCCCACCGAATCCAT CGT GCGGTT CCCCAA TATCACCAATCTGTGCCCCTTCGGCGAGGTGTTCAATGCCACCAGATTCGCCTCTG TGTACGCCTGGAACCGGAAGCGGATCAGCAATTGCGTGGCCGACTACTCCGTGCT GT ACAACT CCGCCAGCTT CAGCACCTT CAAGT GCTACGGCGT GT CCCCTACCAAG CT GAACGACCT GT GCTT CACAAACGT GTACGCCGACAGCTT CGT GAT CCGGGGAG ATGAAGTGCGGCAGATTGCCCCTGGACAGACAGGCAAGATCGCCGACTACAACTA CAAGCT GCCCGACGACTT CACCGGCT GT GT GATT GCCT GGAACAGCAACAACCT G GACTCCAAAGT CGGCGGCAACTACAATTACCT GT ACCGGCT GTT CCGGAAGT CCA ATCTGAAGCCCTTCGAGCGGGACATCTCCACCGAGATCTATCAGGCCGGCAGCAC CCCTTGTAACGGCGTGGAAGGCTTCAACTGCTACTTCCCACTGCAGTCCTACGGC TTTCAGCCCACAAATGGCGTGGGCTATCAGCCCTACAGAGTGGTGGTGCTGAGCT TCGAACTGCTGCATGCCCCTGCCACAGTGTGCGGCCCTAAGAAAAGCACCAATCT CGT GAAGAACAAAT GCGT GAACTT CAACTT CAACGGCCT GACCGGCACCGGCGT G CT GACAGAGAGCAACAAGAAGTT CCT GCCATT CCAGCAGTTT GGCCGGGATAT CG CCGATACCACAGACGCCGTTAGAGATCCCCAGACACTGGAAATCCTGGACATCAC CCCTT GCAGCTT CGGCGGAGTGT CTGT GAT CACCCCT GGCACCAACACCAGCAAT CAGGTGGCAGT GCT GTACCAGGACGT GAACT GTACCGAAGT GCCCGT GGCCATT C ACGCCGATCAGCTGACACCTACATGGCGGGTGTACTCCACCGGCAGCAATGTGTT TCAGACCAGAGCCGGCTGTCTGATCGGAGCCGAGCACGTGAACAATAGCTACGAG TGCGACATCCCCATCGGCGCTGGCATCTGTGCCAGCTACCAGACACAGACAAACA GCCCCGGGAGTGCAAGTTCTGTGGCCAGCCAGAGCATCATTGCCTACACAATGTC T CT GGGCGCCGAGAACAGCGT GGCCTACT CCAACAACT CTAT CGCT AT CCCCACC AACTT CACCAT CAGCGTGACCACAGAGAT CCT GCCT GT GT CCAT GACCAAGACCA GCGT GGACT GCACCAT GTACAT CTGCGGCGATT CCACCGAGTGCT CCAACCTGCT GCTGCAGTACGGCAGCTTCTGCACCCAGCTGAATAGAGCCCTGACAGGGATCGCC GTGGAACAGGACAAGAACACCCAAGAGGTGTTCGCCCAAGTGAAGCAGATCTACA AGACCCCTCCTATCAAGGACTTCGGCGGCTTCAATTTCAGCCAGATTCTGCCCGAT CCTAGCAAGCCCAGCAAGCGGAGCTT CAT CGAGGACCT GCT GTT CAACAAAGT GA CACTGGCCGACGCCGGCTTCATCAAGCAGTATGGCGATTGTCTGGGCGACATTGC CGCCAGGGATCT GATTTGCGCCCAGAAGTTT AACGGACT GACAGT GCTGCCTCCT CT GCT GACCGAT GAGAT GAT CGCCCAGT ACACAT CT GCCCT GCT GGCCGGCACAA T CACAAGCGGCT GGACATTT GGAGCT GGCGCCGCT CT GCAGATCCCCTTT GCT AT GCAGATGGCCTACCGGTTCAACGGCATCGGAGTGACCCAGAATGTGCTGTACGAG AACCAGAAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACA GCCT GAGCAGCACACCAAGCGCCCT GGGAAAGCT GCAGGACGT GGT CAACCAGA ATGCCCAGGCACT GAACACCCT GGT CAAGCAGCT GT CCT CCAACTT CGGCGCCAT CAGCT CT GT GCT GAACGATATCCT GAGCAGACT GGACCCACCTGAAGCCGAGGT G CAGATCGACAGACTGATCACCGGAAGGCTGCAGTCCCTGCAGACCTACGTTACCC AGCAGCTGATCAGAGCCGCCGAGATTAGAGCCTCTGCCAATCTGGCCGCCACCAA GATGTCTGAGTGTGTGCTGGGCCAGAGCAAGAGAGTGGACTTTTGCGGCAAGGG CT ACCACCT GAT GAGCTT CCCT CAGT CTGCCCCT CACGGCGT GGT GTTT CT GCAC GT GACAT ACGT GCCCGCT CAAGAGAAGAATTT CACCACCGCT CCAGCCAT CT GCC ACGACGGCAAAGCCCACTTTCCTAGAGAAGGCGTGTTCGTGTCCAACGGCACCCA TTGGTTCGTGACCCAGCGGAACTTCTACGAGCCCCAGATCATCACCACCGACAAC ACCTT CGTGTCT GGCAACT GCG ACGT CGT GAT CGGCATT GT G AACAAT ACCGTGT A CGACCCTCTGCAGCCCGAGCTGGACAGCTTCAAAGAGGAACTGGATAAGTACTTT AAGAACCACACAAGCCCCGACGTGGACCTGGGCGATATCAGCGGAATCAATGCCA GCGT CGT GAACAT CCAGAAAGAGAT CGACCGGCT GAACGAGGT GGCCAAGAAT CT GAACGAGAGCCT GAT CGACCT GCAAGAACT GGGGAAGT ACGAGCAGTACAT CAAG TGGCCCTGGTACATCTGGCTGGGCTTTATCGCCGGACTGATTGCCATCGTGATGG T CACAAT CAT GCT GT GTT GCAT GACCAGCT GCT GTAGCT GCCT GAAGGGCT GTT GT AGCTGT GGCAGCT GCT GCAAGTT CGACGAGGACGATT CT GAGCCCGTGCT GAAG GGCGTGAAACTGCACTACACCTGAGCGGCCGC
- The nucleotide sequence of the E3L gene of MVA (MVA050L) described in the specification as SEQ ID NO 24 reads as follows (SEQ ID NO 24):
ATGTCT AAGAT CT AT ATT G ACG AGCGTT CT G ACGCAG AG ATT GTGTGTGCGGCTAT T AAAAACATT GGAAT CGAAGGAGCTACTGCT GCACAACT AACT AGACAACTT AAT AT GG AGAAGCG AG AAGTT AAT AAAGCT CT GT ACG AT CTT C AACGT AGT GCTATGGT GT ACAGCT CCGACGAT ATT CCT CCT CGTT GGTTT ATGACAACGGAGGCGGAT AAGCC GGATGCTGATGTTATGGCTGACGCCATAATAGATGATGTATCCCGCGAAAAATCAA T G AG AG AGGAT CAT AAGT CTTTT GAT GAT GTT ATTCCGGCT AAAAAAATT ATT GATT G G AAAG AT GOT AACCCT GT C ACC ATT ATT AAT G AGT ACT G CC AAAT AACT AAG AG A GATT GGT CTTTTCGTATT G AAT CAGT GGGGCCT AGT AACT CT CCT AC ATTTT ATGCC T GTGTAGATAT CGACGGAAGAGTATT CGATAAGGCAGATGGAAAAT CTAAACGAGA T GCTAAAAAT AAT GCAGCT AAATT GGCAGT AGAT AAACTT CTTGGTTACGT CAT CAT TAGATTCTGA
- The MVA E3 protein sequence described in the specification as SEQ ID NO 25 reads as follows (SEQ ID NO 25):
MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSD
DIPPRWFMTTEADKPDADVMADAIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPV TIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLA
VDKLLGYVilRF

Claims

1 A vaccine composition comprising an immunologically effective amount of a modified vaccinia virus Ankara (MVA) vector comprising at least one nucleic acid sequence encoding the full-length spike (S) protein, of at least one SARS-CoV-2 variant or linage, wherein said S protein comprises at least the substitutions R682G, R683S, R685S, A942P, K986P and V987P as defined using the amino acid numbering of the reference Wuhan S protein PDB ID 6VSB, wherein said at least one nucleic acid is inserted into the thymidine kinase (TK) locus of the MVA genome and is operably linked to the synthetic early/late promoter of Vaccinia Virus (VACV), and wherein the MVA vector regulates the expression of the nucleic acid encoding the S protein.
2. The vaccine composition according to claim 1 , wherein the synthetic early/late promoter comprises SEQ ID NO: 21.
3. The vaccine composition according to any of claims 1 or 2, wherein the full-length S protein encoded by the MVA vector comprises SEQ ID NO: 2, or a sequence with at least 90% sequence identity with SEQ ID NO: 2.
4. The vaccine composition according to any of claims 1 to 3, wherein the synthetic early/late promoter consists of SEQ ID NO: 21 and wherein the full-length S protein encoded by the MVA vector consists of SEQ ID NO:
5. The vaccine composition according to any of claims 1 to 4, wherein the nucleic acid comprised in the MVA vector comprises SEQ ID NO: 1 , or a sequence with at least 90% sequence identity with SEQ ID NO: 1.
6. The vaccine composition according to any of claims 1 to 5, wherein the nucleic acid comprised in the MVA vector comprises SEQ ID NO: 23, or a sequence with at least 90% sequence identity with SEQ ID NO: 23.
7. The vaccine composition according to claim 6, wherein the nucleic acid comprised in the MVA vector consists of SEQ ID NO: 23.
8. The vaccine composition according to any of claims 1 to 7, wherein the nucleic acid comprised in the MVA vector further encodes for one or more antigenic proteins selected from the group consisting of structural proteins Envelope, receptor-binding domain, Nucleocapsid or Membrane, or any combination thereof, from at least one SARS-CoV-2 variant or linage.
9. The vaccine composition according to claims 1 to 8, wherein at least one SARS-CoV-2 variant or linage is selected from the group consisting of Wuhan-Hu-1 seafood market pneumonia virus isolate GenBank accession number: MN908947, Linage B.1.1.28, Linage B.1.351 , Linage B.1.427, Linage B.1.429, Linage B.1.617, Linage B.1.1.7, Linage B.1.1.529, or any combination thereof.
10. The vaccine composition according to any of claims 1 to 9, wherein the vaccine further comprises one or more pharmaceutically acceptable carriers, additives, antibiotics, preservatives, adjuvants, diluents and/or stabilizers.
11. A vaccine combination comprising: i. a first composition comprising an immunologically effective amount of a MVA vector as defined in any claims 1 to 10; and ii. a second composition comprising an immunologically effective amount of a MVA vector as defined in any of claims 1 to 10; wherein one of the compositions is a priming composition and the other composition is a boosting composition.
12. A vaccine combination comprising: i. a first composition comprising an immunologically effective amount of a MVA vector as defined in any of claims 1 to 10; and ii. a second composition comprising an immunologically effective amount of at least one immunogen derived from at least one SARS-CoV-2 variant or linage; wherein one of the compositions is a priming composition and the other composition is a boosting composition.
13. The vaccine combination according to claim 12, wherein the at least one immunogen derived from at least one SARS-CoV-2 variant or linage is selected from the group consisting of viral vectors, recombinant proteins or polypeptides, nucleic acids, virus-like particles, nanoparticles, or any combination thereof.
14. The vaccine composition according to any of claims 1 to 10, for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant or linage, wherein said composition is used for priming and/or for boosting said immune response, and wherein the MVA is capable of producing said S protein, or fragment thereof, in the subject to be treated.
15. The vaccine combination according to any of claims 11 to 13, for use in generating an immunogenic and/or protective immune response in a subject in need thereof, preferably in a human subject, wherein said immune response is against at least the S protein, or a fragment of said S protein, comprising the substitutions R682G, R683S, R685S, A942P, K986P and V987P and derived from at least one SARS-CoV-2 variant or linage, and wherein said combination is capable of producing said S protein, or fragment thereof, in the subject to be treated.
16. The vaccine composition according to any o claims 1 to 10, or the vaccine combination according to any of claims 11 to 13, for use in generating a protective immune response in a subject in need thereof, preferably in a human subject, wherein said protective immune response is against the S protein of at least one of the SARS-CoV-2 variant or linage selected from the group consisting of Wuhan strain GenBank accession number MN908947, Wuhan strain D614G mutant, linage B.1.1.7, linage B.1.351 , linage P.1 , linage B.1.167.2, linage B.1.1.529, and/or any combination thereof.
17. The vaccine composition for use according to any of claims 14 to 16, wherein the MVA vector/s of the vaccine composition/s is/are to be administered once, twice, three or more times.
18. The vaccine composition or combination for use according to any of claims 14 to 17, wherein said composition or combination is administered via the intramuscular or intranasal route.
19. The vaccine composition or combination for use according to any of claims 14 to 18, wherein said composition or combination are administered as a boosting composition at least 2 weeks after administering a priming composition.
20. The vaccine composition or combination for use according to any of claims 14 to 19, wherein said composition or combination are administered as a boosting composition 2-12 weeks, preferably 2, 3 or 4 weeks, after administering the priming composition.
21. A kit comprising one, two, or more doses of the vaccine composition as defined in any of claims 1 to 10, or the vaccine combination as defined in any of claims 11 to 13.
EP22737464.2A 2021-06-23 2022-06-23 Mva-based vaccine expressing a prefusion-stabilized sars-cov-2 s protein Pending EP4358999A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP21382557.3A EP4108257A1 (en) 2021-06-23 2021-06-23 Mva-based vaccine against covid-19 expressing a prefusion-stabilized sars-cov-2 s protein
EP21383245 2021-12-31
PCT/EP2022/067271 WO2022269003A1 (en) 2021-06-23 2022-06-23 MVA-BASED VACCINE EXPRESSING A PREFUSION-STABILIZED SARS-CoV-2 S PROTEIN

Publications (1)

Publication Number Publication Date
EP4358999A1 true EP4358999A1 (en) 2024-05-01

Family

ID=82385493

Family Applications (1)

Application Number Title Priority Date Filing Date
EP22737464.2A Pending EP4358999A1 (en) 2021-06-23 2022-06-23 Mva-based vaccine expressing a prefusion-stabilized sars-cov-2 s protein

Country Status (2)

Country Link
EP (1) EP4358999A1 (en)
WO (1) WO2022269003A1 (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114517205A (en) * 2020-11-20 2022-05-20 北京震旦鼎泰生物科技有限公司 Fusion gene, recombinant novel coronavirus efficient immune tripod molecular DNA vaccine, and construction method and application thereof
WO2024238911A1 (en) * 2023-05-17 2024-11-21 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Recombinant murine pneumonia virus expressing severe acute respiratory syndrome coronavirus 2 (sars-cov-2) spike protein

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BE787901A (en) 1971-09-11 1972-12-18 Freistaat Bayern Represente Pa ANTIVARIOLIC VACCINE
US5747324A (en) 1988-06-10 1998-05-05 Therion Biologics Corporation Self-assembled, defective, non-self-propagating lentivirus particles
UA68327C2 (en) 1995-07-04 2004-08-16 Gsf Forschungszentrum Fur Unwe A recombinant mva virus, an isolated eukaryotic cell, infected with recombinant mva virus, a method for production in vitro of polypeptides with use of said cell, a method for production in vitro of virus parts (variants), vaccine containing the recombinant mva virus, a method for immunization of animals
GB0023203D0 (en) 2000-09-21 2000-11-01 Isis Innovation Vaccination method
CN101676389A (en) 2000-11-23 2010-03-24 巴法里安诺迪克有限公司 Modified vaccinia ankara virus variant
DE10144664B4 (en) 2001-09-11 2005-06-09 GSF-Forschungszentrum für Umwelt und Gesundheit GmbH Vaccinia virus MVA-E3L knockout mutants and use thereof
AU2002356690B2 (en) 2001-12-04 2008-07-24 Bavarian Nordic A/S Flavivirus NS1 subunit vaccine
DE602004015418D1 (en) 2003-02-18 2008-09-11 Helmholtz Zentrum Muenchen RECOMBINANT MVA AND METHOD FOR THE PRODUCTION THEREOF
US8394385B2 (en) 2009-03-13 2013-03-12 Bavarian Nordic A/S Optimized early-late promoter combined with repeated vaccination favors cytotoxic T cell response against recombinant antigen in MVA vaccines
AU2011209175B2 (en) 2010-01-28 2016-02-04 Bavarian Nordic A/S Vaccinia virus mutants containing the major genomic deletions of MVA
WO2014162031A1 (en) 2013-04-02 2014-10-09 Consejo Superior De Investigaciones Científicas (Csic) Recombinant vectors based on the modified vaccinia ankara virus (mva) as preventive and therapeutic vaccines against hepatitis c
WO2016086980A1 (en) 2014-12-02 2016-06-09 Consejo Superior De Investigaciones Cientificas Vaccine composition
US10906944B2 (en) * 2020-06-29 2021-02-02 The Scripps Research Institute Stabilized coronavirus spike (S) protein immunogens and related vaccines

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
P�REZ PATRICIA ET AL: "A Single Dose of an MVA Vaccine Expressing a Prefusion-Stabilized SARS-CoV-2 Spike Protein Neutralizes Variants of Concern and Protects Mice From a Lethal SARS-CoV-2 Infection", FRONTIERS IN IMMUNOLOGY, vol. 12, 27 January 2022 (2022-01-27), Lausanne, CH, XP093265742, ISSN: 1664-3224, DOI: 10.3389/fimmu.2021.824728 *

Also Published As

Publication number Publication date
WO2022269003A1 (en) 2022-12-29

Similar Documents

Publication Publication Date Title
JP7113924B2 (en) Recombinant Modified Vaccinia Virus Ankara (MVA) Filovirus Vaccine
US20230021583A1 (en) Measles-vectored covid-19 immunogenic compositions and vaccines
US12584146B2 (en) Synthetic modified vaccinia Ankara (SMVA) based coronavirus vaccines
EP2627774B1 (en) Recombinant modified vaccinia virus ankara (mva) influenza vaccine
US20240123053A1 (en) Coronavirus vaccine through nasal immunization
WO2022269003A1 (en) MVA-BASED VACCINE EXPRESSING A PREFUSION-STABILIZED SARS-CoV-2 S PROTEIN
WO2021250219A1 (en) A recombinant modified vaccinia virus ankara (mva) vaccine against coronavirus disease
Russell et al. Single immunization of a vaccine vectored by a novel recombinant vaccinia virus affords effective protection against respiratory syncytial virus infection in cotton rats
WO2014041082A1 (en) Influenza virus
Ma et al. A vesicular stomatitis virus-based African swine fever vaccine prototype effectively induced robust immune responses in mice following a single-dose immunization
Kwak et al. Recombinant measles virus encoding the spike protein of SARS-CoV-2 efficiently induces Th1 responses and neutralizing antibodies that block SARS-CoV-2 variants
EP3928789A1 (en) Mva-based vaccine against covid-19 expressing sars-cov-2 antigens
US20250235527A1 (en) Synthetic modified vaccinia ankara (smva) based coronavirus vaccines
WO2021260065A1 (en) Mva-based vaccine against covid-19 expressing sars-cov-2 antigens
EP4108257A1 (en) Mva-based vaccine against covid-19 expressing a prefusion-stabilized sars-cov-2 s protein
EP4316514A1 (en) Mva-based vectors and their use as vaccine against sars-cov-2
George et al. Distinct humoral and cellular immunity induced by alternating prime-boost vaccination using plasmid DNA and live viral vector vaccines expressing the E protein of dengue virus type 2
García-Arriaza et al. MVA-based vaccine against COVID-19 expressing SARS-CoV-2 antigens
Dong et al. Recombinant vaccinia vectored ASFV vaccine enhances swine survival against genotype II challenge
US20250325657A1 (en) Modified vaccinia ankara (mva) vaccine
US20230233666A1 (en) SYNTHETIC MODIFIED VACCINIA ANKARA (sMVA) BASED CORONAVIRUS VACCINES
DK2627774T3 (en) INFLUENZAVACCINE BASED ON RECOMBINANT MODIFIED VACCINIAVIRUS ANKARA (VAT)
TW202334434A (en) Poxviral-based vaccine against severe acute respiratory syndrome coronavirus 2 and methods using the same
CA3009928C (en) Recombinant modified vaccinia virus ankara (mva) equine encephalitis virus vaccine

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20240123

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20250408