EP4217376A1 - Vecteurs vaa codant pour nf1 et leurs utilisations - Google Patents

Vecteurs vaa codant pour nf1 et leurs utilisations

Info

Publication number
EP4217376A1
EP4217376A1 EP21873397.0A EP21873397A EP4217376A1 EP 4217376 A1 EP4217376 A1 EP 4217376A1 EP 21873397 A EP21873397 A EP 21873397A EP 4217376 A1 EP4217376 A1 EP 4217376A1
Authority
EP
European Patent Office
Prior art keywords
nucleic acid
isolated nucleic
raav
nucleotide sequence
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP21873397.0A
Other languages
German (de)
English (en)
Inventor
Miguel Sena ESTEVES
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Massachusetts UMass
Original Assignee
University of Massachusetts UMass
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Massachusetts UMass filed Critical University of Massachusetts UMass
Publication of EP4217376A1 publication Critical patent/EP4217376A1/fr
Pending legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/0075—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
    • C07K14/4706—Guanosine triphosphatase activating protein, GAP
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the instant application contains a sequence listing which has been submitted in ASCII format via EFS-web and is hereby incorporated by reference in its entirety.
  • the ASCII file, created on September 22, 2021 is named U012070146WO00-SEQ-SXT and is 230,444 bytes in size.
  • NF1 Neurofibromatosis type I
  • NF1 Neurofibromatosis type I
  • SPNST peripheral nerve sheath tumors
  • NF1 haploinsufficiency can cause cognitive deficits and NF1 deficiency plays an important supporting role in tumor formation.
  • the NF1 coding sequence is 8,540 bp, far exceeding the packaging capacity of recombinant AAV vectors, rendering gene therapy to correct NF1 gene mutation difficult.
  • the present disclosure relates to compositions and methods of treating certain genetic disease (e.g., Neurofibromatosis type I) by delivering functional neurofibromin 1(NF1) protein (e.g., mini-NFl protein and/or full-length NF1 protein) to target cell (e.g., cells and/or tissue of a subject).
  • NF1 protein e.g., mini-NFl protein and/or full-length NF1 protein
  • target cell e.g., cells and/or tissue of a subject.
  • the disclosure is based, in part, on isolated nucleic acids (e.g., rAAV vectors) and rAAVs engineered to express a functional NF1 protein (e.g., mini-NFl protein and/or full-length NF1 protein) or variants thereof.
  • the present disclosure provides an isolated nucleic acid comprising a transgene, wherein the transgene comprises a nucleotide sequence encoding a mini- neurofibromin (mini-NFl
  • the transgene further comprises a promoter operably linked to the nucleotide sequence encoding the mini-NFl protein.
  • the promoter is a constitutive promoter, an inducible promoter, or a minimal promoter.
  • the promoter is a chicken [3-actin (CBA) promoter, or a CAG promoter.
  • the minimal promoter is a short Mecp2 promoter, a mini-CMV promoter, or a Jet promoter.
  • the mini-NFl protein comprises a GTPase-activating protein (GAP)-related domain (GRD).
  • GAP GTPase-activating protein
  • GPD GTPase-activating protein
  • the nucleotide sequence encoding the mini-NF is codon optimized.
  • the mini-NF comprises the amino acid sequence of SEQ ID NO: 1.
  • the nucleotide sequence encoding the mini- NF comprises a nucleotide sequence at least 80% identical to SEQ ID NO: 2.
  • the mini-NFl comprises a GTPase-activating protein (GAP)- related domain (GRD) and a CRAL-TRIO domain.
  • GAP GTPase-activating protein
  • GPD GTPase-activating protein
  • CRAL-TRIO domain a GTPase-activating protein-related domain
  • the mini-NF comprises the amino acid sequence of SEQ ID NO: 3.
  • the nucleotide sequence encoding the mini-NF is codon optimized.
  • the nucleotide sequence encoding the mini-NF comprises a nucleotide sequence at least 80% identical to SEQ ID NO: 4.
  • the mini-NFl comprises a GTPase-activating protein (GAP)- related domain (GRD), a CRAL-TRIO domain and a bipartite phospholipid binding domain.
  • GAP GTPase-activating protein
  • GPD GTPase-activating protein-related domain
  • CRAL-TRIO CRAL-TRIO domain
  • bipartite phospholipid binding domain a bipartite phospholipid binding domain.
  • the mini-NF comprises the amino acid sequence of SEQ ID NO: 5.
  • the nucleotide sequence encoding the mini-NF is codon optimized.
  • the nucleotide sequence encoding the mini-NF comprises a nucleotide sequence at least 80% identical to SEQ ID NO: 6.
  • the transgene further comprises a nucleotide sequence encoding a tag operably linked to the promoter.
  • the tag is a hemagglutinin (HA) tag.
  • the transgene is flanked by adeno-associated virus (AAV) inverted terminal repeats (ITRs).
  • AAV adeno-associated virus
  • the ITRs are adeno-associated virus ITRs of a serotype selected from the group consisting of AAV1 ITR, AAV2 ITR, AAV3 ITR, AAV4 ITR, AAV5 ITR, and AAV6 ITR.
  • the ITRs are AAV2 ITR.
  • the transgene further comprises a polyadenylation signal.
  • the present disclosure provides an 5' isolated nucleic acid flanked by adeno-associated virus (AAV) inverted terminal repeats (ITRs), wherein the isolated nucleic acid comprises, from 5’ to 3’, a promoter operably linked to a nucleotide sequence encoding a first portion of NF1 protein, and a nucleotide sequence encoding a splice donor of an intron.
  • AAV adeno-associated virus
  • ITRs inverted terminal repeats
  • the nucleotide sequence encoding the first portion of NF1 protein comprises exons 1-31 of an NF1 gene. In some embodiments, the nucleotide sequence encoding the first portion of NF1 protein comprises the nucleotide sequence of SEQ ID NO: 11.
  • the promoter is a constitutive promoter, an inducible promoter, or a minimal promoter.
  • the promoter is a chicken P-actin (CBA) promoter, or a CAG promoter.
  • the minimal promoter is a short Mecp2 promoter, a mini-CMV promoter, or a Jet promoter.
  • the ITRs are adeno-associated virus ITRs of a serotype selected from the group consisting of AAV 1 ITR, AAV2 ITR, AAV3 ITR, AAV4 ITR, AAV5 ITR, and AAV6 ITR. In some embodiments, the ITRs are AAV2 ITR.
  • the intron is a human dysferlin intron.
  • the nucleotide sequence encoding the splicing donor comprises the nucleotide sequence of SEQ ID NO: 18.
  • the present disclosure also provides an 3' isolated nucleic acid flanked by adeno-associated virus (AAV) inverted terminal repeats (ITRs), wherein the isolated nucleic acid comprises, from 5’ to 3’, a nucleotide sequence encoding a splice acceptor of an intron, and a nucleotide sequence encoding a second portion of NF1 protein.
  • the isolated nucleic acid further comprises a polyadenylation signal positioned between the nucleotide sequence encoding second portion of NF1 protein and the 3' ITR.
  • the polyadenylation signal is an SV40 polyadenylation signal.
  • the nucleotide sequence encoding the second portion of NF1 protein comprises exons 32-61 of an NF1 gene. In some embodiments, the nucleotide sequence encoding the second portion of NF1 protein comprises the nucleotide sequence of SEQ ID NO: 14.
  • the ITRs are adeno-associated virus ITRs of a serotype selected from the group consisting of AAV 1 ITR, AAV2 ITR, AAV3 ITR, AAV4 ITR, AAV5 ITR, and AAV6 ITR.
  • the ITRs are AAV2 ITR.
  • the intron is a human dysferlin intron.
  • the nucleotide sequence encoding the splicing acceptor comprises the nucleotide sequence of SEQ ID NO: 19.
  • the present disclosure also provides a vector comprising the isolated nucleic acid, the 5' isolated nucleic acid, or the 3’ isolated nucleic acid as described herein.
  • the vector is a plasmid DNA, or closed-ended DNA, or lipid/DNA nanoparticle, or a viral vector.
  • the viral vector is an adeno-associated virus (AAV) vector, adenoviral (Ad) vector, lentiviral vector, retroviral vector, or Baculovirus vector.
  • the vector comprises a nucleic acid sequence of any one of SEQ ID NO: 7-19, 12, or 15.
  • the present disclosure provides a recombinant adeno-associated virus (rAAV) comprising: (i) the isolated nucleic acid encoding any of the mini-NFl protein; and (ii) an AAV capsid protein.
  • rAAV adeno-associated virus
  • the present disclosure also provides a 5' recombinant adeno-associated virus (rAAV) comprising: (i) the 5' isolated nucleic acid encoding the first portion of full-length NF1 protein; and (ii) an AAV capsid protein.
  • rAAV adeno-associated virus
  • the present disclosure also provides a 3' recombinant adeno-associated virus (rAAV) comprising: (i) the 3' isolated nucleic acid encoding the second portion of full- length NF1 protein; and (ii) an AAV capsid protein.
  • rAAV adeno-associated virus
  • the capsid protein is of a serotype selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9 and a variant thereof.
  • the capsid protein is AAV9, AAV-DJ, AAV-Anc80, AAV-PHP.B, or AAV. PHP.eB, or AAVrhlO.
  • the capsid protein has tropism for Schwann cells, peripheral neurons, optic nerve glioma cells, or cells in the central nervous system.
  • the present disclosure provides a neurofibromin (NF1) expression system comprising: the 5'rAAV; and the 3' rAAV as described herein for delivering a full-length NF1 protein to a target cell.
  • NF1 neurofibromin
  • the present disclosure provides a host cell comprising the isolated nucleic acid, the 5' isolated nucleic acid, the 3’ isolated nucleic acid, the vector, the rAAV, the 5' rAAV, the 3' rAAV, or the NF1 expression system as described herein.
  • the present disclosure provides a pharmaceutical composition comprising the isolated nucleic acid, the 5' isolated nucleic acid, the 3’ isolated nucleic acid, the vector, the rAAV, the 5' rAAV, the 3' rAAV, the NF1 expression system, or the host cell as described herein.
  • the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
  • the present disclosure also provides a method for inhibiting Ras activity in a cell, the method comprising delivering to the cell the isolated nucleic acid, the rAAV, the NF1 expression system, or the pharmaceutical composition as described herein.
  • the present disclosure also provides a method for inhibiting Ras activity in a subject in need thereof, the method comprising administering to the subject the isolated nucleic acid, the rAAV, the NF1 expression system, or the pharmaceutical composition as described herein.
  • the present disclosure also provides a method for preventing or treating an NF 1 -associated disease in a subject in need thereof, the method comprising administering to the subject the isolated nucleic acid, the rAAV, the NF1 expression system, or the pharmaceutical composition as described herein.
  • the present disclosure also provides a method for preventing or treating an Neurofibromatosis type I in a subject in need thereof, the method comprising administering to the subject the isolated nucleic acid, the rAAV, the NF1 expression system, or the pharmaceutical composition as described herein.
  • the present disclosure also provides a method for preventing or treating a cognitive dysfunction associated with NF1 in a subject in need thereof, the method comprising administering to the subject the isolated nucleic acid, the rAAV, the NF1 expression system, or the pharmaceutical composition as described herein.
  • the subject comprises one or more mutation in NF1 gene.
  • the NFl-associated disease or Neurofibromatosis type I comprises skin lesions, benign tumor, malignant tumor, and/or cognitive impairment.
  • the benign tumor is a benign neurofibroma.
  • the malignant tumor is optic pathway gliomas or malignant peripheral nerve sheath tumors (MPNST).
  • the subject is a human.
  • the subject is a non-human mammal.
  • the non-human mammal is mouse, rat, cat, dog, sheep, rabbit, horse, cow, goat, pig, guinea pig, hamster, chicken, turkey, or a non-human primate.
  • the administration is systemic administration or local administration.
  • the systemic administration is intravenous injection, intramuscular injection, or subcutaneous injection.
  • the local administration is intratumoral injection, intracranial injection, nerve injection, cerebral spinal fluid (CSF) injection via cerebral lateral ventricles, cistema magna (CM) injection, intrathecal (IT) injection, or intracerebroventricular injection.
  • the local administration is intrathecal (IT) injection.
  • the local administration is intracerebroventricular injection.
  • the administration results in delivery of a neurofibromin (NF1) protein in Schwann cells, peripheral nerve cells, or optic nerve cells.
  • the administration results in delivery of a neurofibromin (NF1) protein in any cells or areas in the CNS that is appropriate for the isolated nucleic acids and methods disclosed herein.
  • the administration of the isolated nucleic acid, the rAAV, the NF1 expression system, or the pharmaceutical composition as described herein results in reduction of tumor burden.
  • FIGs. 1A-1F show AAV vector system for mini-NFl expression.
  • FIG. 1A shows schematic illustrations of full-length NF1 genes and mini-NFl genes. Full length NF1 with some domains identified for comparison with the mini-NFl genes NF1-GAP_M, NF1-GAP_MCT and NF1-GAP_MLB.
  • FIG. IB shows AAV vector backbone with cytomegalovirus enhancer/chicken beta actin promoter (CMV enhancer/CB promoter) driving expression of mini-NFl genes fused to an HA tag at the C-terminus.
  • FIG. 1C is the rAAV vector map encoding mini-NFl having the GRD (SEQ ID NO: 7).
  • FIG. ID is the rAAV vector map encoding mini-NFl having the GRD and CRAL-TRIO domain (SEQ ID NO: 8).
  • FIG. IE is the rAAV vector map encoding mini-NFl having the GRD, CRAL-TRIO domain, and the bipartite phospholipid binding domain (SEQ ID NO: 9).
  • FIG. IF shows western blot analysis of mini-NFl protein expression at 72 hours postinfection of HEK293T cells at 3xl0 5 vg/cell.
  • FIGs. 2A-2F show dual- AAV vector system for full-length NF1 expression.
  • FIG. 2A shows the dual AAV-NF1 vector system:
  • the AAV-MeCP2p-5'NFl-intron vector carries NF1 exons 1-31 under the mouse Mecp2 229-bp promoter followed by a splice donor (SD) and part of an intron;
  • the AAV-intron.3NFl carries part of an intron with a splice acceptor (SA) followed by NF1 exons 32-61 and an SV40 polyadenylation signal (pA). All cassettes flanked by AAV2 inverted terminal repeats (ITR).
  • FIG. 1A shows the dual AAV-NF1 vector system:
  • the AAV-MeCP2p-5'NFl-intron vector carries NF1 exons 1-31 under the mouse Mecp2 229-bp promoter followed by a splice donor (SD) and part of an
  • FIG. 2B is a schematic illustration that shows, upon dual infection of target cells, full length NF1 mRNA will be generated by trans-splicing across ITR elements in concatemerized AAV genomes.
  • FIG. 2C shows trans-splicing dual AAV vector constructs.
  • AAV vector consists of a small ubiquitous promoter, 5’ sequence of NF1 cDNA and splice donor (SD) signal from NF1 intronic sequences.
  • SD splice donor
  • the 3’ AAV vector consists of splice acceptor (SA) also from NF1 intronic sequences, 3’ sequence of NF1 cDNA and HA- tag before the ploy A signal from SV40.
  • SA splice acceptor
  • FIG. 2D shows the 5' AAV vector map encoding the first portion of NF1 protein.
  • FIG. 2E shows the 3' AAV vector map encoding the first portion of NF1 protein.
  • FIG. 2F shows western blot analysis of HA-tagged full length NF1 expression in HEK293T cells at 72 hrs post-transduction with each AAV vector alone, or in combination at 3xl0 5 vg/cell.
  • FIGs. 3A-3C are graphs showing that transduction of human MPNST cell lines (ST267 and ST642) with AAV-NF1 vectors reduced Ras pathway activity.
  • FIG. 3A shows human ST267 and ST642 were transduced with increasing doses of AAV-DJ.GFP-NLS vector and GFP expression analyzed at 72 hours post-transduction.
  • FIG. 3B shows western blot analysis of NF1 expression and impact on Ras pathway activity indirectly assessed by changes in pERKl/2 levels. Cells were transduced at 3xl0 5 vg/cell and protein expression analyzed at 72 hours posttransduction. Antigens detected in each blot are shown on the left size.
  • FIG. 3C shows cell proliferation assays conducted in MPNST cells (STS26T and S462) treated with different AAV vectors encoding mini-NFl genes, trans- splicing dual AAV vectors and GFP-NLS packaged with DJ capsid.
  • FIGs. 4A-4B show MRI detection of tumors in the spinal cord of Nfl Ar 8 681 *; DhhCre mice.
  • FIG. 4 A shows MRIs of mice before and after intrathecal injection of A AV-mini NF1 vector.
  • Mouse No. 613 was a male mouse and mouse No. 003 was a female mouse that were treated with IxlO 12 vg AAV-PHP.eB-GAP_MLB-HA (mini-NFl).
  • FIG. 4B shows MRIs of mice before and after intrathecal injection of dual-AAV-NFl vectors. Both mice No. 001 and No. 002 were female mice that were treated with IxlO 12 vg dual-AAV(5’NFl+3’NFl-HA).
  • FIG. 5 shows western blot analysis of selected molecular markers of NF1 signaling in mice that were injected with PBS, IxlO 12 vg AAV-PHP.eB-GAP_MLB-HA, or IxlO 12 vg dual AAV(5’NF1+3’NF1-HA).
  • the present disclosure relates to compositions and methods of treating certain genetic disease (e.g., Neurofibromatosis type I) by delivering functional neurofibromin 1(NF1) protein (e.g., mini-NFl protein and/or full-length NF1 protein) to target cell (e.g., cells and/or tissue of a subject).
  • NF1 protein e.g., mini-NFl protein and/or full-length NF1 protein
  • target cell e.g., cells and/or tissue of a subject.
  • the disclosure is based, in part, on isolated nucleic acids (e.g., rAAV vectors) and rAAVs engineered to express a functional NF1 protein (e.g., mini-NFl protein and/or full-length NF1 protein) or variants thereof.
  • the disclosure relates to compositions and methods useful for treating certain genetic diseases, for example Neurofibromatosis type I and/or conditions associated thereof.
  • Neurofibromatosis type I is caused by sporadic or inherited germline mutations in the Neurofibromin 1 gene (NF I gene). Sporadic loss of the remaining wild-type NF1 allele is associated with skin lesions and benign neurofibromas, which develop along peripheral nerves. Malignant complications include conditions such as optic pathway gliomas and malignant peripheral nerve sheath tumors (MPNST).
  • MPNST malignant peripheral nerve sheath tumors
  • NF1 haploinsufficiency can cause cognitive deficits in Neurofibromatosis type I patients.
  • NF1 deficiency plays an important supporting role in tumor formation.
  • the NF1 protein is a GTPase-activating protein (GAP) that inactivates Ras through activation of GTP to GDP hydrolysis. Loss of NF1 GAP function leaves Ras in the activated state (Ras-GTP) with resulting over-activation of this signaling pathway (RAF-MEK-ERK) (see, e.g., Johnson et al., Neurofibromin 1 inhibits Ras-dependent growth by a mechanism independent of its GTPase-accelerating function, Mol Cell Biol. 1994 Jan; 14(1): 641-645). Ras activation stimulates cell growth and formation of benign tumors which may progress to malignancies (e.g., MPNSTs and optic gliomas).
  • GAP GTPase-activating protein
  • an NF1 protein coding sequence comprises the nucleic acid sequence set forth in NCBI Reference Sequence Accession Number NM_001042492.3 (SEQ ID NO: 16), or splice variants thereof generated by incorporation of exons 9a, 23a, or 48a.
  • an NF1 gene encodes a protein having the amino acid sequence set forth in NCBI Reference Sequence Accession Number NP_001035957.1 (SEQ ID NO: 17), or protein isoforms with additional amino acids resulting from incorporation of exons 9a, 23a, and 48a in the NF1 mRNA.
  • a wild-type full-length NF1 coding sequence comprises 61 exons.
  • the disclosure is based, in part, on isolated nucleic acids and gene therapy vectors, such as viral (e.g., rAAV) vectors, comprising a transgene, which comprises one or more nucleotide sequence encoding a therapeutic gene product, such as a functional neurofibromin 1 (NF1) protein (e.g., mini-NFl protein and/or full-length NF1 protein).
  • NF1 neurofibromin 1
  • the nucleotide sequence encoding the mini-NFl protein is within the packaging capacity of recombinant AAV vectors.
  • the full-length NF1 protein is delivered by a dual AAV vector system.
  • nucleic acid sequence refers to a DNA or RNA sequence.
  • proteins and nucleic acids of the disclosure are isolated.
  • isolated means artificially produced.
  • isolated means: (i) amplified in vitro by, for example, polymerase chain reaction (PCR); (ii) recombinantly produced by cloning; (iii) purified, as by cleavage and gel separation; or (iv) synthesized by, for example, chemical synthesis.
  • PCR polymerase chain reaction
  • recombinantly produced by cloning recombinantly produced by cloning
  • purified as by cleavage and gel separation
  • iv synthesized by, for example, chemical synthesis.
  • An isolated nucleic acid is one which is readily manipulable by recombinant DNA techniques well known in the art.
  • nucleotide sequence contained in a vector in which 5' and 3' restriction sites are known or for which polymerase chain reaction (PCR) primer sequences have been disclosed is considered isolated but a nucleic acid sequence existing in its native state in its natural host is not.
  • An isolated nucleic acid may be substantially purified, but need not be.
  • a nucleic acid that is isolated within a cloning or expression vector is not pure in that it may comprise only a tiny percentage of the material in the cell in which it resides. Such a nucleic acid is isolated, however, as the term is used herein because it is readily manipulable by standard techniques known to those of ordinary skill in the art.
  • isolated refers to a protein or peptide that has been isolated from its natural environment or artificially produced (e.g., by chemical synthesis, by recombinant DNA technology, etc.).
  • the disclosure relates to isolated nucleic acids comprising a transgene (e.g., a minigene) encoding a functional NF1 protein, such as a mini-NFl protein (e.g., a gene product expressed from a NF1 gene or a portion thereof, such as an NF1 minigene).
  • a transgene e.g., a minigene
  • mini-NFl protein e.g., a gene product expressed from a NF1 gene or a portion thereof, such as an NF1 minigene.
  • minigene refers to an isolated nucleic acid sequence encoding a recombinant peptide or protein where one or more non-essential elements of the corresponding gene encoding the naturally-occurring peptide or protein have been removed and where the peptide or protein encoded by the minigene retains function of the corresponding naturally-occurring peptide or protein.
  • a “therapeutic minigene” refers to a minigene encoding a peptide or protein useful for treatment of a genetic disease, for example dystrophin, dysferlin, Factor VIII, Amyloid precursor protein (APP), Tyrosinase (Tyr), NF1, etc.
  • Minigenes are known in the art and are described, for example by Karpati and Acsadi (1994) Clin Invest Med 17(5):499-509; Plantier et al. (2001) Thromb Haemost. 86(2):596-603; and Xiao et al. (2007) World J. Gastroenterol. 13(2):244-9.
  • a minigene does not comprise the sequence of the corresponding naturally-occurring peptide or protein.
  • an isolated nucleic acid encoding a minigene is between about 10% and about 99% (e.g., about 10%, about 15%, about 20%, about 25%, about 30%, about 40% about 50%, about 60%, about 70%, about 75%, about 80%, about 90%, about 99%, etc.) truncated with respect to a nucleic acid sequence encoding the corresponding naturally-occurring wild-type NF1 protein (e.g., SEQ ID NO: 17).
  • the truncations may be continuous (e.g., single, continuous truncation of amino acid residues) or discontinuous (e.g., two or more truncations of amino acids, for example truncation of two or more domains, that are separated by one or more peptides).
  • a minigene encoding a mini-NFl protein is truncated (e.g., comprises about less than 95%, less than 90%, less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, or less than 10% of the wild type nucleic acid sequence encoding NF1) compared to a wild-type NF1 coding sequence(e.g., SEQ ID NO: 16).
  • a nucleotide sequence encoding a mini-NFl protein comprises a start codon (e.g., the nucleic acid sequence ATG) prior to the nucleic acid sequence encoding the mini-NFl protein.
  • the nucleic acid encoding any of the NF 1 -minigene described herein are codon optimized for expression in a target cell (e.g., human cell).
  • an NF1 minigene comprises a GTPase-activating protein (GAP)- related domain (GRD) of the wildtype NF1 protein.
  • GAP GTPase-activating protein
  • GRD GTPase-activating protein
  • the GRD of NF1 protein has been shown to be responsible for GAP activity and represents a functionally defined segment of NF1 protein (see, e.g., Li,Y. et al. (1992) Somatic mutations in the neurofibromatosis 1 gene in human tumors. Cell, 69, 275-281).
  • the mini-NFl comprising the GRD domain of NF1 protein is capable of acting as a GTPase activating protein (GAP) on Ras.
  • the mini-NFl comprises (or consists of) an amino acid sequence at least 70%, at least 75%, at least 80%,, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 1 or 20.
  • SEQ ID NO: 1 An exemplary amino acid sequence of a mini-NFl protein comprising a GRD domain is set forth in SEQ ID NO: 1:
  • SEQ ID NO: 20 An exemplary amino acid sequence of a mini-NFl protein comprising a GRD domain with an HA tag (bold) is set forth in SEQ ID NO: 20:
  • the nucleotide sequence encoding the mini-NFl protein comprises a nucleotide sequence at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 2 or 21.
  • An exemplary nucleotide sequence encoding a mini-NFl having an NF1 GRD is set forth in SEQ ID NO: 2: ATGGAAGCCAAGAGCCAGCTGTTTCTGAAATACTTTACCCTGTTTATGAATCTGCTGAACGACT GTAGTGAGGTGGAGGACGAGTGCCCAGACCGGCGGCAGGAAGAGAGGCATGTCTAGGAGACT GGCCAGCCTGAGGCACTGCACAGTGCTGGCCATGTCCAACCTGCTGAACGCCAATGTGGACTCC GGCCTGATGCACTCTATCGGCCTGGGCTACCACAAGGATCTGCAGACCCGCGCCACATTCATGG AGGTGCTGACCAAGATCCTGCAGCAGGGCACCGAGTTTGACACACTGGCCGAGACCGTGCTGGC AGATAGGTTCGAGCGCCTGGTGGAGCTGGTGACAATGATGGGCGACCAGGGAGAGCTGCCTATC GCAATGGTGCCATGCAGCCAGTGGGATGATGGGCGACCAGGGAGAGCTGCCTATC GCAATG
  • An exemplary nucleotide sequence encoding a mini-NFl having an NF1 GRD with a HA tag is set forth in SEQ ID NO: 21:
  • an NF1 minigene comprises a GTPase-activating protein (GAP)- related domain (GRD) and a CRAL-TRIO domain of the wildtype NF1 protein.
  • GAP GTPase-activating protein
  • GRD GTPase-related domain
  • CRAL-TRIO domain of the wildtype NF1 protein can serve as a regulatory scaffold that binds to GRD, GTPase, and Ras to facilitate Ras suppression.
  • the mini-NFl comprising the GRD domain and the CRAL-TRIO domain of NF1 protein is capable of acting as a GTPase activating protein (GAP) on Ras.
  • GAP GTPase activating protein
  • the mini-NFl comprises (or consists of) an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 3 and 22.
  • the nucleotide sequence encoding the mini-NFl protein comprises a nucleotide sequence at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 4 and 23.
  • CRAL-TRIO is set forth in SEQ ID NO: 4:
  • an NF1 minigene comprises a GTPase-activating protein (GAP)- related domain (GRD), a CRAL-TRIO domain and a bipartite phospholipid binding domain of the wildtype NF1 protein.
  • GAP GTPase-activating protein
  • GPD GTPase-activating protein-related domain
  • CRAL-TRIO domain a CRAL-TRIO domain
  • bipartite phospholipid binding domain includes a Secl4p homologous segment and a pleckstrin homology (PH)-like domain.
  • lipid binding/interacting domains CRAL-TRIO and bipartite Sec-PH
  • CRAL-TRIO and bipartite Sec-PH were included in this mini-NFl gene to enhance interaction with Ras occurs at the cell membrane and lipid binding may be important for that interaction (see, e.g., Bai et al., Feasibility of using NF1-GRD and AAV for gene replacement therapy, Gene Therapy volume 26, pages277-286(2019)).
  • the mini-NFl comprises (or consists of) an amino acid sequence at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 5 and 24.
  • An exemplary amino acid sequence of a mini-NFl protein comprising a GRD, a CRAL- TRIO domain and a bipartite phospholipid binding domain is set forth in SEQ ID NO: 5: MEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDS GLMHS IGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELP I AMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTF CFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAI I SSSSEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNS IGAVGSAMFLRFIN PAIVSPYEAGILDKKPPPRIERGLKLMSKILQ
  • the nucleotide sequence encoding the mini-NFl protein comprises a nucleotide sequence at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 6 and 25.
  • CRAE-TRIO domain and the bipartite phospholipid binding domain is set forth in SEQ ID NO: 6:
  • An exemplary nucleotide sequence encoding a mini-NFl having an NF1 GRD, the CRAL-TRIO domain and the bipartite phospholipid binding domain with a HA tag is set forth in SEQ ID NO: 25:
  • an NF1 minigene comprises (or consists of) the nucleic acid sequence set forth in any one of SEQ ID NOs: 2, 4, or 6.
  • an NF1 minigene encodes a protein (referred to as a mini-NFl protein) that comprises (or consists of) an amino acid sequence set forth in any one of SEQ ID NOs: 1, 3, or 5.
  • the transgene encoding the mini-NFl proteins further comprises a nucleotide sequence encoding a polypeptide tag.
  • a polypeptide tag refers to polypeptide sequences that are attached to proteins to facilitate easy detection and purification of expressed proteins. In addition, they can also be used to identify potential binding partners for the protein of interest.
  • Non-limiting examples of a polypeptide tag includes a human influenza hemagglutinin (HA) tag, a FEAG tag, a Myc tag, a Maltose-binding protein (MBP) tag, a Calmodulin Binding Protein (CBP) tag, Poly-Histidine tag (His) tag, or a Glutathione-S transferase (GST) tag.
  • the polypeptide tag is an HA tag.
  • the HA tag is position at the N-terminal of the protein it is attached to (e.g., an mini-NFl protein).
  • the polypeptide tag is an HA tag.
  • the HA tag is position at the C-terminal of the protein it is attached to (e.g., an mini-NFl protein).
  • the transgene encoding the mini-NF protein does not comprise a nucleotide sequence encoding a polypeptide tag.
  • the present disclosure provides a set of isolated nucleic acids (e.g., a 5' isolated nucleic acid and/or a 3' isolated nucleic acid) each encoding a different portion of a protein (e.g., a portion of NF1 protein).
  • a set of isolated nucleic acids e.g., a 5' isolated nucleic acid and/or a 3' isolated nucleic acid
  • rAAV recombinant adeno-associated virus
  • a 5' isolated nucleic acid refers to an isolated nucleic acid comprising nucleotide sequence encoding a first portion (e.g., N-terminal portion) of a protein (e.g., full-length NF1 protein.
  • the 5' isolated nucleic acid which is flanked by adeno-associated virus (AAV) inverted terminal repeats (ITRs), comprises, from 5' to 3', a promoter operably linked to a nucleotide sequence encoding a first portion of NF1 protein, a nucleotide sequence encoding a splice donor, and a first portion of an intron.
  • AAV adeno-associated virus
  • a 3' isolated nucleic acid refers to an isolated nucleic acid comprising nucleotide sequence encoding a second portion (e.g., C-terminal portion) of a protein (e.g., full-length NF1 protein.
  • the 3' isolated nucleic acid which is flanked by adeno-associated virus (AAV) inverted terminal repeats (ITRs), comprises, from 5' to 3', a second portion of an intron, a nucleotide sequence encoding a splice acceptor, a nucleotide sequence encoding a second portion of NF1 protein.
  • AAV adeno-associated virus
  • ITRs inverted terminal repeats
  • the 3' and a polyadenylation signal positioned between the nucleotide sequence encoding a second portion of NF1 protein and the 3' ITR of the 3' isolated nucleic acid.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exon 1 of the NF1 coding sequence, and one or more exons from exons 2-61 of the wild-type NF1 coding sequence (e.g., exons 1-25, exons 1-26, exons 1-27, exons 1-28, exons 1-29, exons 1-30, exons 1-31, exons 1-32, exons 1-33, exons 1-34, exons 1-35, exons 1-36, exons 1-37, exons 1-38, exons 1-39, exons 1-40, exons 1-41, exons 1-42, exons 1-43, exons 1-44, exons 1- 45, exons 1-46, exons 1-47, exons 1-48, exons 1-49, exons 1-50, exons 1-51, exons 1-52, exons 1-53, exons 1-54, exons 1-55, exons 1-
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exon 61 of the NF1 coding sequence, and one or more exons from exons 1-60 of the wild-type NF1 coding sequence (e.g., exons 2-61, exons 3-61, exons 4-61, exons 5-61, exons 6-61, exons 7-61, exons 8-61, exons 9-61, exons 10-61, exons 11-61, exons 12-61, exons 13-61, exons 14-61, exons 15-61, exons 16-61, exons 17-61, exons 18-61, exons 19-61, exons 20-61, exons 21-61, exons 22-61, exons 23-61, exons 24-61, exons 25-61, exons 26-61, exons 27-61, exons 28-61, exons 29-61, exons 20-
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exon 1-31 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exon 32-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exon 1 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 2-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-2 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 3-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-3 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 4-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-4 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 5-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-5 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 6-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-6 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 7-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-7 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 8-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-8 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 9-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-9 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 10-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-10 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 11-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-11 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 12-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-12 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 13-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-13 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 14-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-14 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 15-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-15 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 16-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-16 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 17-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-17 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 18-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-18 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 19-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-19 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 20-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-20 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 21-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-21 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 22-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-22 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 23-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-23 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 24-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-24 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 25-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-25 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 25-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-26 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 27-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-28 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 29-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-30 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 31-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-32 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 33-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-33 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 34-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-34 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 35-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-35 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 36-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-36 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 37-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-37 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 38-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-38 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 39-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-39 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 40-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-40 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 41-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-41 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 42-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-42 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 43-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-43 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 44-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-44 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 45-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-46 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 47-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-47 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 48-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-48 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 49-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-49 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 50-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-50 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 51-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-51 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 52-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-52 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 53-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-53 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 54-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-54 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 55-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-55 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 56-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-56 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 57-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-57 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 58-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-59 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exons 60-61 of the NF1 coding sequence.
  • the 5' isolated nucleic acid comprises a nucleotide sequence of exons 1-60 of the NF1 coding sequence
  • the 3' isolated nucleic acid comprises a nucleotide sequence of exon 61 of the NF1 coding sequence.
  • the nucleotide sequence encoding a first portion of the NF1 protein comprises exons 1-31 of the wild-type NF1 coding sequence.
  • the first portion of the NF1 protein comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 10.
  • An exemplary amino acid sequence of the first portion of the NF1 protein is set forth in SEQ ID NO: 10: MAAHRPVEWVQAVVSRFDEQLP IKTGQQNTHTKVSTEHNKECLINI SKYKFSLVI SGLTTILKN VNNMRIFGEAAEKNLYLSQLI ILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGN QHAAELRNSASGVLFSLSCNNFNAVFSRI STRLQELTVCSEDNVDVHDIELLQYINVDCAKLKR LLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGF AESTKRKAAVWPLQI ILLILCPEI IQDI SKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESA AIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGSQPADVDLMID
  • the nucleotide sequence encoding the first portion of the NF1 protein (e.g., exons 1-31) is at least at least 50%, at least 60%, at least 70%, at least 75%, at least 80%,, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 11.
  • a nucleotide sequence encoding the first portion of the NF1 protein is set forth in SEQ ID NO: 11.
  • the nucleotide sequence encoding a second portion of the NF1 protein comprises exons 32-61 of the wild-type NF1 coding sequence.
  • the second portion of the NF1 protein comprises an amino acid sequence at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to SEQ ID NOs: 13 or 26.
  • a nucleotide sequence encoding the second portion of the NF1 protein is set forth in SEQ ID NO: 14: GTGGTTAGCCAGCGTTTCCCTCAGAACAGCATCGGTGCAGTAGGAAGTGCCATGTTCCTCAGAT TTATCAATCCTGCCATTGTCTCACCGTATGAAGCAGGGATTTTAGATAAAAAGCCACCACCTAG AATCGAAAGGGGCTTGAAGTTAATGTCAAAGATACTTCAGAGTATTGCCAATCATGTTCTCTTC ACAAAAGAAGAACATATGCGGCCTTTCAATGATTTTGTGAAAAGCAACTTTGATGCAGCACGCA GGTTTTTCCTTGATATAGCATCTGATTGTCCTACAAGTGATGCAGTAAATCATAGTCTTTCCTT CATAAGTGACGGCAATGTGCTTTACATCGTCTACTCTGGAACAATCAGGAGAAAATTGGG CAGTATCTTTCCAGCAACAGGGATCATAAAGCTGTTGGAAGACGACCTTTTGATAAGATGGCAA CACTTCTTGG
  • a nucleotide sequence encoding the second portion of the NF1 protein with a HA tag is set forth in SEQ ID NO: 27:
  • the 3' isolated nucleic acid further comprises a polyadenylation signal positioned between the nucleotide sequence encoding a second portion of NF1 protein and the 3' ITR. Any of the polyadenylation signal described herein can be used in the 3' isolated nucleic. In some embodiments, the polyadenylation signal is an SV40 polyadenylation signal.
  • the 3' isolated nucleic acid further comprises a nucleotide sequence encoding a polypeptide tag.
  • a polypeptide tag includes a human influenza hemagglutinin (HA) tag, a FLAG tag, a Myc tag, a Maltose-binding protein (MBP) tag, a Calmodulin Binding Protein (CBP) tag, Poly-Histidine tag (His) tag, or a Glutathione-S transferase (GST) tag.
  • HA human influenza hemagglutinin
  • FLAG tag FLAG tag
  • Myc tag a Maltose-binding protein
  • CBP Calmodulin Binding Protein
  • His Poly-Histidine tag
  • GST Glutathione-S transferase
  • the polypeptide tag is a HA tag.
  • the HA tag is position at the C-terminal of the protein it is attached to (e.g., the second portion of the full-length NF1 protein).
  • the 3' isolated nucleic acid does not comprise a nucleotide sequence encoding a polypeptide tag.
  • the 5' isolated nucleic acid further comprises nucleotide sequence encoding a splice donor located of an intron between the nucleotide sequence encoding the first portion of a protein (e.g., NF1 protein) and the 3' ITR.
  • the 3' isolated nucleic acid comprises a nucleotide sequence encoding a splice acceptor of an intron between the 5' ITR and the nucleotide sequence encoding the second portion of a protein (e.g., NF1 protein).
  • the splice donor in the 5' isolated nucleic acid and the splice acceptor in the 3' isolated nucleic acid are derived from the same intron. Any intronic splice donor/splice acceptor sequence can be used in the 5' and 5' isolated nucleic acid described herein.
  • the intron is a human dysferlin intron.
  • the nucleotide sequence encoding the splicing donor comprises a nucleotide sequence at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% identical to SEQ ID NO: 18.
  • An exemplary nucleotide sequence of a splicing donor is set forth in SEQ ID NO: 18.
  • the nucleotide sequence encoding the splicing acceptor comprises a nucleotide sequence at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% identical to SEQ ID NO: 19.
  • An exemplary nucleotide sequence of a splicing donor is set forth in SEQ ID NO: 19. GCAAATTAGGACCGAGAGTCAGTGGCCGCTCAAGAGTCTGTGACCATGCCCCAAATTCAGAGAT GGTCCCAGGAGAGATGGGGGGAACTGCCAAGCAATGAGTGACCGGTTCCCCCTCCCCCAG
  • identity refers to the measurement or calculation of the percent of identical matches between two or more sequences with gap alignments addressed by a mathematical model, algorithm, or computer program that is known to one of ordinary skill in the art.
  • the percent identity of two sequences may, for example, be determined using Basic Local Alignment Search Tool (BLAST®) such as NBLAST® and XBLAST® programs (version 2.0).
  • BLAST® Basic Local Alignment Search Tool
  • Alignment technique such as Clustal Omega may be used for multiple sequence alignments.
  • Other algorithms or alignment methods may include but are not limited to the Smith- Waterman algorithm, the Needleman-Wunsch algorithm, or Fast Optimal Global Sequence Alignment Algorithm (FOGSAA).
  • the present disclosure provides a 5' isolated nucleic acid encoding a first portion of a protein (e.g., NF1 protein) and a 3' isolated nucleic acid encoding a second portion of a protein (e.g., NF1 protein) in a way (e.g., delivered to the same target cell by a 5' rAAV comprising the 5' isolated nucleic acid and an 3' rAAV comprising the 3' isolated nucleic acid ) that the two isolated nucleic acids form a full length (e.g., NF1 protein) mRNA in a target cell after transcription and trans- splicing.
  • a 5' isolated nucleic acid encoding a first portion of a protein (e.g., NF1 protein) and a 3' isolated nucleic acid encoding a second portion of a protein (e.g., NF1 protein) in a way (e.g., delivered to the same target cell by a 5' rAAV
  • the two isolated nucleic acid would go through head to tail concatemerization from 3’ ITR of the 5' isolated nucleic acid and 5’ ITR of the 3' isolated nucleic acid such that the two isolated nucleic acids are combined in one single AAV genome.
  • the mRNA comprises the NF1 first portion mRNA, splicing sites including the splicing donor, concactemerized ITR, and splicing acceptor, and NF1 second portion mRNA.
  • Trans-splicing refers to a special form of RNA processing where exons from two different primary RNA transcripts are joined end to end and ligated. It is usually found in eukaryotes and mediated by the spliceosome. In eukaryotic cells, mRNA splicing occurs at intronic sites. A splice donor (e.g., 5' end of the intron) and a splice acceptor (e.g., 3' end of the intron) are required for splicing.
  • a splice donor e.g., 5' end of the intron
  • a splice acceptor e.g., 3' end of the intron
  • the spliceosome in the cell will then splice out the splicing sites, thereby stitching the NF1 first portion mRNA and NF1 second portion mRNA to form a complete mRNA encoding a full-length NF1.
  • An isolated nucleic acid sequence described herein may further comprise a promoter operably linked to the coding sequences (e.g., NF1 minigenes, or the nucleotide sequence encoding the first portion of the NF1 protein).
  • a "promoter” refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a gene.
  • a promoter is in the correct location and orientation in relation to the nucleic acid to control RNA polymerase initiation and expression of the gene.
  • a promoter may be a constitutive promoter, inducible promoter, or a tissue-specific promoter.
  • constitutive promoters include, without limitation, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al., Cell, 41:521-530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the P-actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFla promoter [Invitrogen] .
  • a promoter comprises a chicken beta-actin (CBA) promoter.
  • a promoter is an enhanced chicken P-actin promoter. In some embodiments, a promoter is a U6 promoter. In some embodiments, a promoter is a chicken beta-actin (CBA) promoter. In some embodiments, the promoter is a minimal promoter. In some embodiments, the promoter is a mini-CMV promoter. In some embodiments, the promoter is a jet promoter. In some embodiments, the promoter is a short Mecp2 promoter. In some embodiments, the transgene encoding the mini-NFl proteins comprises a CBA promoter. In some embodiments, the 5' isolated nucleic acid described herein comprises a short Mecp2 promoter.
  • Inducible promoters allow regulation of gene expression and can be regulated by exogenously supplied compounds, environmental factors such as temperature, or the presence of a specific physiological state, e.g., acute phase, a particular differentiation state of the cell, or in replicating cells only.
  • Inducible promoters and inducible systems are available from a variety of commercial sources, including, without limitation, Invitrogen, Clontech and Ariad. Many other systems have been described and can be readily selected by one of skill in the art.
  • inducible promoters regulated by exogenously supplied promoters include the zinc-inducible sheep metallothionine (MT) promoter, the dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV) promoter, the T7 polymerase promoter system (WO 98/10088); the ecdysone insect promoter (No et ah, Proc. Natl. Acad. Sci. USA, 93:3346-3351 (1996)), the tetracycline -repressible system (Gossen et ah, Proc. Natl. Acad. Sci.
  • MT zinc-inducible sheep metallothionine
  • Dex dexamethasone
  • MMTV mouse mammary tumor virus
  • T7 polymerase promoter system WO 98/10088
  • ecdysone insect promoter No et ah, Proc. Natl. Acad. Sci. USA, 93:3346
  • inducible promoters which may be useful in this context are those which are regulated by a specific physiological state, e.g., temperature, acute phase, a particular differentiation state of the cell, or in replicating cells only.
  • the regulatory sequences impart tissue-specific gene expression capabilities.
  • the tissue-specific regulatory sequences bind tissue-specific transcription factors that induce transcription in a tissue specific manner.
  • tissue-specific regulatory sequences e.g., promoters, enhancers, etc.
  • the tissue-specific promoter is a neuron- specific promoter.
  • a promoter is a RNA polymerase III (pol III) promoter.
  • pol III promoters include U6 and Hl promoter sequences.
  • a promoter is a RNA polymerase II (pol II) promoter.
  • pol II promoters include T7, T3, SP6, RSV, and cytomegalovirus promoter sequences.
  • a gene therapy vector may be a viral vector (e.g., a lentiviral vector, an adeno-associated virus vector, an adenoviral (Ad) vector, etc.), a plasmid, a closed-ended DNA (e.g., ceDNA), a lipid/DNA nanoparticle, etc.
  • a gene therapy vector is a viral vector.
  • a transgene encoding a mini protein (e.g., mini-NFl protein) is flanked by one or more viral replication sequences, for example lentiviral long terminal repeats (LTRs) or adeno-associated virus (AAV) inverted terminal repeats (ITRs).
  • a viral vector is a Baculovirus vector.
  • the 5' isolated nucleic acid and the 3' isolated nucleic acid for expressing full- length NF1 protein are flanked by one or more viral replication sequences, for example lentiviral long terminal repeats (LTRs) or adeno-associated virus (AAV) inverted terminal repeats (ITRs).
  • a viral vector is a Baculovirus vector.
  • the isolated nucleic acids of the disclosure may be recombinant adeno-associated virus (AAV) vectors (rAAV vectors).
  • AAV adeno-associated virus
  • an isolated nucleic acid as described by the disclosure comprises a region (e.g., a first region) comprising a first adeno-associated virus (AAV) inverted terminal repeat (ITR), or a variant thereof.
  • the isolated nucleic acid e.g., the recombinant AAV vector
  • “Recombinant AAV (rAAV) vectors” are typically composed of, at a minimum, a transgene and its regulatory sequences, and 5' and 3' AAV inverted terminal repeats (ITRs).
  • the isolated nucleic acids may comprise, as disclosed elsewhere herein, one or more regions that encode one or more proteins (e.g., mini-NFl protein, or a portion of NF1 protein).
  • the isolated nucleic acids may also comprise a region encoding, for example, a miRNA binding site, and/or an expression control sequence (e.g., a poly-A tail).
  • ITR sequences are about 145 bp in length. Preferably, substantially the entire sequences encoding the ITRs are used in the molecule, although some degree of minor modification of these sequences is permissible. The ability to modify these ITR sequences is within the skill of the art. (See, e.g., texts such as Sambrook et al., "Molecular Cloning. A Laboratory Manual", 2d ed., Cold Spring Harbor Laboratory, New York (1989); and K. Fisher et al., J Virol., 70:520 532 (1996)).
  • the isolated nucleic acid (e.g., the rAAV vector) comprises at least one ITR having a serotype selected from AAV1, AAV2, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, and variants thereof.
  • the isolated nucleic acid comprises a region (e.g., a first region) encoding an AAV2 ITR.
  • the isolated nucleic acid further comprises a region (e.g., a second region, a third region, a fourth region, etc.) comprising a second AAV ITR.
  • the second AAV ITR has a serotype selected from AAV1, AAV2, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAV10, AAV11, and variants thereof.
  • the second AAV ITR is an AAV2 ITR.
  • the second ITR is a mutant ITR that lacks a functional terminal resolution site (TRS).
  • lacking a terminal resolution site can refer to an AAV ITR that comprises a mutation (e.g., a sense mutation such as a non- synonymous mutation, or missense mutation) that abrogates the function of the terminal resolution site (TRS) of the ITR, or to a truncated AAV ITR that lacks a nucleic acid sequence encoding a functional TRS (e.g., a ATRS ITR, or AITR).
  • TRS terminal resolution site
  • a rAAV vector comprising an ITR lacking a functional TRS produces a self- complementary rAAV vector, for example as described by McCarthy (2008) Molecular Therapy 16(10):1648-1656.
  • an isolated nucleic acid described herein may also contain an intron, desirably located between the promoter/enhancer sequence and the transgene.
  • an intron is a synthetic or artificial (e.g., heterologous) intron.
  • synthetic introns include an intron sequence derived from SV-40 (referred to as the SV-40 T intron sequence) and intron sequences derived from chicken beta-actin gene.
  • a transgene described by the disclosure comprises one or more (1, 2, 3, 4, 5, or more) artificial introns.
  • the one or more artificial introns are positioned between a promoter and a nucleotide sequence encoding a transgene.
  • the rAAV vector described herein comprises a posttranscriptional response element.
  • posttranscriptional response element refers to a nucleic acid sequence that, when transcribed, adopts a tertiary structure that enhances expression of a gene.
  • posttranscriptional regulatory elements include, but are not limited to, woodchuck hepatitis virus posttranscriptional regulatory element (WPRE), mouse RNA transport element (RTE), constitutive transport element (CTE) of the simian retrovirus type 1 (SRV-1), the CTE from the Mason-Pfizer monkey virus (MPMV), and the 5' untranslated region of the human heat shock protein 70 (Hsp70 5'UTR).
  • WPRE woodchuck hepatitis virus posttranscriptional regulatory element
  • RTE mouse RNA transport element
  • CTE constitutive transport element
  • SCTE constitutive transport element
  • Hsp70 5'UTR the rAAV vector comprises a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE).
  • the vector further comprises conventional control elements which are operably linked with elements of the transgene in a manner that permits its transcription, translation and/or expression in a cell transfected with the vector or infected with the virus produced by the disclosure.
  • "operably linked" sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
  • Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation (polyA) signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (e.g., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product.
  • RNA processing signals such as splicing and polyadenylation (polyA) signals
  • sequences that stabilize cytoplasmic mRNA sequences that enhance translation efficiency (e.g., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product.
  • polyA polyadenylation
  • a number of expression control sequences including promoters which are native, constitutive, inducible and/or tissue-specific, are known in the art and may be utilized.
  • a polyadenylation sequence generally is inserted following the coding sequences and optionally before a 3' AAV ITR sequence.
  • a rAAV construct useful in the disclosure may also contain an intron, desirably located between the promoter/enhancer sequence and the transgene.
  • One possible intron sequence is derived from SV-40, and is referred to as the SV-40 T intron sequence.
  • Another vector element that may be used is an internal ribosome entry site (IRES).
  • An IRES sequence is used to produce more than one polypeptide from a single gene transcript.
  • An IRES sequence would be used to produce a protein that contain more than one polypeptide chains.
  • the rAAV vector encoding the mini-NFl proteins comprises a nucleic acid as set forth in SEQ ID NOs: 7-9 or 28-30.
  • An exemplary AAV vector sequence encoding a mini-NFl having an NF1 GRD is set forth in SEQ ID NO: 7: CCTGCAGGCAGCTGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGC GACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATC ACTAGGGGTTCCTGCGGCCAGATCTTCAATATTGGCCATTAGCCATATTATTCATTGGTTATAT AGCATAAATCAATATTGGCTATTGGCCATTGCATACGTTGTATCTATATCATAATATGTACATT TATATTGGCTCATGTCCAATATGACCGCCATGTTGGCATTGATTATTGACTAGTTATTAATAGT AATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGT AAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTT CCCATAGTAACGCCAATAGG
  • An exemplary AAV vector sequence encoding a mini-NFl having an NF1 GRD, the CRAL-TRIO domain and the bipartite phospholipid binding domain is set forth in SEQ ID NO: 9:
  • HA tag is set forth in SEQ ID NO: 28:
  • An exemplary AAV vector sequence encoding a mini-NFl having an NF1 GRD, the CRAL-TRIO domain and the bipartite phospholipid binding domain with a HA tag is set forth in SEQ ID NO: 30:
  • the 5' AAV vector and the 3' AAV vector encoding the full- length NF1 proteins comprises a nucleic acid as set forth in SEQ ID NOs: 12 and 15 or 31.
  • An exemplary 5' AAV vector sequence comprising the 5' isolated nucleic acid of the dual AAV vector system encoding full-length NF1 protein is set forth in SEQ ID NO: 12: CCTGCAGGCAGCTGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGC GACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATC ACTAGGGGTTCCTGCGGCCAGATCTGTCGACAATTGAGGGCGTCACCGCTAAGGCTCCGCCCCA GCCTGGGCTCCACAACCAATGAAGGGTAATCTCGACAAAGAGAGCAAGGGGTGGGGCGCGGGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCGCG
  • An exemplary 3' AAV vector sequence comprising the 3' isolated nucleic acid of the dual AAV vector system encoding full-length NF1 protein is set forth in SEQ ID NO: 15: CCTGCAGGCAGCTGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGC GACCTTTGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGCCAACTCCATC ACTAGGGGTTCCTGCGGCCAGATCTGCAAATTAGGACCGAGAGTCAGTGGCCGCTCAAGAGTCT GTGACCATGCCCCAAATTCAGAGATGGTCCCAGGAGAGATGGGGGGAACTGCCAAGCAATGAGT GACCGGTTCCCCCTCCCCCAGGTGGTTAGCCAGCGTTTCCCTCAGAACAGCATCGGTGCAGTAG GAAGTGCCATGTTCCTCAGATTTATCAATCCTGCCATTGTCACCGTATGAAGCAGGGATTTT AGATAAAAAGCCACCACCTAGAATCGAAAGGGGCTTCC
  • An exemplary 3' AAV vector sequence comprising the 3' isolated nucleic acid of the dual AAV vector system encoding full-length NF1 protein with a HA tag is set forth in SEQ ID NO: 1

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Microbiology (AREA)
  • Virology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

La divulgation, selon divers aspects, concerne des compositions et des méthodes de traitement de certaines maladies génétiques (par exemple, la neurofibromatose de type I) par administration d'une protéine neurofibromine 1 fonctionnelle (NF1) (par exemple, une protéine mini-NFl et/ou une protéine NF1 pleine longueur) à une cellule cible (par exemple, des cellules et/ou un tissu d'un sujet). La divulgation est basée, en partie, sur des acides nucléiques isolés (par exemple, des vecteurs rVAA) et des vecteurs rVAA modifiés pour exprimer une protéine NF1 fonctionnelle (par exemple, une protéine mini-NFl et/ou une protéine NF1 pleine longueur) ou certains de leurs variants.
EP21873397.0A 2020-09-24 2021-09-23 Vecteurs vaa codant pour nf1 et leurs utilisations Pending EP4217376A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063082513P 2020-09-24 2020-09-24
PCT/US2021/051667 WO2022066849A1 (fr) 2020-09-24 2021-09-23 Vecteurs vaa codant pour nf1 et leurs utilisations

Publications (1)

Publication Number Publication Date
EP4217376A1 true EP4217376A1 (fr) 2023-08-02

Family

ID=80740027

Family Applications (1)

Application Number Title Priority Date Filing Date
EP21873397.0A Pending EP4217376A1 (fr) 2020-09-24 2021-09-23 Vecteurs vaa codant pour nf1 et leurs utilisations

Country Status (3)

Country Link
US (2) US11401531B2 (fr)
EP (1) EP4217376A1 (fr)
WO (1) WO2022066849A1 (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024080311A1 (fr) * 2022-10-12 2024-04-18 昌和 栗田 Procédé d'introduction de gène, procédé de thérapie génique et procédé de régénération de tissus

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002088346A2 (fr) * 2001-05-01 2002-11-07 National Research Council Of Canada Systeme destine a l'expression inductible dans des cellules eucariotes
DK1310571T3 (da) 2001-11-13 2006-06-19 Univ Pennsylvania Fremgangsmåde til identifikation af ukendte adeno-associerede virussekvenser (AAV-sekvenser) og et kit til fremgangsmåden
ATE512232T1 (de) * 2003-12-03 2011-06-15 Chugai Pharmaceutical Co Ltd Expressionssystem mit einem säuger-beta-actin- promotor
WO2008061213A2 (fr) * 2006-11-16 2008-05-22 Genentech, Inc. Variations génétiques associées à des tumeurs
US9988687B2 (en) * 2011-09-20 2018-06-05 The George Washington Univeristy Companion diagnostics for cancer and screening methods to identify companion diagnostics for cancer based on splicing variants
WO2013075008A1 (fr) * 2011-11-16 2013-05-23 University Of Florida Research Foundation Inc. Systèmes de vecteur double aav pour une thérapie génique

Also Published As

Publication number Publication date
US20220090135A1 (en) 2022-03-24
US11401531B2 (en) 2022-08-02
US20230002787A1 (en) 2023-01-05
WO2022066849A1 (fr) 2022-03-31

Similar Documents

Publication Publication Date Title
AU2023200880B2 (en) Minigene therapy
US20220177539A1 (en) Gene therapies for stargardt disease (abca4)
US20230416757A1 (en) Sod1 dual expression vectors and uses thereof
US20220202959A1 (en) Gene therapies for usher syndrome (ush2a)
US20230002787A1 (en) Aav vectors encoding nf1 and uses thereof
US20220233720A1 (en) Minigene therapy
US20220175967A1 (en) Gene therapies for usher syndrome (ush1b)
US20220162570A1 (en) Aav-mediated gene therapy for maple syrup urine disease (msud)
US20210228739A1 (en) Raav vectors encoding of lysosomal beta-galactosidase (glb1) and cathepsin a
WO2020210592A1 (fr) Thérapie génique par vaa recombinant pour une déficience en ngly1
WO2022232169A1 (fr) Thérapie génique pour la modulation de bcaa dans la maladie des urines à odeur de sirop d'érable (msud)
WO2023147584A2 (fr) Compositions et méthodes de traitement de la sialidose
WO2022232041A1 (fr) Thérapies géniques pour la maladie de stargardt (abca4)
WO2023201329A1 (fr) Silençage génique par vaa-microarn recombinant dans la maladie d'alexander

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20230224

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)