EP4319818A1 - Formulations of l-asparaginase - Google Patents
Formulations of l-asparaginaseInfo
- Publication number
- EP4319818A1 EP4319818A1 EP22724215.3A EP22724215A EP4319818A1 EP 4319818 A1 EP4319818 A1 EP 4319818A1 EP 22724215 A EP22724215 A EP 22724215A EP 4319818 A1 EP4319818 A1 EP 4319818A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- formulation
- asparaginase
- administered
- present disclosure
- amount
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 532
- 238000009472 formulation Methods 0.000 title claims abstract description 524
- 108010024976 Asparaginase Proteins 0.000 title claims abstract description 454
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 title claims abstract description 380
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 52
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 claims abstract description 48
- 238000000034 method Methods 0.000 claims abstract description 48
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims abstract description 36
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims abstract description 35
- 201000011649 lymphoblastic lymphoma Diseases 0.000 claims abstract description 33
- 201000010099 disease Diseases 0.000 claims abstract description 31
- 229960001230 asparagine Drugs 0.000 claims abstract description 28
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims abstract description 26
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims abstract description 22
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 22
- 235000009582 asparagine Nutrition 0.000 claims abstract description 22
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 88
- 239000000872 buffer Substances 0.000 claims description 84
- 239000000178 monomer Substances 0.000 claims description 65
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 claims description 61
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 claims description 61
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 claims description 61
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 56
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 claims description 51
- 150000002016 disaccharides Chemical class 0.000 claims description 47
- 238000003860 storage Methods 0.000 claims description 47
- 239000011780 sodium chloride Substances 0.000 claims description 43
- 229940024606 amino acid Drugs 0.000 claims description 40
- 235000001014 amino acid Nutrition 0.000 claims description 40
- 150000001413 amino acids Chemical group 0.000 claims description 40
- 239000001488 sodium phosphate Substances 0.000 claims description 37
- 229910000162 sodium phosphate Inorganic materials 0.000 claims description 37
- 235000011008 sodium phosphates Nutrition 0.000 claims description 37
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 claims description 37
- 229920000053 polysorbate 80 Polymers 0.000 claims description 30
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 claims description 29
- 229940068968 polysorbate 80 Drugs 0.000 claims description 29
- 239000003381 stabilizer Substances 0.000 claims description 22
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 claims description 20
- 229930006000 Sucrose Natural products 0.000 claims description 20
- 239000005720 sucrose Substances 0.000 claims description 20
- 239000008363 phosphate buffer Substances 0.000 claims description 19
- 235000010356 sorbitol Nutrition 0.000 claims description 17
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 claims description 15
- 201000011510 cancer Diseases 0.000 claims description 15
- 239000012931 lyophilized formulation Substances 0.000 claims description 15
- 239000008351 acetate buffer Substances 0.000 claims description 11
- 229920001213 Polysorbate 20 Polymers 0.000 claims description 7
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 claims description 7
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 claims description 7
- 239000002552 dosage form Substances 0.000 claims description 6
- 229940068977 polysorbate 20 Drugs 0.000 claims description 6
- 239000002246 antineoplastic agent Substances 0.000 claims description 5
- 229940127089 cytotoxic agent Drugs 0.000 claims description 5
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 claims description 4
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical group [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 claims description 4
- 229920001993 poloxamer 188 Polymers 0.000 claims description 4
- 229940044519 poloxamer 188 Drugs 0.000 claims description 4
- BBMHARZCALWXSL-UHFFFAOYSA-M sodium dihydrogenphosphate monohydrate Chemical compound O.[Na+].OP(O)([O-])=O BBMHARZCALWXSL-UHFFFAOYSA-M 0.000 claims description 2
- 238000011282 treatment Methods 0.000 abstract description 23
- 208000035475 disorder Diseases 0.000 abstract description 17
- 102000015790 Asparaginase Human genes 0.000 description 74
- 230000000694 effects Effects 0.000 description 33
- 125000003275 alpha amino acid group Chemical group 0.000 description 27
- 235000018102 proteins Nutrition 0.000 description 24
- 102000004169 proteins and genes Human genes 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 24
- 108090000765 processed proteins & peptides Proteins 0.000 description 21
- 230000035882 stress Effects 0.000 description 21
- 229960003272 asparaginase Drugs 0.000 description 19
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 19
- 150000003839 salts Chemical class 0.000 description 19
- 241000588724 Escherichia coli Species 0.000 description 16
- 230000002378 acidificating effect Effects 0.000 description 16
- 102000004196 processed proteins & peptides Human genes 0.000 description 16
- 229910019142 PO4 Inorganic materials 0.000 description 15
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 15
- 238000001542 size-exclusion chromatography Methods 0.000 description 15
- 238000001195 ultra high performance liquid chromatography Methods 0.000 description 15
- 239000000463 material Substances 0.000 description 14
- 230000008646 thermal stress Effects 0.000 description 14
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 13
- 206010020751 Hypersensitivity Diseases 0.000 description 13
- 238000013019 agitation Methods 0.000 description 13
- 239000010452 phosphate Substances 0.000 description 13
- 238000012506 imaged capillary isoelectric focusing Methods 0.000 description 12
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 11
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 11
- 238000007254 oxidation reaction Methods 0.000 description 11
- 239000000600 sorbitol Substances 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 10
- 238000009826 distribution Methods 0.000 description 10
- 239000012634 fragment Substances 0.000 description 10
- 230000003647 oxidation Effects 0.000 description 10
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 9
- 238000000502 dialysis Methods 0.000 description 9
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 9
- 230000004048 modification Effects 0.000 description 9
- 238000012986 modification Methods 0.000 description 9
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 8
- 239000004094 surface-active agent Substances 0.000 description 8
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- 208000026935 allergic disease Diseases 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 229940088598 enzyme Drugs 0.000 description 7
- 238000000569 multi-angle light scattering Methods 0.000 description 7
- 239000008194 pharmaceutical composition Substances 0.000 description 7
- 229920001223 polyethylene glycol Polymers 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- -1 Tris) Chemical compound 0.000 description 6
- 230000000973 chemotherapeutic effect Effects 0.000 description 6
- 238000013400 design of experiment Methods 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 230000036252 glycation Effects 0.000 description 6
- 230000009610 hypersensitivity Effects 0.000 description 6
- 238000004255 ion exchange chromatography Methods 0.000 description 6
- 108010001564 pegaspargase Proteins 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 230000004481 post-translational protein modification Effects 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 241000894007 species Species 0.000 description 6
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 5
- 241000588700 Dickeya chrysanthemi Species 0.000 description 5
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 5
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 5
- 230000006240 deamidation Effects 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 230000010494 opalescence Effects 0.000 description 5
- 238000005457 optimization Methods 0.000 description 5
- 238000012510 peptide mapping method Methods 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 4
- 206010006187 Breast cancer Diseases 0.000 description 4
- 206010009944 Colon cancer Diseases 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 239000007983 Tris buffer Substances 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- 229910052783 alkali metal Inorganic materials 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 108010033937 calaspargase pegol Proteins 0.000 description 4
- 210000004027 cell Anatomy 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000011156 evaluation Methods 0.000 description 4
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 4
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 4
- 239000008215 water for injection Substances 0.000 description 4
- QXLQZLBNPTZMRK-UHFFFAOYSA-N 2-[(dimethylamino)methyl]-1-(2,4-dimethylphenyl)prop-2-en-1-one Chemical compound CN(C)CC(=C)C(=O)C1=CC=C(C)C=C1C QXLQZLBNPTZMRK-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 3
- 102100023927 Asparagine synthetase [glutamine-hydrolyzing] Human genes 0.000 description 3
- 108010070255 Aspartate-ammonia ligase Proteins 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- 241000589540 Pseudomonas fluorescens Species 0.000 description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 3
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 3
- 150000001340 alkali metals Chemical class 0.000 description 3
- 229910021529 ammonia Inorganic materials 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 229940044683 chemotherapy drug Drugs 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 239000012537 formulation buffer Substances 0.000 description 3
- 208000005017 glioblastoma Diseases 0.000 description 3
- 229960001031 glucose Drugs 0.000 description 3
- 239000013628 high molecular weight specie Substances 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 239000013627 low molecular weight specie Substances 0.000 description 3
- 108091005573 modified proteins Proteins 0.000 description 3
- 102000035118 modified proteins Human genes 0.000 description 3
- 238000011395 multi-agent chemotherapy Methods 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 229960001744 pegaspargase Drugs 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 239000001632 sodium acetate Substances 0.000 description 3
- 235000017281 sodium acetate Nutrition 0.000 description 3
- 239000008174 sterile solution Substances 0.000 description 3
- 229960002317 succinimide Drugs 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 3
- 208000030507 AIDS Diseases 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 238000012490 Cation-exchange liquid chromatography method Methods 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000588698 Erwinia Species 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241000588701 Pectobacterium carotovorum Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 101710180958 Putative aminoacrylate hydrolase RutD Proteins 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 208000030961 allergic reaction Diseases 0.000 description 2
- 238000012863 analytical testing Methods 0.000 description 2
- 208000003455 anaphylaxis Diseases 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 229940102797 asparaginase erwinia chrysanthemi Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 229960001334 corticosteroids Drugs 0.000 description 2
- 229950006799 crisantaspase Drugs 0.000 description 2
- HCAJEUSONLESMK-UHFFFAOYSA-N cyclohexylsulfamic acid Chemical compound OS(=O)(=O)NC1CCCCC1 HCAJEUSONLESMK-UHFFFAOYSA-N 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000000779 depleting effect Effects 0.000 description 2
- 229960003957 dexamethasone Drugs 0.000 description 2
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 2
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 230000005684 electric field Effects 0.000 description 2
- 229940051398 erwinaze Drugs 0.000 description 2
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 2
- 238000012495 forced degradation study Methods 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 208000014951 hematologic disease Diseases 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 230000036210 malignancy Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- IZXGZAJMDLJLMF-UHFFFAOYSA-N methylaminomethanol Chemical compound CNCO IZXGZAJMDLJLMF-UHFFFAOYSA-N 0.000 description 2
- 230000011987 methylation Effects 0.000 description 2
- 238000007069 methylation reaction Methods 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 229940045641 monobasic sodium phosphate Drugs 0.000 description 2
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 2
- 235000019799 monosodium phosphate Nutrition 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 229940099216 oncaspar Drugs 0.000 description 2
- 230000008650 pH stress Effects 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 229960005205 prednisolone Drugs 0.000 description 2
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 2
- 229960004618 prednisone Drugs 0.000 description 2
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 201000001514 prostate carcinoma Diseases 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- AAWZDTNXLSGCEK-LNVDRNJUSA-N (3r,5r)-1,3,4,5-tetrahydroxycyclohexane-1-carboxylic acid Chemical compound O[C@@H]1CC(O)(C(O)=O)C[C@@H](O)C1O AAWZDTNXLSGCEK-LNVDRNJUSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 206010000871 Acute monocytic leukaemia Diseases 0.000 description 1
- 206010000890 Acute myelomonocytic leukaemia Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 208000036832 Adenocarcinoma of ovary Diseases 0.000 description 1
- 206010001197 Adenocarcinoma of the cervix Diseases 0.000 description 1
- 208000034246 Adenocarcinoma of the cervix uteri Diseases 0.000 description 1
- 206010052747 Adenocarcinoma pancreas Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 206010002199 Anaphylactic shock Diseases 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 206010005064 Bladder papilloma Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 208000029147 Collagen-vascular disease Diseases 0.000 description 1
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- AAWZDTNXLSGCEK-UHFFFAOYSA-N Cordycepinsaeure Natural products OC1CC(O)(C(O)=O)CC(O)C1O AAWZDTNXLSGCEK-UHFFFAOYSA-N 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 101000703368 Escherichia coli (strain K12) L-asparaginase 2 Proteins 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 206010019755 Hepatitis chronic active Diseases 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000021605 Large-Cell Immunoblastic Lymphoma Diseases 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 208000035489 Monocytic Acute Leukemia Diseases 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 208000033835 Myelomonocytic Acute Leukemia Diseases 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 208000008900 Pancreatic Ductal Carcinoma Diseases 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 206010056332 Panencephalitis Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 201000011152 Pemphigus Diseases 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 208000009052 Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 208000033826 Promyelocytic Acute Leukemia Diseases 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- AAWZDTNXLSGCEK-ZHQZDSKASA-N Quinic acid Natural products O[C@H]1CC(O)(C(O)=O)C[C@H](O)C1O AAWZDTNXLSGCEK-ZHQZDSKASA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101000703403 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) L-asparaginase 2-1 Proteins 0.000 description 1
- 101000703404 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) L-asparaginase 2-2 Proteins 0.000 description 1
- 101000901050 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) L-asparaginase 2-3 Proteins 0.000 description 1
- 101000901051 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) L-asparaginase 2-4 Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 159000000021 acetate salts Chemical class 0.000 description 1
- 235000011054 acetic acid Nutrition 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 201000011186 acute T cell leukemia Diseases 0.000 description 1
- 208000011912 acute myelomonocytic leukemia M4 Diseases 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 150000003973 alkyl amines Chemical class 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 230000036783 anaphylactic response Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000013011 aqueous formulation Substances 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-N benzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-N 0.000 description 1
- 229940092714 benzenesulfonic acid Drugs 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 206010005084 bladder transitional cell carcinoma Diseases 0.000 description 1
- 201000011177 bladder transitional cell papilloma Diseases 0.000 description 1
- 201000001528 bladder urothelial carcinoma Diseases 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 201000008274 breast adenocarcinoma Diseases 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 208000014581 breast ductal adenocarcinoma Diseases 0.000 description 1
- 201000010983 breast ductal carcinoma Diseases 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 239000003560 cancer drug Substances 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 201000006662 cervical adenocarcinoma Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 208000018805 childhood acute lymphoblastic leukemia Diseases 0.000 description 1
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 1
- 229960002023 chloroprocaine Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 201000010897 colon adenocarcinoma Diseases 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 235000008504 concentrate Nutrition 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 238000007596 consolidation process Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229940119744 dextran 40 Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 229940043237 diethanolamine Drugs 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 229940012017 ethylenediamine Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 238000013401 experimental design Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000008642 heat stress Effects 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 206010073095 invasive ductal breast carcinoma Diseases 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 201000009546 lung large cell carcinoma Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 208000025036 lymphosarcoma Diseases 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229940098779 methanesulfonic acid Drugs 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 150000004682 monohydrates Chemical class 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- LNOPIUAQISRISI-UHFFFAOYSA-N n'-hydroxy-2-propan-2-ylsulfonylethanimidamide Chemical compound CC(C)S(=O)(=O)CC(N)=NO LNOPIUAQISRISI-UHFFFAOYSA-N 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 208000013371 ovarian adenocarcinoma Diseases 0.000 description 1
- 201000006588 ovary adenocarcinoma Diseases 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 201000002094 pancreatic adenocarcinoma Diseases 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 201000008129 pancreatic ductal adenocarcinoma Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 201000001976 pemphigus vulgaris Diseases 0.000 description 1
- 235000019371 penicillin G benzathine Nutrition 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000013441 quality evaluation Methods 0.000 description 1
- ZHNFLHYOFXQIOW-LPYZJUEESA-N quinine sulfate dihydrate Chemical compound [H+].[H+].O.O.[O-]S([O-])(=O)=O.C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@@H]2[C@H](O)C1=CC=NC2=CC=C(OC)C=C21.C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@@H]2[C@H](O)C1=CC=NC2=CC=C(OC)C=C21 ZHNFLHYOFXQIOW-LPYZJUEESA-N 0.000 description 1
- 239000006215 rectal suppository Substances 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 201000006845 reticulosarcoma Diseases 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000009094 second-line therapy Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- IIACRCGMVDHOTQ-UHFFFAOYSA-M sulfamate Chemical compound NS([O-])(=O)=O IIACRCGMVDHOTQ-UHFFFAOYSA-M 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 238000013385 tryptic peptide mapping Methods 0.000 description 1
- 230000001875 tumorinhibitory effect Effects 0.000 description 1
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 208000012477 urothelial papilloma Diseases 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 239000006216 vaginal suppository Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- LQBVNQSMGBZMKD-UHFFFAOYSA-N venetoclax Chemical compound C=1C=C(Cl)C=CC=1C=1CC(C)(C)CCC=1CN(CC1)CCN1C(C=C1OC=2C=C3C=CNC3=NC=2)=CC=C1C(=O)NS(=O)(=O)C(C=C1[N+]([O-])=O)=CC=C1NCC1CCOCC1 LQBVNQSMGBZMKD-UHFFFAOYSA-N 0.000 description 1
- 229960001183 venetoclax Drugs 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/50—Hydrolases (3) acting on carbon-nitrogen bonds, other than peptide bonds (3.5), e.g. asparaginase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
- A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/08—Solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/01—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in linear amides (3.5.1)
- C12Y305/01001—Asparaginase (3.5.1.1)
Definitions
- L- asparaginases Proteins with L-asparagine aminohydrolase activity, commonly known as L- asparaginases, have successfully been used for the treatment of various diseases that are potentially fatal, including cancers such as Acute Lymphoblastic Leukemia (ALL) and Lymphoblastic Lymphoma (LBL), for which children constitute a large proportion of patients stricken with these diseases.
- ALL Acute Lymphoblastic Leukemia
- LBL Lymphoblastic Lymphoma
- L-asparaginases of bacterial origin have a high immunogenic and antigenic potential.
- E. coli derived L-asparaginase and pegaspargase are E. coli derived L-asparaginase and pegaspargase. These products can provoke adverse hypersensitivity reactions including allergic reaction, silent inactivation, and anaphylactic shock in patients.
- Erwinaze® has been plagued by supply issues for years: reportedly, it can take 9 months to prepare (See, e.g., “Saving Ava: When a cancer drug shortage imperiled a toddler, her mom got to work”, Stat News, Karen Weintraub (Oct. 31, 2016); Asparaginase Erwinia Chrysanthemi Drug Shortage, Drugs.com). Even today the issues persist and Erwinase® shortages are common.
- coli-derived asparaginase would address a significant medical need (as a component of a multi-agent chemotherapeutic regimen) for patients with ALL/Lymphoblastic Lymphoma (LBL), by helping to ensure availability of an asparaginase for patients who have developed hypersensitivity to E.coli-derived asparaginase.
- LBL ALL/Lymphoblastic Lymphoma
- Erwinase® is supplied as a sterile, lyophilized, white powder in vials. Each vial contains 10,000 International Units of asparaginase Erwinia chrysanthemi, and the following inactive ingredients: glucose monohydrate (5.0 mg), sodium chloride (0.5 mg).
- non-lyophilized formulations removes the need for rehydration before administration to a subject, e.g., a human.
- Oncaspar® an alternative, non- lyophilized treatment option, is supplied as a clear, colorless, preservative-free, isotonic sterile solution in phosphate-buffered saline, pH 7.3.
- Each milliliter contains 750 ⁇ 150 International Units of pegaspargase, dibasic sodium phosphate, USP (5.58 mg), monobasic sodium phosphate, USP, (1.20 mg) and sodium chloride, USP (8.50 mg) in water for injection, USP.
- ASPARLAS® another non-lyophilized alternative, is supplied as a clear, colorless, preservative-free, isotonic sterile solution in phosphate-buffered saline, pH 7.3, that requires dilution prior to intravenous infusion.
- Each vial of ASPARLAS® contains 3,750 units in 5 mL of solution.
- Each milliliter contains 750 units of calaspargase pegol-mknl; dibasic sodium phosphate, USP (5.58 mg); monobasic sodium phosphate, USP (1.20 mg); and sodium chloride, USP (8.50 mg) in water for injection, USP.
- non-lyophilized formulations such as Oncaspar® and ASPARLAS®
- stability for example, the existing formulations must be used within 48 hours if stored at room temperature.
- such formulations may find use in the treatment of one or more diseases, disorders, or conditions treatable by asparagine depletion, including, for example, cancers such as Acute Lymphoblastic Leukemia (ALL) and Lymphoblastic Lymphoma (LBL), including relapsed ALL and relapsed LBL.
- ALL Acute Lymphoblastic Leukemia
- LBL Lymphoblastic Lymphoma
- aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1; and (ii) one or more stabilizers, or one or more buffers, or any combination thereof.
- the one or more stabilizers comprise one or more disaccharides, one or more sorbitols, one or more amino acids, or any combination thereof.
- the one or more disaccharides comprise trehalose, sucrose, or any combination thereof.
- the one or more disaccharides comprise trehalose.
- the one or more buffers are substantially free of amino acid.
- the one or more buffers comprise a phosphate buffer, an acetate buffer, or any combination thereof.
- the one or more buffers comprise a phosphate buffer.
- the one or more buffers comprise sodium phosphate.
- the sodium phosphate is sodium phosphate dibasic anhydrous, sodium phosphate monobasic monohydrate, or a combination thereof.
- the formulation further comprises sodium chloride.
- the formulation further comprises one or more excipients.
- the one or more excipients comprise polysorbate 80, polysorbate 20, poloxamer 188, or any combination thereof.
- the formulation has a pH of between about 4.0 and about 8.5.
- the L-asparaginase is present at a concentration of about 20 mg/mL. In some embodiments, the L-asparaginase is non-PEGylated and non-PASylated.
- the formulation comprises less than about 0.6% low- molecular-weight (LMW) species after storage at 40 °C for two months. In some embodiments, the formulation comprises less than about 0.6% low-molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than 2% high-molecular-weight (HMW) species after storage at 40 °C for two months.
- LMW low- molecular-weight
- HMW high-molecular-weight
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; and (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- provided herein is a method of treating a disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof, comprising administering to the subject any of the formulations described herein.
- a unit dosage form comprising: (i) any of the formulations described herein; and (ii) one or more pharmaceutically acceptable excipients.
- a kit comprising: (i) any of the formulations described herein; and (ii) instructions for treating a disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof.
- Subject refers to mammals, and includes humans and non-human mammals. Examples of individuals include, but are not limited to mice, rats, hamsters, guinea pigs, pigs, rabbits, cats, dogs, goats, sheep, cows, and humans. In some embodiments, subject refers to a human.
- the articles “a” and “an” as used herein and in the appended claims are used to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article unless the context clearly indicates otherwise.
- a buffer means one buffer or more than one buffer.
- a parameter or value includes and describes that parameter or value per se.
- “about X” includes and describes X per se.
- the term “about” modifying, for example, the dimensions, volumes, quantity of an ingredient in a composition, concentrations, process temperature, process time, yields, flow rates, pressures, and like values, and ranges thereof, refers to variation in the numerical quantity that can occur, for example, through typical measuring and handling procedures used for making compounds, compositions, concentrates or use formulations; through inadvertent error in these procedures; through differences in the manufacture, source, or purity of starting materials or ingredients used to carry out the methods; and like considerations.
- the term “about” also encompasses amounts that differ due to aging of, for example, a composition, formulation, or cell culture with a particular initial concentration or mixture, and amounts that differ due to mixing or processing a composition or formulation with a particular initial concentration or mixture. Whether modified by the term “about” the claims appended hereto include equivalents to these quantities.
- the term “about” further may refer to a range of values that are similar to the stated reference value. In certain embodiments, the term “about” refers to a range of values that fall within 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 percent or less of the stated reference value.
- the terms “treatable by depletion of asparagine” and “treatable by asparagine depletion” refers to a disease, condition, or disorder wherein the cells involved in or responsible for the disease, condition, or disorder either lack or have a reduced ability to synthesize L-asparagine. Depletion or deprivation of L-asparagine can be partial or substantially complete (e.g., to levels that are undetectable using methods and apparatus that arc known in the art). [0020]
- the term “comprising the sequence of SEQ ID NO: 1” means that the amino-acid sequence of the protein may not be strictly limited to SEQ ID NO: I but may contain additional amino acids.
- LMW species refers to species that have a molecular weight that is lower than that of L-asparaginase.
- the LMW species have a molecular weight that is less than about 100%, less than about 90%, less than about 80%, less than about 70%, less than about 60%, less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 2%, or less than about 1% of the molecular weight of L- asparaginase.
- LMW species are formed by the degradation or decomposition of L-asparaginase, e.g., through hydrolysis of one or more covalent bonds in the L-asparaginase.
- “High-molecular-weight species” or “HMW species”, as used herein, refers to species that have a molecular weight that is greater than that of L-asparaginase.
- the HMW species have a molecular weight that is greater than about 100%, greater than about 150%, greater than about 200%, greater than about 250%, greater than about 300%, greater than about 350%, greater than about 400%, greater than about 450%, or greater than about 500% of the molecular weight of L-asparaginase.
- Tehalose refers to a disaccharide having the following structure: .
- Sucrose refers to a disaccharide having the following structure: .
- Polysorbate 80 or “PS-80” refers to an excipient having the following structure: .
- PEGylated is used to describe a structure or moiety to which PEG (polyethylene glycol) is conjugated or attached. Any suitable number of PEG units may be attached in any suitable way (e.g., through one or more covalent bonds) and at any suitable location of the structure or moiety in question.
- a “PEGylated L- asparaginase” indicates an L-asparaginase to which one or more PEG units have been conjugated or attached.
- a “non-PEGylated” moiety is one to which PEG has not been conjugated or attached.
- PASylation is used to describe a structure or moiety to which one or more polypeptide units comprising proline, alanine, or serine, or any combination thereof, is conjugated attached. Any suitable number of such polypeptide units may be attached in any suitable way (e.g., through one or more covalent bonds) and at any suitable location of the structure or moiety in question.
- a “PASylated L- asparaginase” indicates an L-asparaginase to which one or more polypeptide units comprising proline, alanine, or serine, or any combination thereof, have been conjugated or attached.
- a “non-PASylated” moiety is one to which one or more polypeptide units comprising proline, alanine, or serine, or any combination thereof, has not been conjugated or attached.
- “SEQ ID NO: 1” is as follows: ADKLPNIVILATGGTIAGSAATGTQTTGYKAGALGVDTLINAVPEVKKLANVKGEQF SNMASENMTGDVVLKLSQRVNELLARDDVDGVVITHGTDTVEESAYFLHLTVKSD KPVVFVAAMRPATAISADGPMNLLEAVRVAGDKQSRGRGVMVVLNDRIGSARYIT KTNASTLDTFKANEEGYLGVIIGNRIYYQNRIDKLHTTRSVFDVRGLTSLPKVDILYG YQDDPEYLYDAAIQHGVKGIVYAGMGAGSVSVRGIAGMRKAMEKGVVVIRSTRTG NGIVPPDEELPGLVSDSLNPAHARILLMLALTRTSDPKVIQEYFHT
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1; and (ii) one or more stabilizers, or one or more buffers, or any combination thereof.
- the L-asparaginase formulation comprises one or more stabilizers.
- the one or more stabilizers comprise one or more disaccharides, one or more sorbitols, one or more amino acids, or any combination thereof.
- the L-asparaginase formulation comprises one or more disaccharides. In some embodiments, the one or more disaccharides comprise trehalose, sucrose, or any combination thereof. In some embodiments, the L-asparaginase formulation comprises one or more buffers. In some embodiments, the one or more buffers, wherein the one or more buffers are substantially free of amino acid. In some embodiments, the L-asparaginase formulation comprises one or more stabilizers and one or more buffers. In some embodiments, the L-asparaginase formulation comprises less than about 0.6% low- molecular-weight (LMW) species after storage at 40 °C for two months.
- LMW low- molecular-weight
- the L-asparaginase formulation comprises less than 2% high-molecular-weight (HMW) species after storage at 40 °C for two months. In some embodiments, the L- asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species and less than 2% high-molecular-weight (HMW) species after storage at 40 °C for two months. In some embodiments, the L-asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- HMW high-molecular-weight
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; and (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- a L-asparaginase in accordance with the disclosure provided herein is an recombinant L-asparaginase.
- a L-asparaginase in accordance with the invention described herein is an enzyme with L-asparagine aminohydrolase activity.
- Such a L-asparaginase’s enzymatic activity may include not only deamidation of asparagine to aspartic acid and ammonia, but also deamidation of glutamine to glutamic acid and ammonia.
- a L-asparaginase as disclosed herein is active as a multimer.
- the L-asparaginase is an active enzyme as a tetramer.
- a tetramer is composed of four subunits (also known as monomers).
- a L-asparaginase is a tetramer consisting of four identical 35 kD subunits.
- the L-asparaginase is a non-disulfide bonded tetrameric therapeutic protein.
- each of the subunits or monomers of a multimeric L-asparaginase comprises the amino acid sequence of SEQ ID NO: 1.
- each of the subunits or monomers of a tetrameric Lasparaginase comprises the amino acid sequence of SEQ ID NO: 1.
- the L-asparaginase is from Erwinia chrysanthemi NCPPB 1066 (Genbank Accession No. CAA32884, incorporated herein by reference in its entirety), either with or without signal peptides and/or leader sequences.
- the L-asparaginase is composed of multiple subunits, for example, four subunits or monomers (tetramer).
- a corresponding modified protein may then, e.g., consist of 1 to 20 (or more) peptides conjugated to each of the monomers of that tetramer.
- the L-asparaginase comprises a monomer and 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 (or more) peptides conjugated to each of the L-asparaginase monomers.
- the L- asparaginase is a multimer comprising multiple subunits or monomers, such as a tetramer, and each of the monomers in that tetramer is conjugated to 1 peptide, resulting in a tetramer comprising 4 conjugated peptides, one for each monomer.
- the L- asparaginase is a tetramer comprising 1-4 peptides conjugated to each of the monomers.
- the L-asparaginase is a tetramer comprising 4-20 peptides conjugated to each of the L- monomers.
- the Lasparaginase is a tetramer comprising 6-18 peptides conjugated to each of the monomers.
- the L-asparaginase is a tetramer comprising 6-18 peptides conjugated to each of the monomers.
- the L-asparaginase is a tetramer comprising 10-15 peptides conjugated to each of the monomers.
- the invention relates to a modified protein having a L- asparaginase and multiple chemically attached peptide sequences.
- the length of the peptide sequences are from about 10 to about 100, from about 15 to about 60 or from about 20 to about 40.
- fragments of L-asparaginase may be of use in the presently described invention.
- the term “a fragment of L-asparaginase” (e.g., a fragment of the L-asparaginase of SEQ ID NO: 1) means that the sequence of the L-asparaginase may include fewer amino-acids than in the L-asparaginases exemplified herein (e.g., the L-asparaginase of SEQ ID NO: 1) but still enough amino-acids to confer L-aminohydrolase activity.
- a “fragment of L-asparaginase” is a fragment that is/consists of at least about 150 or 200 contiguous amino acids of one of the L- asparaginases exemplified herein (e.g. the L-asparaginase of SEQ ID NO: 1) (for example, about 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 321, 322, 323, 324, 325, or 326 contiguous amino acids) and/or wherein said fragment has up to 50 amino acids deleted from the N-terminus of said L-asparaginases exemplified herein (e.g.
- the L-asparaginase of SEQ ID NO: 1) e.g. up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, or 50
- has up to up to 75 or 100 amino acids deleted from the C- terminus of said L-asparaginases exemplified herein e.g., the Lasparaginase of SEQ ID NO: 1
- the Lasparaginase of SEQ ID NO: 1 e.g.
- L-asparaginases up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 70, 75, 80, 85, 90, 95 or 100
- L-asparaginases exemplified herein (e.g., the L-asparaginase of SEQ ID NO: 1), wherein the total number of amino acids deleted can be up to 125 or 150 amino acids.
- a Nessler assay is used for the determination of L-asparaginase activity according to a method described by Mashburn and Wriston (Mashburn, L., and Wriston, J. (1963) “Tumor Inhibitory Effect ofLAsparaginase,” Biochem Biophys Res Commun 12, 50, incorporated herein by reference in its entirety).
- Mashburn and Wriston a method described by Mashburn and Wriston
- a polypeptide can be modified by substitution, insertion, deletion and/or addition of one or more amino-acids while retaining its enzymatic activity.
- the term "one or more amino acids” in this context can refer to one, two, three, four, five, six, seven, eight, nine, ten or more amino acids.
- substitutions may be defined as exchanges within one of the following groups: Small aliphatic, non-polar or slightly polar residues: Ala, Ser, Thr, Pro, Gly; Polar, negatively charged residues and their amides: Asp, Asn, Glu, Gln; Polar, positively charged residues: His, Arg, Lys; Large aliphatic, non-polar residues: Met, Leu, Ile, Val, Cys; Large aromatic residues: Phe, Tyr, Trp.
- the sequences of the catalytic sites ofL-asparaginases are highly conserved between Erwinia chrysanthemi, Erwinia carotovora, and E. coli L-asparaginase II (Id).
- the active site flexible loop contains amino acid residues 14-33, and structural analysis show that Thrl5, Thr95, Ser62, Glu63, Asp96, and Alal20 contact the ligand (Id).
- Aghaipour et al. have conducted a detailed analysis of the four active sites of Erwinia chrysanthemi L-asparaginase by examining high resolution crystal structures of the enzyme complexed with its substrates (Aghaipour (2001) Biochemistry 40, 5655-5664).
- Kotzia et al. provide sequences for L-asparaginases from several species and subspecies of Erwinia and, even though the proteins have only about 75- 77% identity between Erwinia chrysanthemi and Erwinia carotovora, they each still have L- asparaginase activity (Kotzia (2007) J. Biotechnol. 127, 657-669).
- Moola et al performed epitope mapping studies of Erwinia chrysanthemi 3937 L-asparaginase and were able to retain enzyme activity even after mutating various antigenic sequences in an attempt to reduce immunogenicity of the asparaginase (Moola (1994) Biochem. J. 302, 921-927).
- fragments of the protein of SEQ ID NO: 1 are also comprised within the definition of the protein used in the L-asparaginase of the invention.
- the term “a fragment of SEQ ID NO: l” means that the sequence of the polypeptide may include fewer amino-acids than the full-length SEQ ID NO: 1 but retains enough of the protein to confer Laminohydrolase activity.
- a L-asparaginase has at least about 80% homology or identity with the protein comprising SEQ ID NO: 1.
- the L-asparaginase of the formulation comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1. In some embodiments, each monomer unit has an amino acid sequences that is at least about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, or about 84% identical to SEQ ID NO: 1.
- each monomer unit has an amino acid sequences that is at least about 85%, about 86%, about 87%, about 88%, about 89%, about 90% about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to SEQ ID NO: 1.
- the L-asparaginase of the formulation is present at a concentration of about 20 mg/mL.
- the L-asparaginase of the formulation is non- PEGylated. In some embodiments, the L-asparaginase of the formulation is non-PASylated.
- the L-asparaginase of the formulation is non-PEGylated and non- PASylated.
- the L-asparaginase formulation comprises one or more stabilizers.
- the one or more stabilizers comprise one or more disaccharides, one or more sorbitols, one or more amino acids, or any combination thereof.
- the L- asparaginase formulation comprises one or more buffers.
- the one or more buffers comprise acetate, glutamate, citrate, histidine, succinate, phosphate, hydroxymethylaminomethane (e.g., Tris), or any combination thererof.
- the L-asparaginase formulation comprises one or more surfactants.
- the one or more surfactants comprise polysorbate 80 (e.g.,Tween 80), polysorbate 20 (e.g.,Tween 20), poloxamer 188, or any combination thereof.
- the L-asparaginase formulation comprises one or more polyol (e.g., mannitol and sorbitol), one or more disaccharides (e.g., sucrose and trehalose), and one or more polysaccharides (e.g., dextran 40).
- the L-asparaginase formulation comprises sodium chloride.
- the L-asparaginase formulation comprises one or more amino acids (e.g., proline, glycine, and arginie).
- the formulation comprises one or more stabilizers at a concentration of between about 50 mM and about 300 mM. In some embodiments, the formulation comprises one or more stabilizers at a concentration of between about 75 mM and about 300 mM, between about 100 mM and about 300 mM, between about 125 mM and about 300 mM, between about 150 mM and about 300 mM, between about 175 mM and about 300 mM, between about 200 mM and about 300 mM, between about 225 mM and about 300 mM, between about 250 mM and about 300 mM, or between about 275 mM and about 300 mM.
- the formulation comprises one or more stabilizers at a concentration of between about 50 mM and about 275 mM, between about 50 mM and about 250 mM, between about 50 mM and about 225 mM, between about 50 mM and about 200 mM, between about 50 mM and about 175 mM, between about 50 mM and about 150 mM, between about 50 mM and about 125 mM, between about 50 mM and about 100 mM, or between about 50 mM and about 75 mM. In some embodiments, the formulation comprises one or more stabilizers at a concentration of between about 150 mM and about 275 mM.
- the formulation comprises one or more stabilizers at a concentration of between about 150 mM and about 200 mM, between about 150 mM and about 190 mM, between about 150 mM and about 180 mM, between 150 mM and about 170 mM, or between about 160 mM and 150 mM. In some embodiments, the formulation comprises one or more stabilizers at a concentration of between about 160 mM and about 200 mM, between about 170 mM and about 200 mM, between about 180 mM and about 200 mM, or between about 190 mM and about 200 mM. In some embodiments, the formulation comprises one or more stabilizers at a concentration of about 170 mM.
- the one or more disaccharides of the formulation comprise trehalose. In other embodiments, the one or more disaccharides of the formulation comprise sucrose. In some embodiments, the one or more disaccharides of the formulation comprise a combination of trehalose and sucrose. [0050] In some embodiments, the formulation comprises one or more disaccharides at a concentration of between about 50 mM and about 300 mM.
- the formulation comprises one or more disaccharides at a concentration of between about 75 mM and about 300 mM, between about 100 mM and about 300 mM, between about 125 mM and about 300 mM, between about 150 mM and about 300 mM, between about 175 mM and about 300 mM, between about 200 mM and about 300 mM, between about 225 mM and about 300 mM, between about 250 mM and about 300 mM, or between about 275 mM and about 300 mM.
- the formulation comprises one or more disaccharides at a concentration of between about 50 mM and about 275 mM, between about 50 mM and about 250 mM, between about 50 mM and about 225 mM, between about 50 mM and about 200 mM, between about 50 mM and about 175 mM, between about 50 mM and about 150 mM, between about 50 mM and about 125 mM, between about 50 mM and about 100 mM, or between about 50 mM and about 75 mM. In some embodiments, the formulation comprises one or more disaccharides at a concentration of between about 150 mM and about 275 mM.
- the formulation comprises one or more disaccharides at a concentration of between about 150 mM and about 200 mM, between about 150 mM and about 190 mM, between about 150 mM and about 180 mM, between 150 mM and about 170 mM, or between about 160 mM and 150 mM. In some embodiments, the formulation comprises one or more disaccharides at a concentration of between about 160 mM and about 200 mM, between about 170 mM and about 200 mM, between about 180 mM and about 200 mM, or between about 190 mM and about 200 mM. In some embodiments, the formulation comprises one or more disaccharides at a concentration of about 170 mM.
- the formulation comprises trehalose at a concentration of between about 50 mM and about 300 mM.
- the formulation comprises one or more disaccharides at a concentration of between about 75 mM and about 300 mM, between about 100 mM and about 300 mM, between about 125 mM and about 300 mM, between about 150 mM and about 300 mM, between about 175 mM and about 300 mM, between about 200 mM and about 300 mM, between about 225 mM and about 300 mM, between about 250 mM and about 300 mM, or between about 275 mM and about 300 mM.
- the formulation comprises trehalose at a concentration of between about 50 mM and about 275 mM, between about 50 mM and about 250 mM, between about 50 mM and about 225 mM, between about 50 mM and about 200 mM, between about 50 mM and about 175 mM, between about 50 mM and about 150 mM, between about 50 mM and about 125 mM, between about 50 mM and about 100 mM, or between about 50 mM and about 75 mM. In some embodiments, the formulation comprises trehalose at a concentration of between about 150 mM and about 275 mM.
- the formulation comprises trehalose at a concentration of between about 150 mM and about 200 mM, between about 150 mM and about 190 mM, between about 150 mM and about 180 mM, between 150 mM and about 170 mM, or between about 160 mM and 150 mM. In some embodiments, the formulation comprises trehalose at a concentration of between about 160 mM and about 200 mM, between about 170 mM and about 200 mM, between about 180 mM and about 200 mM, or between about 190 mM and about 200 mM. In some embodiments, the formulation comprises trehalose at a concentration of about 170 mM.
- the one or more buffers of the formulation are substantially free of amino acid. In some embodiments, the one or more buffers of the formulation are substantially free of histidine or arginine, or both. In some embodiments, the one or more buffers of the formulation are substantially free of histidine. In some embodiments, the one or more buffers of the formulation comprise a phosphate buffer, an acetate buffer, or any combination thereof. In some embodiments, the one or more buffers comprise a phosphate buffer. In some embodiments, the one or more buffers comprise an acetate buffer. In some embodiments, the one or more buffers comprise a combination of a phosphate buffer and an acetate buffer.
- the one or more buffers comprise an acetate salt of an alkali metal. In some embodiments, the one or more buffers comprise a phosphate salt of an alkali metal. In some embodiments, the one or more buffers comprise sodium phosphate. [0053] In some embodiments, formulation comprises one or more buffers at a concentration of between about 0.5 mM and between about 50 mM.
- formulation comprises one or more buffers at a concentration of between about 1 mM and about 50 mM, between about 2.5 mM and about 50 mM, between about 5 mM and about 50 mM, between about 10 mM and about 50 mM, between about 15 mM and about 50 mM, between about 20 mM and about 50 mM, between about 25 mM and about 50 mM, between about 30 mM and about 50 mM, between about 35 mM and about 50 mM, between about 40 mM and about 50 mM, or between about 45 mM and about 50 mM.
- formulation comprises one or more buffers at a concentration of between about 0.5 mM and about 45 mM, between about 0.5 mM and about 40 mM, between about 0.5 mM and about 35 mM, between about 0.5 mM and about 30 mM, between about 0.5 mM and 25 mM, between about 0.5 mM and about 20 mM, between about 0.5 mM and about 15 mM, between about 0.5 mM and about 10 mM, between about 0.5 mM and about 5 mM, between about 0.5 M and about 2.5 mM, or between 0.5 mM and about 1 mM.
- formulation comprises one or more buffers at a concentration of between about 10 mM and about 30 mM. In some embodiments, formulation comprises one or more buffers at a concentration of between about 15 mM and about 25 mM. In some embodiments, formulation comprises one or more buffers at a concentration of about 20 mM. [0054] In some embodiments, the formulation comprises sodium phosphate at a concentration of between about 0.5 mM and between about 50 mM.
- the formulation comprises sodium phosphate at a concentration of between about 1 mM and about 50 mM, between about 2.5 mM and about 50 mM, between about 5 mM and about 50 mM, between about 10 mM and about 50 mM, between about 15 mM and about 50 mM, between about 20 mM and about 50 mM, between about 25 mM and about 50 mM, between about 30 mM and about 50 mM, between about 35 mM and about 50 mM, between about 40 mM and about 50 mM, or between about 45 mM and about 50 mM.
- the formulation comprises sodium phosphate at a concentration of between about 0.5 mM and about 45 mM, between about 0.5 mM and about 40 mM, between about 0.5 mM and about 35 mM, between about 0.5 mM and about 30 mM, between about 0.5 mM and 25 mM, between about 0.5 mM and about 20 mM, between about 0.5 mM and about 15 mM, between about 0.5 mM and about 10 mM, between about 0.5 mM and about 5 mM, between about 0.5 M and about 2.5 mM, or between 0.5 mM and about 1 mM.
- the formulation comprises sodium phosphate at a concentration of between about 10 mM and about 30 mM. In some embodiments, the formulation comprises sodium phosphate at a concentration of between about 15 mM and about 25 mM. In some embodiments, the formulation comprises sodium phosphate at a concentration of about 20 mM. [0055] In some embodiments, the formulation further comprises an alkali metal salt. In some embodiments, the formulation further comprises a halide salt. In some embodiments, the formulation further comprises a halide salt of an alkali metal. In some embodiments, the formulation further comprises sodium chloride. In some embodiments, the formulation further comprises sodium chloride at a concentration of between about 25 mM and about 150 mM.
- the formulation further comprises sodium chloride at a concentration of between about 30 mM and about 150 mM, between about 40 mM and about 150 mM, between about 50 mM and about 150 mM, between about 60 mM and about 150 mM, between about 70 mM and about 150 mM, between about 80 mM and about 150 mM, between about 90 mM and about 150 mM, between about 100 mM and about 150 mM, between about 110 mM and about 150 mM, between about 120 mM and about 150 mM, between about 130 mM and about 150 mM, or between about 140 mM and about 150 mM.
- the formulation comprises sodium chloride at a concentration of between about 25 mM and about 140 mM, between about 25 mM and 130 mM, between about 25 mM and about 120 mM, between about 25 mM and about 110 mM, between about 25 mM and about 100 mM, between about 25 mM and about 90 mM, between about 25 mM and about 80 mM, between about 25 mM and about 70 mM, between about 25 mM and about 60 mM, between about 25 mM and about 50 mM, between about 25 mM and about 40 mM, or between about 25 mM and 30 mM.
- the formulation comprises sodium chloride at a concentration of between about 30 mM and about 70 mM. In some embodiments, the formulation comprises sodium chloride at a concentration of between about 40 mM and about 60 mM. In some embodiments, the formulation comprises sodium chloride at a concentration of about 50 mM. [0056] In some embodiments, the formulation further comprises one or more excipients. In some embodiments, the one or more excipients comprise one or more surfactants. In some embodiments, the one or more excipients comprise one or more emulsifiers. In some embodiments, the one or more excipients are derived from sorbitan.
- the one or more excipients comprise polysorbate 80 (also known as PS- 80). In some embodiments, the one or more excipients comprise polysorbate 20. In some embodiments, the one or more excipients comprise a combination of polysorbate 80 and polysorbate 20. [0057] In some embodiments, the formulation comprises one or more excipients at a concentration of no more than about 0.3% (w/v). In some embodiments, the formulation comprises one or more excipients at a concentration of no more than about 0.28% (w/v). In some embodiments, the formulation comprises one or more excipients at a concentration of no more than about 0.26% (w/v).
- the formulation comprises one or more excipients at a concentration of no more than about 0.24% (w/v). In some embodiments, the formulation comprises one or more excipients at a concentration of no more than about 0.22% (w/v). In some embodiments, the formulation further comprises one or more excipients at a concentration of between about 0.004% (w/v) and about 0.3% (w/v). In some embodiments, the formulation further comprises one or more excipients at a concentration of between about 0.01% (w/v) and about 0.3% (w/v). [0058] In some embodiments, the formulation further comprises one or more excipients at a concentration of between about 0.004% (w/v) and about 0.2% (w/v).
- the formulation further comprises one or more excipients at a concentration of between about 0.004% (w/v) and about 0.18% (w/v), between about 0.004% (w/v) and about 0.16% (w/v), between about 0.004% (w/v) and about 0.14% (w/v), between about 0.004% (w/v) and about 0.12% (w/v), between about 0.004% (w/v) and about 0.1% (w/v), between about 0.004% (w/v) and about 0.08% (w/v), between about 0.004% (w/v) and about 0.06% (w/v), between about 0.004% (w/v) and about 0.04% (w/v), between about 0.004% (w/v) and about 0.03%, between about 0.004% (w/v) and about 0.025% (w/v), between about 0.004% (w/v) and about 0.02% (w/v), between about 0.004% (w/v) and about 0.015% (w/v),
- the formulation further comprises one or more excipients at a concentration of between about 0.01% (w/v) and about 0.2% (w/v), between about 0.015% (w/v) and about 0.2% (w/v), between about 0.02% (w/v) and about 0.2% (w/v), between about 0.025% (w/v) and about 0.2% (w/v), between about 0.03% (w/v) and about 0.2% (w/v), between about 0.04% (w/v) and about 0.2% (w/v), between about 0.05% (w/v) and about 0.2% (w/v), between about 0.06% (w/v) and about 0.2% (w/v), between about 0.07% (w/v) and about 0.2% (w/v), between about 0.08% (w/v) and about 0.2% (w/v), between about 0.09% (w/v) and about 0.2% (w/v), between about 0.1% (w/v) and about 0.2% (w/v), between about 0.12% (w/v/v),
- the formulation further comprises one or more excipients at a concentration of between about 0.01% (w/v) and about 0.03% (w/v). In some embodiments, the formulation further comprises one or more excipients at a concentration of between about 0.015% (w/v) and about 0.025% (w/v). In some embodiments, the formulation further comprises one or more excipients at a concentration of about 0.02% (w/v). [0059] In some embodiments, the formulation further comprises polysorbate 80 at a concentration of between about 0.004% (w/v) and about 0.2% (w/v).
- the formulation further comprises polysorbate 80 at a concentration of between about 0.004% (w/v) and about 0.18% (w/v), between about 0.004% (w/v) and about 0.16% (w/v), between about 0.004% (w/v) and about 0.14% (w/v), between about 0.004% (w/v) and about 0.12% (w/v), between about 0.004% (w/v) and about 0.1% (w/v), between about 0.004% (w/v) and about 0.08% (w/v), between about 0.004% (w/v) and about 0.06% (w/v), between about 0.004% (w/v) and about 0.04% (w/v), between about 0.004% (w/v) and about 0.03%, between about 0.004% (w/v) and about 0.025% (w/v), between about 0.004% (w/v) and about 0.02% (w/v), between about 0.004% (w/v) and about 0.015% (w/v), or between about
- the formulation further comprises polysorbate 80 at a concentration of between about 0.01% (w/v) and about 0.2% (w/v), between about 0.015% (w/v) and about 0.2% (w/v), between about 0.02% (w/v) and about 0.2% (w/v), between about 0.025% (w/v) and about 0.2% (w/v), between about 0.03% (w/v) and about 0.2% (w/v), between about 0.04% (w/v) and about 0.2% (w/v), between about 0.05% (w/v) and about 0.2% (w/v), between about 0.06% (w/v) and about 0.2% (w/v), between about 0.07% (w/v) and about 0.2% (w/v), between about 0.08% (w/v) and about 0.2% (w/v), between about 0.09% (w/v) and about 0.2% (w/v), between about 0.1% (w/v) and about 0.2% (w/v), between about 0.12% (w/v) and
- the formulation further comprises polysorbate 80 at a concentration of between about 0.01% (w/v) and about 0.03% (w/v). In some embodiments, the formulation further comprises polysorbate 80 at a concentration of between about 0.015% (w/v) and about 0.025% (w/v). In some embodiments, the formulation further comprises polysorbate 80 at a concentration of about 0.02% (w/v). [0060] In some embodiments, the formulation provided herein has a pH of between about 4.0 and about 8.5.
- the formulation has a pH of between about 4.5 and about 8.5, between about 5.0 and about 8.5, between about 5.5 and about 8.5, between about 6.0 and about 8.5, between about 6.5 and about 8.5, between about 7.0 and about 8.5, between about 7.5 and about 8.5, or between about 8.0 and about 8.5. In some embodiments, the formulation has a pH of between about 4.5 and about 8.0, between about 4.5 and about 7.5, between about 4.5 and about 7.0, between about 4.5 and about 6.5, between about 4.5 and about 6.0, between about 4.5 and about 5.5, or between about 4.5 and about 5.0.
- the formulation provided herein has a pH of between about 4.0 and about 8.0, between about 4.0 and about 7.5, between about 4.0 and about 7.0, between about 4.0 and about 6.5, between about 4.0 and about 6.0, between about 4.0 and about 5.5, between about 4.0 and about 5.0, or between about 4.0 and about 4.5. In some embodiments, the formulation provided herein has a pH of between about 5.5 and about 8.5. In some embodiments, the formulation provided herein has a pH of between about 6.0 and about 8.0. In some embodiments, the formulation provided herein has a pH of between 6.5 and about 7.5. In some embodiments, the formulation provided herein has a pH of around 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L- asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1; and (ii) one or more stabilizers, or one or more buffers, or any combination thereof.
- the L-asparaginase formulation comprises one or more stabilizers.
- the one or more stabilizers comprise one or more disaccharides, one or more sorbitols, one or more amino acids, or any combination thereof.
- the L-asparaginase formulation comprises one or more disaccharides. In some embodiments, the one or more disaccharides comprise trehalose, sucrose, or any combination thereof. In some embodiments, the L-sparaginase formulation comprises one or more buffers. In some embodiments, the one or more buffers, wherein the one or more buffers are substantially free of amino acid. In some embodiments, the L-asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species after storage at 40 °C for two months. In some embodiments, the L-asparaginase formulation comprises less than 2% high-molecular- weight (HMW) species after storage at 40 °C for two months.
- LMW low-molecular-weight
- HMW high-molecular- weight
- the L- asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species and less than 2% high-molecular-weight (HMW) species after storage at 40 °C for two months. In some embodiments, the L-asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1, and is present at a concentration of around 20 mg/mL; (ii) one or more stabilizers (e.g., disaccharides, sorbitols, amino acids, or any combination thereof) at a concentration between about 50 mM and about 300 mM; (iii) one or more buffers (e.g., acetate, glutamate, citrate, histidine, succinate, phosphate, hydroxymethylaminomethane, or combination thereof) at a concentration of between about 0.5 mM and about 50 mM; (iv) sodium chloride, wherein the sodium chloride is present at a concentration of between about 25 mM and about 150 mM; and (v) one or more surfactants (e.g., polysorbate 80, poly
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, in conjunction with embodiments above or below, the formulation has a pH of about 7.0.
- the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1, and is present at a concentration of around 20 mg/mL; (ii) trehalose, wherein the trehalose is present at a concentration between about 50 mM and about 300 mM; (iii) sodium phosphate, wherein the sodium phosphate (e.g., dibasic anhydrous, monobasic monohydrate, or combination thereof) is present at a concentration of between about 0.5 mM and about 50 mM; (iv) sodium chloride, wherein the sodium chloride is present at a concentration of between about 25 mM and
- the L-asparaginase in conjunctions with embodiments above or below, can be formulated in a unit dosage form.
- unit dosage forms refers to physically discrete units suitable as unitary dosages for human subjects and other mammals, each unit containing a predetermined quantity of active ingredient calculated to produce the desired therapeutic effect, in association with a suitable pharmaceutical excipient.
- a unit dosage can be administered every 12 hours, every 24 hours, every 48 hours, or every 72 hours. In some embodiments, a unit dosage is administered every 48 hours.
- a unit dosage contain from about 5 mg to about 50 mg (e.g., about 6 mg, 7 mg, 8 mg, 9 mg, 10 mg, 11 mg, 12 mg, 13 mg, 14 mg, 15 mg, 16 mg, 17 mg, 18 mg, 19 mg, 20 mg, 21 mg, 22 mg, 23 mg, 24 mg, 25 mg, 26 mg, 27 mg, 28 mg, 29 mg, 30 mg, 31 mg, 32 mg, 33 mg, 34 mg, 35 mg, 36 mg, 37 mg, 38 mg, 39 mg, 40 mg, 41 mg, 42 mg, 43 mg, 44 mg, 45 mg, 46 mg, 47 mg, 48 mg, and 49 mg) of the L- asparaginase.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid; and (iv) sodium chloride, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid; and (iv) one or more excipients, wherein the formulation comprises less than about 5% low-molecular- weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular- weight
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid; (iv) sodium chloride; and (v) one or more excipients, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid; and (iv) polysorbate 80, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid; (iv) sodium chloride; and (v) polysorbate 80, wherein the formulation comprises less than about 5% low- molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low- molecular-weight
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) trehalose; (iii) sodium phosphate; (iv) sodium chloride; and (v) polysorbate 80, wherein the formulation comprises less than about 5% low- molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low- molecular-weight
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1, and wherein the L-asparaginase is present at a concentration of around 20 mg/mL; (ii) trehalose, wherein the trehalose is present at a concentration between about 50 mM and about 300 mM; (iii) sodium phosphate, wherein the sodium phosphate is present at a concentration of between about 0.5 mM and about 50 mM; (iv) sodium chloride, wherein the sodium chloride is present at a concentration of between about 25 mM and about 150 mM;
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- an aqueous, non-lyophilized formulation comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1, and wherein the L-asparaginase is present at a concentration of around 20 mg/mL; (ii) trehalose, wherein the trehalose is present at a concentration of about 170 mM; (iii) sodium phosphate, wherein the sodium phosphate is present at a concentration of about 20 mM; (iv) sodium chloride, wherein the sodium chloride is present at a concentration of about 50 mM; and (v) polysorbate 80, wherein the polysorbate 80 is present at a
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- a formulation as described elsewhere herein wherein the formulation comprises less than about 5% low-molecular- weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than about 4.5% low-molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than about 4% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- the formulation comprises less than about 3.5% low-molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than about 3% low-molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than about 2.5% low- molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than about 2% low-molecular-weight (LMW) species after storage at 37 °C for one week. the formulation comprises less than about 1.5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- the formulation comprises less than about 1% low-molecular-weight (LMW) species after storage at 37 °C for one week. In some embodiments, the formulation comprises less than about 0.5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the formulation comprises less than about 0.5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- the L-asparaginase formulations of the present disclosure can be used in the treatment of a disease in a subject (for example, a human), wherein the disease is treatable by the depletion of asparagine or the administration of asparaginase.
- a subject for example, a human
- the disease is treatable by the depletion of asparagine or the administration of asparaginase.
- the human subject has, prior to administration of the L-asparaginase, experienced silent inactivation of the E. Coli-derived asparaginase.
- the subject has, prior to administration of the L-asparaginase, experienced an allergic reaction to the E. Coli- derived asparaginase.
- the subject has, prior to administration of the L- asparaginase, experienced anaphylaxis to the E. Coli-derived asparaginase.
- objective signs of allergy or hypersensitivity include testing “antibody positive” for an asparaginase enzyme.
- the L-asparaginase formulations of the present disclosure are useful in the treatment or the manufacture of a medicament for use in the treatment of acute lymphoblastic leukemia (ALL).
- ALL acute lymphoblastic leukemia
- the incidence of relapse in ALL patients following treatment with L-asparaginase remains high, with approximately 10-25% of pediatric ALL patients having early relapse (e.g., some during maintenance phase at 30-36 months post-induction). If a patient treated with E.
- the L-asparaginase of the invention may be used in a method of treating patients with relapsed ALL who were previously treated with other asparaginase preparations, in particular those who were previously treated with E. coli-derived asparaginases.
- L-asparaginase formulations of the present disclosure are useful in treating include, but are not limited to, the following: malignancies, or cancers, including but not limited to, hematalogic malignancies, lymphoma, non- Hodgkin’s lymphoma, NK lymphoma, pancreatic cancer, Hodgkin’s disease, large cell immunoblastic lymphoma, acute promyelocytic leukemia, acute myelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute T-cell leukemia, acute myeloid leukemia (AML), biphenotypic B-cell myelomonocytic Leukemia, chronic lymphocytic leukemia, lymphosarcoma, reticulosarcoma, and melanosarcoma, and diffuse large B-cell lymphoma (DLBCL).
- malignancies or cancers, including but not limited to, hematalogic
- L-asparaginase formulations useful in treating are cancers including, but not limited to, renal cell carcinoma, renal cell adenocarcinoma, glioblastoma including glioblastoma multiforma and glioblastoma astrocytoma, medulloblastoma, rhabdomyosarcoma, malignant melanoma, epidermoid carcinoma, squamous cell carcinoma, lung carcinoma including large cell lung carcinoma and small cell lung carcinoma, endometrial carcinoma, ovarian adenocarcinoma, ovarian tetratocarcinoma, cervical adenocarcinoma, breast carcinoma, breast adenocarcinoma, breast ductal carcinoma, pancreatic adenocarcinoma, pancreatic ductal carcinoma, colon carcinoma, colon adenocarcinoma, colorectal adenocarcinoma, bladder transitional cell carcinoma, bladder papilloma, prostate carcinoma,
- cancers including
- the cancer may be a solid cancer, for example lung cancer or breast cancer.
- Representative non-malignant hematologic diseases which respond to asparagine depletion include immune system-mediated blood diseases, including, but not limited to, infectious diseases such as those caused by HIV infection (i.e., AIDS).
- Nonhematologic diseases associated with asparagine dependence include autoimmune diseases, for example, rheumatoid arthritis, collagen vascular diseases, AIDS, osteoarthritis, Issac’s syndrome, psoriasis, insulin dependent diabetes mellitus, multiple sclerosis, sclerosing panencephalitis, systemic lupus erythematosus (SLE), rheumatic fever, inflammatory bowel disease (e.g., ulcerative colitis and Crohn’s disease), primary billiary cirrhosis, chronic active hepatitis, glomerulonephritis, myasthenia gravis, pemphigus vulgaris, and Graves’ disease.
- autoimmune diseases for example, rheumatoid arthritis, collagen vascular diseases, AIDS, osteoarthritis, Issac’s syndrome, psoriasis, insulin dependent diabetes mellitus, multiple sclerosis, sclerosing panencephalitis, systemic l
- the disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof comprises WNT mutated colorectal cancer (CRC).
- the disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof comprises relapse remitting (R/R) acute myeloid leukemia (AML).
- L-asparaginase formulations of the present disclosure are useful in treating include, but are not limited to, sarcoma, breast cancer, metastatic breast cancer, liver cancer, stomach cancer, colorectal cancer, and head and neck cancer.
- Pharmaceutical compositions and co-administration [0080] In some embodiments, treatment with a L-asparaginase formulation of the present disclosure is co-administered with a multi-agent chemotherapeutic regimen. In some embodiments, treatment with a L-asparaginase formulation of the present disclosure is co- administered with one or more other chemotherapeutic agents as part of a multi-agent chemotherapeutic regimen.
- treating patients with a L-asparaginase formulation of the present disclosure in addition to other agents helps to ensure availability of an asparaginase for patients who have developed hypersensitivity to E. coli derivedasparaginase.
- agents that may be part of a multi-agent chemotherapeutic regimen with a L-asparaginase of the present disclosure include, but are not limited to: cytarabine, vincristine, daunorubicin, methotrexate, leuvocorin, doxorubicin, anthracycline, corticosteroids and glucocortiods (including but not limited to prednisone, prednisolone, and/or dexamethasone), cyclophosphamide, 6-mercaptopurine, venetoclax, and etoposide.
- the multi-agent chemotherapeutic regimen is the L-asparaginase and one additional chemotherapeutic agent. In some embodiments, the multi-agent chemotherapeutic regimen is the L-asparaginase and two or more additional chemotherapeutic agents. [0082] As an example, patients with ALL will be co-administered the L- asparaginase of the present disclosure along with a multi-agent chemotherapy during 3 chemotherapy phases including induction, consolidation or intensification, and maintenance.
- the L-asparaginase formulation of the present disclosure is co- administered with an asparagine synthetase inhibitor (e.g., such as set forth in WO 2007/103290, which is herein incorporated by reference in its entirety).
- an asparagine synthetase inhibitor e.g., such as set forth in WO 2007/103290, which is herein incorporated by reference in its entirety.
- the L-asparaginase formulation of the present disclosure is not co-administered with an asparagine synthetase inhibitor, but is co-administered with other chemotherapy drugs.
- the L-asparaginase formulation of the present disclosure is co- administered with an asparagine synthetase inhibitor and other chemotherapy drugs.
- the L- asparaginase formulation of the present disclosure can be co-administered before, after, or simultaneously with other compounds as part of a multi-agent chemotherapy regimen.
- the L-asparaginase of the present disclosure comprises a protein recombinantly produced in Pseudomonas fluorescens and, more specifically, the L- asparaginase comprising the sequence of SEQ ID NO: 1.
- the formulations described herein can be administered to a patient as a pharmaceutical composition using standard techniques. Techniques and formulations generally may be found in Remington’s Pharmaceutical Sciences, 22nd edition, Mack Publishing, 2015 (herein incorporated by reference).
- Suitable dosage forms depend upon the use or the route of entry, for example, oral, transdermal, transmucosal, or by injection (parenteral). Such dosage forms should allow the therapeutic agent to reach a target cell or otherwise have the desired therapeutic effect.
- pharmaceutical compositions injected into the blood stream preferably are soluble.
- the pharmaceutical compositions according to the present disclosure can be formulated as pharmaceutically acceptable salts and complexes thereof.
- Pharmaceutically acceptable salts are non-toxic salts present in the amounts and concentrations at which they are administered. The preparation of such salts can facilitate pharmaceutical use by altering the physical characteristics of the compound without preventing it from exerting its physiological effect.
- Useful alterations in physical properties include lowering the melting point to facilitate transmucosal administration and increasing solubility to facilitate administering higher concentrations of the drug.
- the pharmaceutically acceptable salt of a modified protein as described herein may be present as a complex, as those in the art will appreciate.
- Pharmaceutically acceptable salts include acid addition salts such as those containing sulfate, hydrochloride, fumarate, maleate, phosphate, sulfamate, acetate, citrate, lactate, tartrate, methanesulfonate, ethanesulfonate, benzenesulfonate, p- toluenesulfonate, cyclohexylsulfamate, and quinate.
- Pharmaceutically acceptable salts can be obtained from acids, including hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, cyclohexylsulfamic acid, fumaric acid, and quinic acid.
- acids including hydrochloric acid, maleic acid, sulfuric acid, phosphoric acid, sulfamic acid, acetic acid, citric acid, lactic acid, tartaric acid, malonic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, cyclohexylsulfamic acid, fumaric acid, and quinic acid.
- Pharmaceutically acceptable salts also include basic addition salts such as those containing benzathine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine, procaine, aluminum, calcium, lithium, magnesium, potassium, sodium, ammonium, alkylamine, and zinc, when acidic functional groups, such as carboxylic acid or phenol are present.
- acidic functional groups such as carboxylic acid or phenol are present.
- Such salts can be prepared using the appropriate corresponding bases.
- Pharmaceutically acceptable carriers and/or excipients can also be incorporated into a pharmaceutical composition according to the invention to facilitate administration of the particular asparaginase.
- compositions according to the invention can be administered by different routes, including intravenous, intraperitoneal, subcutaneous, intramuscular, oral, topical (transdermal), or transmucosal administration.
- the compounds can be formulated into conventional oral dosage forms such as capsules, tablets, and liquid preparations such as syrups, elixirs, and concentrated drops.
- injection parenteral administration
- pharmaceutical compositions are formulated in liquid solutions, preferably in physiologically compatible buffers or solutions, such as saline solution, Hank’s solution, or Ringer’s solution.
- the L-asparaginase formulation is administered intramuscularly.
- the L-asparaginase formulation is administered intravenously.
- the L-asparaginase formulation is administered subcutaneously.
- Systemic administration can also be accomplished by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are well known in the art, and include, for example, for transmucosal administration, bile salts, and fusidic acid derivatives.
- detergents may be used to facilitate permeation.
- Transmucosal administration for example, may be through nasal sprays, inhalers (for pulmonary delivery), rectal suppositories, or vaginal suppositories.
- a dose is an amount administered to the human subject over a certain time and frequency.
- the dose of L-asparaginase formulation will be given to a human subject with hypersensitivity only when the hypersensitivity subsides.
- a L-asparaginase formulation is administered to a human subject in an amount from about 10 mg/m 2 to 100 mg/m 2 .
- a L-asparaginase formulation is administered intramuscularly every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days, wherein the amount is about 25 mg/m 2 .
- a L-asparaginase formulation is administered intravenously every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days, wherein the amount is about 37.5 mg/m 2 .
- a L-asparaginase formulation is administered intravenously every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days, wherein the amount is about 50 mg/m 2 .
- the L-asparaginase formulation administered in such doses is not conjugated to a polymer such as a PEG moiety and/or is not conjugated to a peptide comprising solely alanine and/or proline residues.
- Dose amount [0090] The amounts of the L-asparaginase formulation of the present disclosure that are to be delivered will depend on many factors, for example, the IC50, EC50, the biological half-life of the compound, the age, size, weight, and physical condition of the patient, and the disease or disorder to be treated. The importance of these and other factors to be considered are well known to those of ordinary skill in the art.
- the amount of the L-asparaginase formulation of the present disclosure will be administered at a range from about 1 milligram per square meter of the surface area of the patient's body (mg/m 2 ) to 1,000/m 2 , with a dosage range of about 10 mg/m 2 to about 100 mg/m 2 to treat disease, including but not limited to ALL or LBL. Of course, other dosages and/or treatment regimens may be employed, as determined by the attending physician. [0091] In some embodiments, the method comprises administering the recombinant L- asparaginase of the present disclosure at an amount from about 10 mg/m 2 and about 100 mg/m 2 .
- the method comprises administering the L- asparaginase formulation of the present disclosure at an amount from 10 mg/m 2 and 100 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount of about 10,15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 95, or 95 mg/m 2 or an equivalent amount thereof (for example on a protein content basis).
- the L-asparaginase formulation of the present disclosure is administered at an amount selected from the group consisting of about 10, 20, 30, 40, 50, 60, 70, 80, 90, and about 100 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered at a dose more than or equal to about 1, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 95, 100, 200, or 300 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered at a dose less than or equal to about 300, 200100, 95, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10, 5, or 1 mg/m 2 .
- the L- asparaginase formulation of the present disclosure is administered in an amount between about 12 mg/m 2 and about 90 mg/m 2 .
- the recombinant L- asparaginase of the present disclosure is administered in an amount between about 20 mg/m 2 and about 80 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 25 mg/m 2 and about 70 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 25 mg/m 2 and about 80 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 37.5 mg/m 2 and about 80 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 37.5 mg/m 2 and about 65 mg/m 2 . In an exemplary embodiment, the recombinant L- asparaginase of the present disclosure is administered in an amount between about 25 mg/m 2 and about 37.5 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 25 mg/m 2 and about 100 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 25 mg/m 2 and about 65 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 25 mg/m 2 and about 80 mg/m 2 .
- the method comprises administering the recombinant L- asparaginase of the present disclosure at an amount from about 25 mg/m 2 and about 50 mg/m 2 .
- the method comprises administering the L- asparaginase formulation of the present disclosure at an amount from 25 mg/m 2 and 50 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount of about 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 mg/m 2 or an equivalent amount thereof (for example on a protein content basis).
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 20 mg/m 2 and about 30 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 22.5 mg/m 2 and about 28.5 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 23 mg/m 2 and about 27 mg/m 2 . In an exemplary embodiment, the recombinant L- asparaginase of the present disclosure is administered in an amount between about 24 mg/m 2 and about 26 mg/m 2 . In an exemplary embodiment, the L- asparaginase formulation of the present disclosure is administered in an amount between about 24.5 mg/m 2 and about 25.5 mg/m 2 . [0094] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 60 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 42.5 mg/m 2 and about 58.5 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 43 mg/m 2 and about 57 mg/m 2 . In an exemplary embodiment, the recombinant L- asparaginase of the present disclosure is administered in an amount between about 44 mg/m 2 and about 56 mg/m 2 . In an exemplary embodiment, the L- asparaginase formulation of the present disclosure is administered in an amount between about 45 mg/m 2 and about 55 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 46 mg/m 2 and about 54 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 47.5 mg/m 2 and about 52.5 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 48 mg/m 2 and about 52 mg/m 2 . In an exemplary embodiment, the recombinant L- asparaginase of the present disclosure is administered in an amount between about 49 mg/m 2 and about 51 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 49.5 mg/m 2 and about 50.5 mg/m 2 . [0095] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 30 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 35 mg/m 2 and about 70 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 65 mg/m 2 .
- the recombinant L- asparaginase of the present disclosure is administered in an amount between about 45 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L- asparaginase formulation of the present disclosure is administered in an amount between about 50 mg/m 2 and about 55 mg/m 2 . [0096] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 45 mg/m 2 and about 70 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 50 mg/m 2 and about 65 mg/m 2 . In an exemplary embodiment, the recombinant L- asparaginase of the present disclosure is administered in an amount between about 55 mg/m 2 and about 60 mg/m 2 . [0097] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 45 mg/m 2 and about 55 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 47.5 mg/m 2 and about 50 mg/m 2 . [0098] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 30 mg/m 2 and about 35 mg/m 2 . [0099] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 30 mg/m 2 and about 95 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 35 mg/m 2 and about 90 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 85 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 45 mg/m 2 and about 80 mg/m 2 . In an exemplary embodiment, the L- asparaginase formulation of the present disclosure is administered in an amount between about 50 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 55 mg/m 2 and about 70 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 60 mg/m 2 and about 65 mg/m 2 . [0100] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 30 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 35 mg/m 2 and about 55 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 50 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 42.5 mg/m 2 and about 57.5 mg/m 2 . [0101] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 30 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 35 mg/m 2 and about 70 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered in an amount between about 40 mg/m 2 and about 65 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered in an amount between about 45 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L- asparaginase formulation of the present disclosure is administered in an amount between about 50 mg/m 2 and about 55 mg/m 2 . [0102] In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 10 mg/m 2 and about 50 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 12.5 mg/m 2 and about 47.5 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 15 mg/m 2 and about 45 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 20 mg/m 2 and about 42.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 22.5 mg/m 2 and about 40 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 24 mg/m 2 and about 39 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 27 mg/m 2 and about 37.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of between about 30 mg/m 2 and about 45 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of about 25 mg/m 2 .
- the recombinant L- asparaginase of the present disclosure is administered intramuscularly in an amount of 25 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 25 mg/m 2 and about 80 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 37.5 mg/m 2 and about 80 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 37.5 mg/m 2 and about 65 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 25 mg/m 2 and about 37.5 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 30 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 35 mg/m 2 and about 70 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 40 mg/m 2 and about 65 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 45 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 50 mg/m 2 and about 55 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 40 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 45 mg/m 2 and about 70 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 50 mg/m 2 and about 65 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 55 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 40 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 45 mg/m 2 and about 55 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 47.5 mg/m 2 and about 50 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount between about 30 mg/m 2 and about 35 mg/m 2 . [0103] In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 10 mg/m 2 and about 95 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 20 mg/m 2 and about 60 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 22.5 mg/m 2 and about 57.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 25 mg/m 2 and about 55 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 27.5 mg/m 2 and about 47.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 30 mg/m 2 and about 45 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 32.5 mg/m 2 and about 42.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 21.5 mg/m 2 and about 38.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of between about 36 mg/m 2 and about 45 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of about 37.5 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of 37.5 mg/m 2 . In some embodiments, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of 50 mg/m 2 . [0104] In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 25 mg/m 2 and about 37.5 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 25 mg/m 2 and about 100 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 25 mg/m 2 and about 65 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 25mg/m 2 and about 80 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 30 mg/m 2 and about 35 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 30 mg/m 2 and about 95 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 35 mg/m 2 and about 90 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 40 mg/m 2 and about 85 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 45 mg/m 2 and about 80 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 50 mg/m 2 and about 75 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 55 mg/m 2 and about 70 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 60 mg/m 2 and about 65 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 30 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 35 mg/m 2 and about 55 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 40 mg/m 2 and about 50 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 42.5 mg/m 2 and about 57.5 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 30 mg/m 2 and about 75 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 35 mg/m 2 and about 70 mg/m 2 .
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 40 mg/m 2 and about 65 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 45 mg/m 2 and about 60 mg/m 2 . In an exemplary embodiment, the L-asparaginase formulation of the present disclosure is administered intravenously in an amount between about 50 mg/m 2 and about 55 mg/m 2 .
- the method comprises administering a recombinant L- asparaginase of the present disclosure that elicits a lower immunogenic response in a patient compared to a non-recombinant L-asparaginase.
- treatment will be administered at a dose ranging from about 1 mg/m 2 to about 1000 mg/m 2 , typically about 10 mg/m 2 to about 100 mg/m 2 , at a schedule ranging from about three a week to about once a month, typically once per week or once every other week, as a single agent (e.g., monotherapy) or as part of a combination of chemotherapy drugs, including, but not limited to glucocorticoids, corticosteroids, anticancer compounds or other agents, including, but not limited to methotrexate, dexamethasone, prednisone, prednisolone, vincristine, cyclophosphamide, and anthracycline.
- chemotherapy drugs including, but not limited to glucocorticoids, corticosteroids, anticancer compounds or other agents, including, but not limited to methotrexate, dexamethasone, prednisone, prednisolone, vincristine, cyclophosphamide,
- the L-asparaginase formulation of the present disclosure can be administered before, after, or simultaneously with other compounds as part of a multi-agent chemotherapy regimen.
- the L-asparaginase formulation of the present disclosure comprises a protein recombinantly produced in Pseudomonas fluorescens, and more specifically, the L-asparaginase formulation comprises a sequence according to SEQ ID NO:1.
- the L-asparaginase formulation of the present disclosure is administered at a dose that depletes L-asparagine to undetectable levels using methods and apparatus known in the art for a period of about 3 days to about 10 days (e.g., 3, 4, 5, 6, 7, 8, 9, or 10 days) for a single dose.
- the L-asparaginase formulation of the present disclosure is administered three times a week.
- the L-asparaginase formulation of the present disclosure is administered every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days.
- the L-asparaginase formulation of the present disclosure is administered on Monday, Wednesday, and Friday of the same week.
- the L-asparaginase formulation of the present disclosure is administered three times a week for at least one to three weeks. In some embodiments, the L-asparaginase formulation of the present disclosure is administered every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days for about one to three weeks. In some embodiments, the L-asparaginase formulation of the present disclosure is administered on Monday, Wednesday, and Friday of the week for about one to three weeks. [0109] In some embodiments, the L-asparaginase formulation of the present disclosure is administered three times a week for about two weeks.
- the L-asparaginase formulation of the present disclosure is administered every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days for about two weeks. In some embodiments, the L-asparaginase formulation of the present disclosure is administered on Monday, Wednesday, and Friday of the same week for about two weeks. [0110] In some embodiments, the L-asparaginase formulation of the present disclosure is administered three times a week for two weeks. In some embodiments, the L- asparaginase formulation of the present disclosure is administered every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days for two weeks.
- the L-asparaginase formulation of the present disclosure is administered on Monday, Wednesday, and Friday of the same week for two weeks. [0111] In some embodiments, the L-asparaginase formulation of the present disclosure is administered three times a week, continuing until the patient no longer has a disease that is treatable by depletion of asparagine. In some embodiments, the L-asparaginase formulation of the present disclosure is administered every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days, continuing until the patient no longer has a disease that is treatable by depletion of asparagine.
- the recombinant L- asparaginase of the present disclosure is administered on Monday, Wednesday, and Friday of the same week, continuing until the patient no longer has a disease that is treatable by depletion of asparagine.
- the L-asparaginase formulation of the present disclosure is administered three times a week, continuing until the patient decides to end or postpone treatment.
- the L-asparaginase formulation of the present disclosure is administered every other day over a period of 5 consecutive days followed by a rest period of 2 consecutive days, continuing until the patient decides to end or postpone treatment.
- the L-asparaginase formulation of the present disclosure is administered on Monday, Wednesday, and Friday of the same week, continuing until the patient decides to end or postpone treatment. [0113] In some embodiments, the L-asparaginase formulation of the present disclosure is administered about every 48 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered every 40 to 58 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered about every 42 to 56 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered about every 44 to 52 hours. In some embodiments, the L- asparaginase formulation of the present disclosure is administered about every 46 to 50 hours.
- the recombinant L- asparaginase of the present disclosure is administered about every 72 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered every 64 to 80 hours. In some embodiments, the L- asparaginase formulation of the present disclosure is administered about every 66 to 78 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered about every 68 to 76 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered about every 70 to 74 hours. [0114] In some embodiments, L-asparaginase formulation of the present disclosure is administered as a second line therapy with patients who are hypersensitive to an E.
- the L-asparaginase formulation is administered to the human subject as a substitute for a dose of a long-acting E. coli-derived asparaginase.
- six doses of the L-asparaginase formulation are administered to the human subject as a substitute for one dose of the long-acting E. coli-derived asparaginase.
- seven doses of the L-asparaginase formulation are administered to the human subject as a substitute for one dose of the long-acting E.
- a dose regimen for the L-asparaginase formulation comprises a cycle, wherein the cycle comprises a first dose, a second dose, and a third dose, wherein the cycle is optionally repeatable, and wherein the first dose, second dose, and third dose are administered about 48-72 hours apart.
- dose amounts may vary within the cycle.
- a dose regimen for the L-asparaginase formulation comprises a cycle, wherein the cycle is optionally repeatable, and wherein the cycle comprises administration of the L-asparaginase formulation every other day over a period of five consecutive days followed by a rest period of two consecutive days, wherein the first dose of the cycle is 25 mg/m 2 , the second dose of the cycle is 25 mg/m 2 and the third dose of the cycle is 50 mg/m 2 , followed by the rest period of two consecutive days.
- a dose regimen for the L-asparaginase formulation comprises a cycle, wherein the cycle is optionally repeatable, and wherein the cycle comprises administration of the L-asparaginase formulation every other day over a period of five consecutive days followed by a rest period of two consecutive days, wherein the first dose of the cycle is 25 mg/m 2 , the second dose of the cycle is 25 mg/m 2 and the third dose of the cycle is 37.5 mg/m 2 , followed by the rest period of two consecutive days.
- a dose regimen for the L-asparaginase formulation comprises a cycle, wherein the cycle is optionally repeatable, and wherein the cycle comprises administration of the L-asparaginase formulation every other day over a period of five consecutive days followed by a rest period of two consecutive days, wherein the first dose of the cycle is 37.5 mg/m 2 , the second dose of the cycle is 37.5 mg/m 2 and the third dose of the cycle is 37.5 mg/m 2 , followed by the rest period of two consecutive days.
- a dose regimen for the L-asparaginase formulation comprises a cycle, wherein the cycle is optionally repeatable, and wherein the cycle comprises administration of the L-asparaginase formulation every other day over a period of five consecutive days followed by a rest period of two consecutive days, wherein the first dose of the cycle is 37.5 mg/m 2 , the second dose of the cycle is 25 mg/m 2 and the third dose of the cycle is 37.5 in mg/m 2 , followed by the rest period of two consecutive days.
- a dose regimen for the L-asparaginase formulation comprises a cycle, wherein the cycle is optionally repeatable, and wherein the cycle comprises administration of the L-asparaginase formulation every other day over a period of five consecutive days followed by a rest period of two consecutive days, wherein the first dose of the cycle is 37.5 mg/m 2 , the second dose of the cycle is 25 mg/m 2 and the third dose of the cycle is 25 mg/m 2 , followed by the rest period of two consecutive days.
- the first dose of the cycle is administered on a Monday
- the second dose of the cycle is given on a Wednesday
- the third dose of the cycle is given on a Friday.
- a dose regimen for the L-asparaginase formulation comprises a cycle, where the cycle is optionally repeatable, and where the cycle comprises administration of the L-asparaginase formulation every other day over a period of five consecutive days followed by a rest period of two consecutive days, where the first dose of the cycle is 25 mg/m 2 , the second dose of the cycle is 25 mg/m 2 and the third dose of the cycle is 50 mg/m 2 , followed by the rest period of two consecutive days.
- the first dose of the cycle is administered on a Monday
- the second dose of the cycle is given on a Wednesday
- the third dose of the cycle is given on a Friday.
- the present disclosure provides a method for depleting asparaginase in a human subject to treat Acute Lymphoblastic Leukemia (ALL) or Lymphoblastic Lymphoma (LBL), the method comprising: on Mondays, Wednesdays, and Fridays, administering intramuscularly about 25 mg/m 2 of L-asparaginase to the human subject, such that the human subject receives a total of seven doses of L-asparaginase over a two week period.
- ALL Acute Lymphoblastic Leukemia
- LBL Lymphoblastic Lymphoma
- the present disclosure provides a method for depleting asparaginase in a human subject to treat Acute Lymphoblastic Leukemia (ALL) or Lymphoblastic Lymphoma (LBL), the method comprising: (a) on Mondays and Wednesdays, administering intramuscularly about 25 mg/m 2 of L-asparaginase to the human subject, and (b) on Fridays, administering intramuscularly about 50 mg/m 2 of L-asparaginase to the human subject; such that the human subject receives a total of six doses of L-asparaginase over a two week period.
- ALL Acute Lymphoblastic Leukemia
- LBL Lymphoblastic Lymphoma
- the dose regimen may encompass any number of cycles for any number of weeks or until any endpoint that is specified herein.
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of (i) 25 mg/m 2 on Monday, (ii) 25 mg/m 2 on Wednesday, and (iii) 50 mg/m 2 on Friday.
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of 25 mg/m 2 every 48 hours.
- the L-asparaginase formulation of the present disclosure is administered intravenously in an amount of 37.5 mg/m 2 every 48 hours.
- the L- asparaginase formulation of the present disclosure is administered intravenously in an amount of 50 mg/m 2 every 48 hours. [0129] In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of 25 mg/m 2 every 48 hours. In some embodiments, the L-asparaginase formulation of the present disclosure is administered intramuscularly in an amount of 37.5 mg/m 2 every 48 hours. In some embodiments, the L- asparaginase formulation of the present disclosure is administered intramuscularly in an amount of 50 mg/m 2 every 48 hours.
- the L-asparaginase formulation of the present disclosure is administered (i) intravenously in an amount of 25 mg/m 2 on Monday, (ii) intravenously in an amount of 25 mg/m 2 on Wednesday, and (iii) intramuscularly in an amount of 50 mg/m 2 on Friday.
- a dosing regimen may comprise administration of six doses (e.g., a first dose, a second dose, a third dose, a fourth dose, a fifth dose, and a sixth dose) of the L-asparaginase formulation over a period of two weeks, wherein during week one, (i) a first dose is administered intravenously or intramuscularly in an amount of 25 mg/m 2 or 37.5 mg/m 2 on Monday, (ii) a second dose is administered intravenously or intramuscularly in an amount of 25 mg/m 2 37.5 mg/m 2 on Wednesday, and (iii) a third dose is administered intravenously or intramuscularly in an amount of 25 mg/m 2 37.5 mg/m 2 on Friday; and during week two, (iv) a fourth dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (v) a fifth dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (vi) a sixth dose is
- a dosing regimen comprises administration of six doses of the L-asparaginase formulation over a period of two weeks, wherein during week one, (i) a first dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (ii) a second dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (iii) a third dose is administered intravenously in an amount of 25 mg/m 2 on Friday; and during week two, (iv) a fourth dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (v) a fifth dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (vi) a sixth dose is administered intramuscularly in an amount of 50 mg/m 2 on Friday.
- a dosing regimen comprises administration of six doses of the L-asparaginase formulation over a period of two weeks, wherein during week one, (i) a first dose is administered intramuscularly in an amount of 25 mg/m 2 on Monday, (ii) a second dose is administered intramuscularly in an amount of 25 mg/m 2 on Wednesday, and (iii) a third dose is administered intramuscularly in an amount of 25 mg/m 2 on Friday; and during week two, (iv) a fourth dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (v) a fifth dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (vi) a sixth dose is administered intramuscularly in an amount of 50 mg/m 2 on Friday.
- a dosing regimen comprises administration of six doses of the L-asparaginase formulation over a period of two weeks, wherein during week one, (i) a first dose is administered intravenously in an amount of 37.5 mg/m 2 on Monday, (ii) a second dose is administered intravenously in an amount of 37.5 mg/m 2 on Wednesday, and (iii) a third dose is administered intravenously in an amount of 37.5 mg/m 2 on Friday; and during week two, (iv) a fourth dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (v) a fifth dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (vi) a sixth dose is administered intramuscularly in an amount of 50 mg/m 2 on Friday.
- a dosing regimen comprises administration of six doses of the L-asparaginase formulation over a period of two weeks, wherein during week one, (i) a first dose is administered intramuscularly in an amount of 37.5 mg/m 2 on Monday, (ii) a second dose is administered intramuscularly in an amount of 37.5 mg/m 2 on Wednesday, and (iii) a third dose is administered intramuscularly in an amount of 37.5 mg/m 2 on Friday; and during week two, (iv) a fourth dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (v) a fifth dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (vi) a sixth dose is administered intramuscularly in an amount of 50 mg/m 2 on Friday.
- a dosing regimen comprise administration of six doses of the L-asparaginase formulation over a period of two weeks, wherein during week one, (i) a first dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (ii) a second dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (iii) a third dose is administered intravenously in an amount of 50 mg/m 2 on Friday; and during week two, (iv) a fourth dose is administered intravenously in an amount of 25 mg/m 2 on Monday, (v) a fifth dose is administered intravenously in an amount of 25 mg/m 2 on Wednesday, and (vi) a sixth dose is administered intramuscularly in an amount of 50 mg/m 2 on Friday.
- kits comprising: (i) any one of the formulations described herein; and (ii) instructions for treating a disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof.
- the kit comprises a formulation, comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1; and (ii) one or more stabilizers, or one or more buffers, or any combination thereof.
- the L-asparaginase formulation comprises less than about 0.6% low- molecular-weight (LMW) species after storage at 40 °C for two months. In some embodiments, the L-asparaginase formulation comprises less than 2% high-molecular-weight (HMW) species after storage at 40 °C for two months. In some embodiments, the L- asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species and less than 2% high-molecular-weight (HMW) species after storage at 40 °C for two months. In some embodiments, the L-asparaginase formulation comprises less than about 0.6% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the kit comprises a formulation, comprising (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; and (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the kit comprises a formulation, comprising (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 70% identical to SEQ ID NO: 1, and wherein the L-asparaginase is present at a concentration of around 20 mg/mL; (ii) trehalose, wherein the trehalose is present at a concentration of about 170 mM; (iii) sodium phosphate, wherein the sodium phosphate is present at a concentration of about 20 mM; (iv) sodium chloride, wherein the sodium chloride is present at a concentration of about 50 mM; and (v) polysorbate 80, wherein the polysorbate 80 is present at a concentration of about 0.02% (w/v), wherein the formulation comprises less than about 0.6% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- the kit comprises a formulation, comprising (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1, and wherein the L-asparaginase is present at a concentration of around 20 mg/mL; (ii) trehalose, wherein the trehalose is present at a concentration of about 170 mM; (iii) sodium phosphate, wherein the sodium phosphate is present at a concentration of about 20 mM; (iv) sodium chloride, wherein the sodium chloride is present at a concentration of about 50 mM; and (v) polysorbate 80, wherein the polysorbate 80 is present at a concentration of about 0.02% (w/v
- the formulation has a pH of between about 4.0 and about 8.5. In some embodiments, the formulation has a pH of about 7.0.
- the kits comprise instructions for treating cancer. In some embodiments, the kits comprise instructions for treating acute lymphoblastic leukemia (ALL). In some embodiments, the ALL is relapsed. In some embodiments, the kits comprise instructions for treating lymphoblastic lymphoma (LBL). In some embodiments, the LBL is relapsed.
- ALL acute lymphoblastic leukemia
- LBL lymphoblastic lymphoma
- Nessler Activity was measured by Nessler assay, in which the measurement of asparaginase activity is based on an endpoint limit assay in which the enzyme is incubated at +37 °C under saturating L-asparagine concentration for 15 minutes. The reaction is stopped by addition of Nessler’s reagent and the amount of ammonia produced during the reaction is assessed colorimetrically (at 450 nm) using a calibration curve constructed from known quantities of ammonium sulfate.
- SEC Size Exclusion Chromatography
- Example 1 Baseline Buffer/Excipient Screen
- the effects of pH and buffer type from six buffer/pH combinations in the range of 4.5 – 8.0 were assessed on stability of L-asparaginase.
- An additional set of formulations with 6 different excipients in either 20 mM histidine buffer at pH 7.0 or 20 mM sodium phosphate at pH 8.0 were prepared as an initial excipient screen (Table 1).
- L- asparaginase 1.0 mL of Lot RM-LAP-P03/P05/P06 Pool of Bulks at 20.9 mg/mL
- excipients proline, lysine, sodium chloride, arginine, trehalose, sorbitol, and sucrose in histidine buffer at pH 7.0 or phosphate buffer at pH 8.0 were evaluated for the influence of excipients.
- SEC and the Nessler activity assay were used to assess the stability of RC in the presence of these excipients in the selected buffers.
- the purity of 26 formulations was assessed by SEC-HPLC. Results are summarized in Table 2 and Table 3. Little difference was observed in the SEC profiles between the 5°C and 37°C conditions after 1 week storage for all formulations. However, differences were observed between the different formulations. The main peak purities had a range of 66.4 – 98.3%.
- the histidine buffer formulation all had purity levels between 66.4% and 74.0%, while the remaining formulations had purity levels between 90.6% and 98.3%.
- succinate, citrate, phosphate with lysine, and phosphate with arginine buffers a LMW species was observed at ⁇ 11.6 minutes ranging from 1.3 – 32.4%.
- the formulations in acetate, phosphate, and tris buffers showed between 0.2 – 0.6% LMW species.
- Formulations in phosphate buffer with sodium chloride, trehalose, sorbitol, and sucrose showed similar levels of LMW species to the formulations without excipients.
- Table 3 [0149] Based on the highest purity and lowest LMW species percentage, acetate and phosphate buffer were selected for further evaluation. Additionally, trehalose, sorbitol, and sodium chloride were chosen as the excipients to be evaluated in the DOE to assess their impact on formulation stability under more stringent stress conditions.
- Example 2 DOE [0150] A statistical design of experiment (DOE) approach considering one numeric factor (pH) and one categorical factor (excipient) was used to evaluate the effects of pH and excipient for acetate and phosphate buffer in the range of 4.5 – 5.5 and 7.0 – 8.0, respectively, on L-asparaginase.
- DOE A statistical design of experiment (DOE) approach considering one numeric factor (pH) and one categorical factor (excipient) was used to evaluate the effects of pH and excipient for acetate and phosphate buffer in the range of 4.5 – 5.5 and 7.0 – 8.0, respectively, on L-asparaginase.
- the Nessler activity assay for formulations exposed to a single freeze/thaw cycle or stored for 2 weeks at 40°C had activities that ranged from 600 to 1270 ⁇ mol/min.mgE (Table 4 and Table 5). No significant loss of activity of the formulations was observed the thermal or freeze/thaw stress, and it is undetermined if the formulations with increased activity is a result of the formulation buffer or the variability of the Nessler Activity assay.
- the formulations were analyzed by RP-HPLC. By RP-HPLC, all formulations in both acetate and phosphate buffer were determined to be 100% main peak after a single freeze/thaw stress, and 98% main peak and 2% minor peak after 2 weeks at 40°C.
- Table 5 [0153] All formulations and stress conditions were analyzed by SEC-HPLC. Results are shown in Table 6. After thermal stress, the purity in phosphate buffered formulations ranged from 88.70% to 99.31%, the HMW peak ranged from 0.66% to 1.00%, the LMW shoulder ranged from none detected to 10.98%, and the LMW peak was none detected. At pH 7.0, all three excipients show similar SEC profiles after thermal stress, and the main peak percentage was 99% for each excipient.
- Table 6 [0154] The decrease in main peak purity and increase in LMW shoulder percentage were fit to a linear model dependent on pH only with the maximum main peak purity observed at pH 7.0 (Table 7).
- the off-design formulations at pH 8.5 also show formation of significant quantities of LMW shoulder after thermal stress (Table 8).
- the formation of HMW species was found to be dependent on excipient, but not pH, with sorbitol having the overall largest percentage of HMW species.
- Table 7 Table 8 [0155] Under freeze/thaw stress for the sodium phosphate formulations, the SEC- HPLC main peak purity range from 98.05% to 99.34%, the HMW peak ranged from 0.66% to 0.71%, and the LMW peak ranged from none detected to 1.28%.
- Table 11 [0158] At pH 7.0, the main peak percentage was 62.1-63.1%, 59.3-59.9%, and 57.2-57.5% for sodium chloride, trehalose, and sorbitol, respectively. No trend was observed for the amount of basic species under thermal stress. A similar trend for pH was observed for the main peak and acidic species percentages for these formulations under freeze/thaw stress (Table 12), but little difference was observed between the excipients. Table 12 [0159] After thermal stress, the acetate buffer formulations purity ranged from 51.3% to 56.4%, the acidic species from 5.9% to 7.3%, and basic species from 37.2% to 41.8% (Table 11 above).
- the main peak decreased with decreasing pH, and the main peak percentage was also dependent on the excipient type. At pH 5.0, the main peak percentage was 54.0%, 55.2%, and 52.1% for sorbitol, trehalose, and sodium chloride respectively. No trend was observed for the amount of basic species observed under thermal stress. Under freeze/thaw stress in sodium acetate buffers, a similar trend was observed with pH and excipient relative to the thermal stress, although the difference between formulations are relatively small (Table 12 above).
- the IEX-HPLC results for the off-design formulations are found in Table 13 and Table 14. Table 13 Table 14 [0160] All formulations were colorless and clear after vialing.
- the numerical optimization was performed on the analytical results from the 20 mM sodium phosphate DOE after 2 weeks of thermal stress.
- the formulation optimization was performed to find the optimal formulation without any constraints on the pH or excipient.
- the optimization parameters and results are found in Table 18, Table 19, Table 20, and Table 21.
- the optimal formulation was calculated to be 20 mM sodium phosphate, 250 mM trehalose at pH 7.2. If the appearance of particulate in the formulation is not factor as a constraint in the optimization and all results were given the same importance, the optimal formulation was calculated to be 20 mM sodium phosphate, 150 mM sodium chloride at pH 7.0.
- One vial from each formulation was held at 5°C for the initial time point testing (8 total) during the freeze-thaw and agitation evaluation.
- One and three freeze-thaw cycles were performed independently on separate vials of each formulation. Each freeze-thaw cycle was frozen at -75 ⁇ 10°C for a minimum of 2 hours and thawed at room temperature for a minimum of 2 hours and until completely thawed.
- Three vials from each formulation were required for the agitation evaluation (24 total).
- One vial was agitated on a rotator at 60 rpm at ambient temperature for 24 hours, one vial for 48 hours under the same conditions, and one vial was placed next to the rotator for the duration of the study as a control.
- Controls for each formulation were held at 5°C for the freeze/thaw stress and room temperature for 48 hours without agitation.
- All control and stressed samples were colorless and slightly opalescence without product related particulate. There was no observed difference in the degree of opalescence between the control samples and the freeze/thaw and agitation samples or the different levels of PS-80.
- the protein concentration was also assessed for controls and stressed formulations. The protein concentration was between 19 and 22 mg/mL (Table 22). No significant changes or trends were observed upon freeze/thaw or agitation stress.
- the DLS analysis showed that all samples had a hydrodynamic radius between 4.1 and 4.5 with a percent polydispersity between 10.7% and 19.4% (Table 23 and Table 24). No significant differences or trends were observed in the DLS relative to formulation or stress condition.
- Table 25 Table 26 [0170] Sub-visible particulates were measured by HIAC for the T0, 1 freeze/thaw cycle, 3 freeze/thaw cycles, agitation control, 24 hour agitation, and 48 hour agitation samples with varying concentrations of PS-80. The results are summarized in Table 27 and Table 28. For all samples the cumulative counts/mL ranged from 2330 – 45270, 390 – 35857, 78 – 6430, and 0 – 150 for ⁇ 2 ⁇ m, 5 ⁇ m, ⁇ 10 ⁇ m, ⁇ 25 ⁇ m, respectively. A few conditions had elevated particulate levels relative to the other conditions of the same formulation, but these samples appear to be outliers rather than representing a trend. For example, 20 mM phosphate, 250 mM trehalose, 0.04% PS-80, pH 7.0 solution had 2842 ⁇ 10 ⁇ m particles at the initial timepoint, but only 155 particles in the agitation control.
- Table 27 Table 28 [0171] IEX-HPLC was performed for all the 20 mM phosphate formulations at all conditions.
- the main peak percentage for the T0 control at pH 7.0 with 0%, 0.02%, 0.04%, and 0.06% PS-80 was 68.88%, 69.83%, 71.36%, and 70.38%, respectively (Table 29).
- the main peak percentage for the T0 control at pH 6.5, 7.0, and 7.5 was 70.11%, 71.36%, and 68.04%, respectively.
- Example 4 Salt/Trehalose Dependence Study [0172] The preformation salt/trehalose dependence study performed at 22 mg/mL L-asparaginase was formulated in nine different formulation buffers, according to Table 30. An aliquot of 27 mL of Lot RE-LAP-P59 was divided into 6 portions of approximately 3 mL (3 portions) and 6 mL (3 portions). A buffer exchange was performed for formulations 1-6 via dialysis using 10K MWCO Slide-A-Lyzer G2 Cassettes. Dialysis was performed at room temperature at a minimum buffer to sample volume ratio of 40:1. Four dialysis buffer exchanges were performed for each formulation approximately every 2 hours, with one exchange occurring overnight.
- Table 30 [0173] Following dialysis, the material was removed from the dialysis cassettes and the pH and protein concentration were confirmed. The concentration of the samples was then adjusted to 20 ⁇ 2 mg/mL with the corresponding buffer. After adjustment, the material in buffers 1-3 was split into equal portions of 3mL each. One set of these aliquots was supplemented with 10% PS-80 to a final concentration of 0.02%. All samples were then filtered and vialed in a biosafety cabinet. One set of the formulations were stored at 5°C until testing for the initial material quality evaluation, one set was stored at 5°C for 3 weeks, and one set was subjected to a heat stress at 40°C for 3 weeks.
- the 3 week time point was selected after an evaluation of the visual appearance for after 1.5 weeks storage at 40°C. Formulations one and two at 5°C were additionally tested by IEX and SEC HPLC after seven weeks.
- the salt/trehalose dependence study was performed to assess the impact of sodium chloride concentration on L-asparaginase formulations in 20 mM or 50 mM phosphate, 175 mM trehalose, at pH 7.0 with and without 0.02% PS-80 (Table 30). The formulations were exposed to 1.5 and 3 weeks at 5°C and 40°C. Size exclusion and IEX chromatography were used to assess the stability of RC in the presence of these varying salt concentrations in the selected buffers.
- Osmolality and conductivity were also determined at the initial timepoint and are shown in Table 31.
- Table 31 [0175] By appearance testing, all initial and stressed samples were colorless and slightly opalescence with very-few to no product related particulates. All formulations became more opalescent as a function of stress. The 0.02% PS-80 containing formulations did not have any particulates present regardless of storage duration (Table 32). This result indicates that addition of 0.02% PS-80 may delay particle formulation during long term storage. There was no dependence of appearance on salt concentration. The protein concentration was also assessed for initial and stressed formulations. The protein concentration was between 19.7 and 25.2 mg/mL (Table 33). No significant changes or trends were observed in the stressed samples.
- Formulations with salt have slightly higher main peak percentages, compared to formulations without salt. Addition of 0.02% PS-80 had little to no benefit in terms of charge heterogeneity.
- Table 34 [0177] SEC-HPLC results at the initial time point showed similar profiles with main peak percentages between 98.0% and 98.2% and HMW peak percentages between 1.9% and 2.0%. After three weeks at 40°C the samples showed slight degradation in purity due to the appearance of a LMW peak. The main peak percentages for the three week stressed samples were between 94.8% and 95.4%, with HMW peak percentages between 1.9% and 2.1% and LMW peak percentages between 2.7% and 3.1%. After three weeks at 5°C no significant changes in main peak and HMW peak percentages were observed (Table 35).
- SE-HPLC separation combined with MALLS performed on both RC-P and Erwinase identified the SEC main content as tetramer, with a molecular weight in the range of 133-134 kDa. Both materials showed dominant tetramer content.
- HMW1 species for both materials was identified as the octamer with a MW in the range of 277-286 kDa, which was close to the theoretical octamer mass of 280 kDa.
- HMW2 species observed only for Erwinase was identified as the hexadecamer (16-mer) with a MW of 554 kDa, which matched to the theoretical hexadecamer mass of 560 kDa.
- iCIEF Results The iCIEF method is an orthogonal method to evaluate the charge distribution of RC-P with an applied electrical field. The overlays of the oxidized sample and the reference standard were analyzed. Their relative peak intensities are listed in Table 44. Both oxidized samples showed an increased acidic peak at pI around 8.5. Oxidation have no impact for the basic variants. Table 44: iCIEF Results for the Oxidized Sample and RS Low pH study: [0188] Both RC-P and Erwinase samples were subjected to low pH treatment with 50mM sodium phosphate at pH 3.4 at room temperature, then frozen at -80°C.
- SE-UHPLC Results The SE-UHPLC method is used to evaluate the size distribution of RC-P in its native state under nondenaturing conditions.
- iCIEF Results The iCIEF method is an orthogonal method to evaluate the charge distribution of RC-P with an applied electrical field. The overlays of the low pH treated RC-P, Erwinase and the reference standard were analyzed. Their relative peak intensities are listed in Table 47. Both low pH treated RC-P and Erwinase showed an increased acidic peak at pI around 7.2, which was identified as monomer previously. Low pH treatment had no impact for the basic variants.
- Erwinase has glycation modifications, which contribute to the acidic variants differences.
- the higher level of octamer/16-mer observed in Erwinase contributed to the late eluting basic variants shown on CIEX.
- Previous forced degradation study of RC-P demonstrates the glycated RC-P have comparable structure and activity to RC-P. Hydrophobic profiles, as measured by HIC and RP-UHPLC, are comparable for both materials. Minor differences were observed are due to the glycation modification and higher level of HMW content of Erwinase. Primary structure and higher order structure of both materials are comparable. Potency results are comparable.
- Embodiment 1 An aqueous, non-lyophilized formulation, comprising: (i) an L-asparaginase, wherein the L-asparaginase comprises four monomer units, wherein each monomer unit has an amino acid sequence that is at least about 95% identical to SEQ ID NO: 1; (ii) one or more disaccharides, wherein the one or more disaccharides comprise trehalose, sucrose, or any combination thereof; and (iii) one or more buffers, wherein the one or more buffers are substantially free of amino acid, wherein the formulation comprises less than about 5% low-molecular-weight (LMW) species after storage at 37 °C for one week.
- LMW low-molecular-weight
- Embodiment 2 The formulation of embodiment 1, wherein the L- asparaginase is present at a concentration of about 20 mg/mL.
- Embodiment 3 The formulation of embodiment 1 or embodiment 2, wherein the L-asparaginase is non-PEGylated and non-PASylated.
- Embodiment 4 The formulation of any one of embodiments 1-3, wherein the one or more disaccharides comprise trehalose.
- Embodiment 5 The formulation of embodiment 4, wherein the trehalose is present at a concentration of between about 50 mM and about 300 mM.
- Embodiment 6 The formulation of embodiment 4, wherein the trehalose is present at a concentration of between about 150 mM and about 275 mM.
- Embodiment 7 The formulation of embodiment 4, wherein the trehalose is present a concentration of about 170 mM.
- Embodiment 8 The formulation of any one of embodiments 1-7, wherein the one or more buffers comprise a phosphate buffer, an acetate buffer, or any combination thereof.
- Embodiment 9 The formulation of any one of embodiments 1-7, wherein the one or more buffers comprise a phosphate buffer.
- Embodiment 10 The formulation of any one of embodiments 1-7, wherein the one or more buffers comprise sodium phosphate.
- Embodiment 11 The formulation of embodiment 10, wherein the sodium phosphate is present at a concentration of between about 0.5 mM and about 50 mM.
- Embodiment 12 The formulation of embodiment 10, wherein the sodium phosphate is present at a concentration of about 20 mM.
- Embodiment 13 The formulation of any one of embodiments 1-12, wherein the formulation further comprises sodium chloride.
- Embodiment 14 The formulation of embodiment 13, wherein the sodium chloride is present at a concentration of between about 25 mM and about 150 mM.
- Embodiment 15 The formulation of embodiment 13, wherein the sodium chloride is present at a concentration of about 50 mM.
- Embodiment 16 The formulation of any one of embodiments 1-15, wherein the formulation further comprises one or more excipients.
- Embodiment 17 The formulation of embodiment 16, wherein the one or more excipients comprise polysorbate 80.
- Embodiment 18 The formulation of embodiment 17, wherein the polysorbate 80 is present a concentration of between about 0.004% (w/v) and about 0.2% (w/v).
- Embodiment 19 The formulation of embodiment 17, wherein the polysorbate 80 is present at a concentration of about 0.02% (w/v).
- Embodiment 20 The formulation of any one of embodiments 1-19, wherein the formulation has a pH of between about 4.0 and about 8.5.
- Embodiment 21 The formulation of any one of embodiments 1-19, wherein the formulation has a pH of about 7.0.
- Embodiment 22 A method of treating a disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof, comprising administering to the subject a formulation of any one of embodiments 1-21.
- Embodiment 23 The method of embodiment 22, wherein the disease, condition, or disorder is cancer.
- Embodiment 24 The method of embodiment 23, wherein the cancer is acute lymphoblastic leukemia (ALL).
- ALL acute lymphoblastic leukemia
- Embodiment 25 The method of embodiment 24, wherein the ALL is relapsed ALL.
- Embodiment 26 The method of embodiment 23, wherein the cancer is lymphoblastic lymphoma (LBL).
- Embodiment 27 The method of embodiment 26, wherein the LBL is relapsed LBL.
- Embodiment 28 The method of any one of embodiments 22-27, wherein the formulation is administered intramuscularly.
- Embodiment 29 The method of any one of embodiments 22-27, wherein the formulation is administered intravenously.
- Embodiment 30 The method of any one of embodiments 22-29, wherein the formulation is co-administered with one or more other chemotherapeutic agents.
- Embodiment 31 A kit, comprising: (i) a formulation of any one of embodiments 1-21; and (ii) instructions for treating a disease, condition, or disorder that is treatable by asparagine depletion in a subject in need thereof.
- Embodiment 32 The kit of embodiment 31, wherein the disease, condition, or disorder is cancer.
- Embodiment 33 The kit of embodiment 32, wherein the cancer is acute lymphoblastic leukemia (ALL).
- ALL acute lymphoblastic leukemia
- Embodiment 34 The kit of embodiment 33, wherein the ALL is relapsed ALL.
- Embodiment 35 The kit of embodiment 32, wherein the cancer is lymphoblastic lymphoma (LBL).
- Embodiment 36 The kit of embodiment 35, wherein the LBL is relapsed LBL.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Inorganic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Dermatology (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Immunology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163171429P | 2021-04-06 | 2021-04-06 | |
PCT/US2022/071562 WO2022217231A1 (en) | 2021-04-06 | 2022-04-05 | Formulations of l-asparaginase |
Publications (1)
Publication Number | Publication Date |
---|---|
EP4319818A1 true EP4319818A1 (en) | 2024-02-14 |
Family
ID=81748398
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP22724215.3A Pending EP4319818A1 (en) | 2021-04-06 | 2022-04-05 | Formulations of l-asparaginase |
Country Status (12)
Country | Link |
---|---|
EP (1) | EP4319818A1 (es) |
JP (1) | JP2024515555A (es) |
KR (1) | KR20230165799A (es) |
CN (1) | CN117377494A (es) |
AR (1) | AR125301A1 (es) |
AU (1) | AU2022256071A1 (es) |
BR (1) | BR112023019862A2 (es) |
CA (1) | CA3213726A1 (es) |
CL (1) | CL2023002983A1 (es) |
CO (1) | CO2023014093A2 (es) |
MX (1) | MX2023011693A (es) |
WO (1) | WO2022217231A1 (es) |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7985548B2 (en) | 2006-03-03 | 2011-07-26 | The United States Of America As Represented By The Department Of Health And Human Services | Materials and methods directed to asparagine synthetase and asparaginase therapies |
JP7109427B2 (ja) * | 2016-06-01 | 2022-07-29 | セルヴィエ アイピー ユーケー リミテッド | ポリアルキレンオキシド-アスパラギナーゼの製剤ならびにその製造法および使用法 |
WO2021078988A1 (en) * | 2019-10-25 | 2021-04-29 | Jazz Pharmaceuticals Ireland Ltd. | Recombinant l-asparaginase |
-
2022
- 2022-04-05 KR KR1020237037007A patent/KR20230165799A/ko unknown
- 2022-04-05 AU AU2022256071A patent/AU2022256071A1/en active Pending
- 2022-04-05 CN CN202280032191.2A patent/CN117377494A/zh active Pending
- 2022-04-05 BR BR112023019862A patent/BR112023019862A2/pt unknown
- 2022-04-05 EP EP22724215.3A patent/EP4319818A1/en active Pending
- 2022-04-05 JP JP2023561628A patent/JP2024515555A/ja active Pending
- 2022-04-05 MX MX2023011693A patent/MX2023011693A/es unknown
- 2022-04-05 AR ARP220100846A patent/AR125301A1/es unknown
- 2022-04-05 CA CA3213726A patent/CA3213726A1/en active Pending
- 2022-04-05 WO PCT/US2022/071562 patent/WO2022217231A1/en active Application Filing
-
2023
- 2023-10-05 CL CL2023002983A patent/CL2023002983A1/es unknown
- 2023-10-23 CO CONC2023/0014093A patent/CO2023014093A2/es unknown
Also Published As
Publication number | Publication date |
---|---|
MX2023011693A (es) | 2023-12-15 |
KR20230165799A (ko) | 2023-12-05 |
CL2023002983A1 (es) | 2024-04-12 |
AU2022256071A1 (en) | 2023-10-19 |
BR112023019862A2 (pt) | 2023-11-07 |
WO2022217231A1 (en) | 2022-10-13 |
CA3213726A1 (en) | 2022-10-13 |
JP2024515555A (ja) | 2024-04-10 |
CO2023014093A2 (es) | 2023-10-30 |
AR125301A1 (es) | 2023-07-05 |
CN117377494A (zh) | 2024-01-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
USRE49736E1 (en) | Pegylated L-asparaginase | |
US20230173042A1 (en) | Methods of treatment with asparaginase | |
JP6416106B2 (ja) | ゴナドトロピンカルボキシ末端ペプチドに結合することによりポリペプチドの流体力学的体積を増加させる方法 | |
US9096656B2 (en) | Factor VIII conjugates | |
EP2451486B2 (en) | Pegylated l-asparaginase | |
AU2022256071A1 (en) | Formulations of l-asparaginase | |
US20240197841A1 (en) | Formulations of l-asparaginase | |
US20220323556A1 (en) | Dosing and administration of recombinant l-asparaginase | |
JP2022527322A (ja) | Fms様チロシンキナーゼ3リガンド(flt3l)ベースキメラタンパク質 | |
KR20180031775A (ko) | 긴 반감기 응집 복합체와 관련된 방법 및 조성물 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20231102 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |