EP4211242A1 - Compositions and methods for treatment of duchenne muscular dystrophy - Google Patents
Compositions and methods for treatment of duchenne muscular dystrophyInfo
- Publication number
- EP4211242A1 EP4211242A1 EP21786687.0A EP21786687A EP4211242A1 EP 4211242 A1 EP4211242 A1 EP 4211242A1 EP 21786687 A EP21786687 A EP 21786687A EP 4211242 A1 EP4211242 A1 EP 4211242A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- nucleic acid
- sequence
- seq
- composition
- nos
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 398
- 238000000034 method Methods 0.000 title claims abstract description 215
- 206010013801 Duchenne Muscular Dystrophy Diseases 0.000 title claims abstract description 119
- 150000007523 nucleic acids Chemical class 0.000 claims description 1009
- 108020005004 Guide RNA Proteins 0.000 claims description 989
- 102000039446 nucleic acids Human genes 0.000 claims description 908
- 108020004707 nucleic acids Proteins 0.000 claims description 908
- 125000006850 spacer group Chemical group 0.000 claims description 569
- 239000002773 nucleotide Substances 0.000 claims description 315
- 125000003729 nucleotide group Chemical group 0.000 claims description 313
- 239000013598 vector Substances 0.000 claims description 180
- 108091033409 CRISPR Proteins 0.000 claims description 148
- 101100166144 Staphylococcus aureus cas9 gene Proteins 0.000 claims description 140
- 230000000295 complement effect Effects 0.000 claims description 110
- 230000002441 reversible effect Effects 0.000 claims description 98
- 210000004027 cell Anatomy 0.000 claims description 87
- 108010042407 Endonucleases Proteins 0.000 claims description 85
- 102100031780 Endonuclease Human genes 0.000 claims description 80
- 241001134656 Staphylococcus lugdunensis Species 0.000 claims description 80
- 230000004048 modification Effects 0.000 claims description 75
- 238000012986 modification Methods 0.000 claims description 75
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 74
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 74
- 239000013603 viral vector Substances 0.000 claims description 72
- 108090000623 proteins and genes Proteins 0.000 claims description 71
- 101150015424 dmd gene Proteins 0.000 claims description 64
- 108010077850 Nuclear Localization Signals Proteins 0.000 claims description 62
- 208000009869 Neu-Laxova syndrome Diseases 0.000 claims description 61
- 239000013607 AAV vector Substances 0.000 claims description 58
- 230000030648 nucleus localization Effects 0.000 claims description 50
- 241000649044 Adeno-associated virus 9 Species 0.000 claims description 41
- 102100038895 Myc proto-oncogene protein Human genes 0.000 claims description 38
- 101710135898 Myc proto-oncogene protein Proteins 0.000 claims description 38
- 101710150448 Transcriptional regulator Myc Proteins 0.000 claims description 38
- 238000001727 in vivo Methods 0.000 claims description 36
- 108020004485 Nonsense Codon Proteins 0.000 claims description 35
- 238000003780 insertion Methods 0.000 claims description 26
- 230000037431 insertion Effects 0.000 claims description 26
- 108020004414 DNA Proteins 0.000 claims description 25
- 108010069091 Dystrophin Proteins 0.000 claims description 24
- 238000011144 upstream manufacturing Methods 0.000 claims description 23
- 108091027544 Subgenomic mRNA Proteins 0.000 claims description 22
- 230000008488 polyadenylation Effects 0.000 claims description 21
- 102000002488 Nucleoplasmin Human genes 0.000 claims description 20
- 108060005597 nucleoplasmin Proteins 0.000 claims description 20
- 241000702421 Dependoparvovirus Species 0.000 claims description 19
- 210000003205 muscle Anatomy 0.000 claims description 18
- 239000012634 fragment Substances 0.000 claims description 15
- 238000000338 in vitro Methods 0.000 claims description 15
- 102100036912 Desmin Human genes 0.000 claims description 11
- 108010044052 Desmin Proteins 0.000 claims description 11
- 210000005045 desmin Anatomy 0.000 claims description 11
- 108020005067 RNA Splice Sites Proteins 0.000 claims description 10
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 claims description 9
- 101000910035 Streptococcus pyogenes serotype M1 CRISPR-associated endonuclease Cas9/Csn1 Proteins 0.000 claims description 8
- 210000001519 tissue Anatomy 0.000 claims description 7
- 241001655883 Adeno-associated virus - 1 Species 0.000 claims description 6
- 241000702423 Adeno-associated virus - 2 Species 0.000 claims description 6
- 108700024394 Exon Proteins 0.000 claims description 6
- 150000004713 phosphodiesters Chemical class 0.000 claims description 6
- 241000202702 Adeno-associated virus - 3 Species 0.000 claims description 5
- 241000580270 Adeno-associated virus - 4 Species 0.000 claims description 5
- 241001634120 Adeno-associated virus - 5 Species 0.000 claims description 5
- 241000972680 Adeno-associated virus - 6 Species 0.000 claims description 5
- 241001164823 Adeno-associated virus - 7 Species 0.000 claims description 5
- 241001164825 Adeno-associated virus - 8 Species 0.000 claims description 5
- 208000009889 Herpes Simplex Diseases 0.000 claims description 5
- 108010059343 MM Form Creatine Kinase Proteins 0.000 claims description 5
- 206010046865 Vaccinia virus infection Diseases 0.000 claims description 5
- 230000002950 deficient Effects 0.000 claims description 5
- 150000002632 lipids Chemical class 0.000 claims description 5
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 claims description 5
- 239000002105 nanoparticle Substances 0.000 claims description 5
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 5
- 208000007089 vaccinia Diseases 0.000 claims description 5
- 102100034343 Integrase Human genes 0.000 claims description 4
- 108010061833 Integrases Proteins 0.000 claims description 4
- 230000005782 double-strand break Effects 0.000 claims description 4
- 102000004169 proteins and genes Human genes 0.000 description 62
- 125000005647 linker group Chemical group 0.000 description 61
- 150000001413 amino acids Chemical class 0.000 description 49
- 101710163270 Nuclease Proteins 0.000 description 36
- 235000000346 sugar Nutrition 0.000 description 30
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 22
- 108010081734 Ribonucleoproteins Proteins 0.000 description 14
- 102000004389 Ribonucleoproteins Human genes 0.000 description 14
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 14
- 238000006467 substitution reaction Methods 0.000 description 14
- 238000010354 CRISPR gene editing Methods 0.000 description 13
- 108091028113 Trans-activating crRNA Proteins 0.000 description 13
- -1 aryl phosphonates Chemical class 0.000 description 13
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 11
- 208000035657 Abasia Diseases 0.000 description 10
- 230000004075 alteration Effects 0.000 description 10
- 201000010099 disease Diseases 0.000 description 10
- 230000000694 effects Effects 0.000 description 10
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 9
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 9
- 239000002777 nucleoside Substances 0.000 description 9
- 125000003835 nucleoside group Chemical class 0.000 description 9
- 108700019146 Transgenes Proteins 0.000 description 8
- 238000010362 genome editing Methods 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 108020005345 3' Untranslated Regions Proteins 0.000 description 7
- 108091026890 Coding region Proteins 0.000 description 7
- 108090000848 Ubiquitin Proteins 0.000 description 7
- 102000044159 Ubiquitin Human genes 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 6
- 102000001039 Dystrophin Human genes 0.000 description 6
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 6
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 6
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 102000034287 fluorescent proteins Human genes 0.000 description 6
- 108091006047 fluorescent proteins Proteins 0.000 description 6
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 6
- 239000007787 solid Substances 0.000 description 6
- 102000004533 Endonucleases Human genes 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 229910019142 PO4 Inorganic materials 0.000 description 5
- 241000193996 Streptococcus pyogenes Species 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 150000003833 nucleoside derivatives Chemical class 0.000 description 5
- 235000021317 phosphate Nutrition 0.000 description 5
- 150000008163 sugars Chemical class 0.000 description 5
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 4
- 108091093037 Peptide nucleic acid Proteins 0.000 description 4
- 241000191967 Staphylococcus aureus Species 0.000 description 4
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 4
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 4
- 125000000217 alkyl group Chemical group 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 229910052799 carbon Inorganic materials 0.000 description 4
- 238000007385 chemical modification Methods 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 108010041758 cleavase Proteins 0.000 description 4
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical group NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 4
- 230000009977 dual effect Effects 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 238000010172 mouse model Methods 0.000 description 4
- 239000010452 phosphate Substances 0.000 description 4
- 108010054624 red fluorescent protein Proteins 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 125000001424 substituent group Chemical group 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 3
- 125000003282 alkyl amino group Chemical group 0.000 description 3
- 125000001769 aryl amino group Chemical group 0.000 description 3
- 125000003118 aryl group Chemical group 0.000 description 3
- 125000004429 atom Chemical group 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 3
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 125000000753 cycloalkyl group Chemical group 0.000 description 3
- 125000004663 dialkyl amino group Chemical group 0.000 description 3
- 125000004986 diarylamino group Chemical group 0.000 description 3
- 125000005240 diheteroarylamino group Chemical group 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 125000005843 halogen group Chemical group 0.000 description 3
- 125000005241 heteroarylamino group Chemical group 0.000 description 3
- 125000000623 heterocyclic group Chemical group 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 201000006938 muscular dystrophy Diseases 0.000 description 3
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 125000004437 phosphorous atom Chemical group 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 229940068917 polyethylene glycols Drugs 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 102000040430 polynucleotide Human genes 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 239000002157 polynucleotide Substances 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 125000000548 ribosyl group Chemical group C1([C@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 229940104230 thymidine Drugs 0.000 description 3
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 3
- 229940045145 uridine Drugs 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- UVBYMVOUBXYSFV-XUTVFYLZSA-N 1-methylpseudouridine Chemical compound O=C1NC(=O)N(C)C=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 UVBYMVOUBXYSFV-XUTVFYLZSA-N 0.000 description 2
- ZXIATBNUWJBBGT-JXOAFFINSA-N 5-methoxyuridine Chemical compound O=C1NC(=O)C(OC)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ZXIATBNUWJBBGT-JXOAFFINSA-N 0.000 description 2
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 101710201279 Biotin carboxyl carrier protein Proteins 0.000 description 2
- 101710172824 CRISPR-associated endonuclease Cas9 Proteins 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 102220605874 Cytosolic arginine sensor for mTORC1 subunit 2_D10A_mutation Human genes 0.000 description 2
- 230000004568 DNA-binding Effects 0.000 description 2
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 2
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 2
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 108010047956 Nucleosomes Proteins 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 229930185560 Pseudouridine Natural products 0.000 description 2
- PTJWIQPHWPFNBW-UHFFFAOYSA-N Pseudouridine C Natural products OC1C(O)C(CO)OC1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-UHFFFAOYSA-N 0.000 description 2
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 102000002669 Small Ubiquitin-Related Modifier Proteins Human genes 0.000 description 2
- 108010043401 Small Ubiquitin-Related Modifier Proteins Proteins 0.000 description 2
- 241000187191 Streptomyces viridochromogenes Species 0.000 description 2
- 241000203587 Streptosporangium roseum Species 0.000 description 2
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 2
- 102000002933 Thioredoxin Human genes 0.000 description 2
- 102100021012 Ubiquitin-fold modifier 1 Human genes 0.000 description 2
- 101710082264 Ubiquitin-fold modifier 1 Proteins 0.000 description 2
- 101710082247 Ubiquitin-like protein 5 Proteins 0.000 description 2
- 102100030580 Ubiquitin-like protein 5 Human genes 0.000 description 2
- 102100027266 Ubiquitin-like protein ISG15 Human genes 0.000 description 2
- 102100031319 Ubiquitin-related modifier 1 Human genes 0.000 description 2
- 101710144315 Ubiquitin-related modifier 1 Proteins 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 125000003710 aryl alkyl group Chemical group 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- WGDUUQDYDIIBKT-UHFFFAOYSA-N beta-Pseudouridine Natural products OC1OC(CN2C=CC(=O)NC2=O)C(O)C1O WGDUUQDYDIIBKT-UHFFFAOYSA-N 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 102000021178 chitin binding proteins Human genes 0.000 description 2
- 108091011157 chitin binding proteins Proteins 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 238000004891 communication Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 229940104302 cytosine Drugs 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 108010021843 fluorescent protein 583 Proteins 0.000 description 2
- 125000001072 heteroaryl group Chemical group 0.000 description 2
- 238000010874 in vitro model Methods 0.000 description 2
- 230000015788 innate immune response Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- YACKEPLHDIMKIO-UHFFFAOYSA-N methylphosphonic acid Chemical compound CP(O)(O)=O YACKEPLHDIMKIO-UHFFFAOYSA-N 0.000 description 2
- 230000006780 non-homologous end joining Effects 0.000 description 2
- 238000011330 nucleic acid test Methods 0.000 description 2
- 210000001623 nucleosome Anatomy 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- PTMHPRAIXMAOOB-UHFFFAOYSA-N phosphoramidic acid Chemical class NP(O)(O)=O PTMHPRAIXMAOOB-UHFFFAOYSA-N 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- PTJWIQPHWPFNBW-GBNDHIKLSA-N pseudouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-GBNDHIKLSA-N 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 150000003212 purines Chemical class 0.000 description 2
- 150000003230 pyrimidines Chemical class 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000011808 rodent model Methods 0.000 description 2
- 229910052594 sapphire Inorganic materials 0.000 description 2
- 239000010980 sapphire Substances 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 239000011593 sulfur Substances 0.000 description 2
- 238000010381 tandem affinity purification Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 229940094937 thioredoxin Drugs 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- 125000003161 (C1-C6) alkylene group Chemical group 0.000 description 1
- YMHOBZXQZVXHBM-UHFFFAOYSA-N 2,5-dimethoxy-4-bromophenethylamine Chemical compound COC1=CC(CCN)=C(OC)C=C1Br YMHOBZXQZVXHBM-UHFFFAOYSA-N 0.000 description 1
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 1
- FZIIBDOXPQOKBP-UHFFFAOYSA-N 2-methyloxetane Chemical compound CC1CCO1 FZIIBDOXPQOKBP-UHFFFAOYSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- 150000005007 4-aminopyrimidines Chemical class 0.000 description 1
- BXJHWYVXLGLDMZ-UHFFFAOYSA-N 6-O-methylguanine Chemical compound COC1=NC(N)=NC2=C1NC=N2 BXJHWYVXLGLDMZ-UHFFFAOYSA-N 0.000 description 1
- ZAOGIVYOCDXEAK-UHFFFAOYSA-N 6-n-methyl-7h-purine-2,6-diamine Chemical compound CNC1=NC(N)=NC2=C1NC=N2 ZAOGIVYOCDXEAK-UHFFFAOYSA-N 0.000 description 1
- 241000007910 Acaryochloris marina Species 0.000 description 1
- 241001135192 Acetohalobium arabaticum Species 0.000 description 1
- 241000093740 Acidaminococcus sp. Species 0.000 description 1
- 241001464929 Acidithiobacillus caldus Species 0.000 description 1
- 241000605222 Acidithiobacillus ferrooxidans Species 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 241000640374 Alicyclobacillus acidocaldarius Species 0.000 description 1
- 241000190857 Allochromatium vinosum Species 0.000 description 1
- 241000147155 Ammonifex degensii Species 0.000 description 1
- 241000620196 Arthrospira maxima Species 0.000 description 1
- 240000002900 Arthrospira platensis Species 0.000 description 1
- 235000016425 Arthrospira platensis Nutrition 0.000 description 1
- 241001495183 Arthrospira sp. Species 0.000 description 1
- 108091005950 Azurite Proteins 0.000 description 1
- 241000906059 Bacillus pseudomycoides Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000823281 Burkholderiales bacterium Species 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 108091079001 CRISPR RNA Proteins 0.000 description 1
- 238000010453 CRISPR/Cas method Methods 0.000 description 1
- 102000000584 Calmodulin Human genes 0.000 description 1
- 108010041952 Calmodulin Proteins 0.000 description 1
- 102000007590 Calpain Human genes 0.000 description 1
- 108010032088 Calpain Proteins 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 241000589986 Campylobacter lari Species 0.000 description 1
- 241001496650 Candidatus Desulforudis Species 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 108091005944 Cerulean Proteins 0.000 description 1
- 241000579895 Chlorostilbon Species 0.000 description 1
- 108091005960 Citrine Proteins 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000907165 Coleofasciculus chthonoplastes Species 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241000065716 Crocosphaera watsonii Species 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- 108091005943 CyPet Proteins 0.000 description 1
- 241000159506 Cyanothece Species 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108091005941 EBFP Proteins 0.000 description 1
- 108091005947 EBFP2 Proteins 0.000 description 1
- 108091005942 ECFP Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 101100176848 Escherichia phage N15 gene 15 gene Proteins 0.000 description 1
- 241000326311 Exiguobacterium sibiricum Species 0.000 description 1
- 241000605896 Fibrobacter succinogenes Species 0.000 description 1
- 241000192016 Finegoldia magna Species 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 1
- 241000589599 Francisella tularensis subsp. novicida Species 0.000 description 1
- 241000588088 Francisella tularensis subsp. novicida U112 Species 0.000 description 1
- 241000968725 Gammaproteobacteria bacterium Species 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 102100028966 HLA class I histocompatibility antigen, alpha chain F Human genes 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 101000986080 Homo sapiens HLA class I histocompatibility antigen, alpha chain F Proteins 0.000 description 1
- 101000589002 Homo sapiens Myogenin Proteins 0.000 description 1
- 101001057508 Homo sapiens Ubiquitin-like protein ISG15 Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 241001430080 Ktedonobacter racemifer Species 0.000 description 1
- 241000689670 Lachnospiraceae bacterium ND2006 Species 0.000 description 1
- 241000186679 Lactobacillus buchneri Species 0.000 description 1
- 241000186673 Lactobacillus delbrueckii Species 0.000 description 1
- 241000186606 Lactobacillus gasseri Species 0.000 description 1
- 241000186869 Lactobacillus salivarius Species 0.000 description 1
- 241000186805 Listeria innocua Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 241001134698 Lyngbya Species 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 101000986081 Macaca mulatta Mamu class I histocompatibility antigen, alpha chain F Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000501784 Marinobacter sp. Species 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000204637 Methanohalobium evestigatum Species 0.000 description 1
- 241000192710 Microcystis aeruginosa Species 0.000 description 1
- 241000190928 Microscilla marina Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 208000010428 Muscle Weakness Diseases 0.000 description 1
- 206010028289 Muscle atrophy Diseases 0.000 description 1
- 206010028372 Muscular weakness Diseases 0.000 description 1
- 102100032970 Myogenin Human genes 0.000 description 1
- 102000053987 NEDD8 Human genes 0.000 description 1
- 108700004934 NEDD8 Proteins 0.000 description 1
- 101150107958 NEDD8 gene Proteins 0.000 description 1
- 241000167285 Natranaerobius thermophilus Species 0.000 description 1
- 241000588654 Neisseria cinerea Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 241000919925 Nitrosococcus halophilus Species 0.000 description 1
- 241001515112 Nitrosococcus watsonii Species 0.000 description 1
- 241000203619 Nocardiopsis dassonvillei Species 0.000 description 1
- 241001223105 Nodularia spumigena Species 0.000 description 1
- 241000192673 Nostoc sp. Species 0.000 description 1
- 108091007494 Nucleic acid- binding domains Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- WSDRAZIPGVLSNP-UHFFFAOYSA-N O.P(=O)(O)(O)O.O.O.P(=O)(O)(O)O Chemical compound O.P(=O)(O)(O)O.O.O.P(=O)(O)(O)O WSDRAZIPGVLSNP-UHFFFAOYSA-N 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 101100532088 Oryza sativa subsp. japonica RUB2 gene Proteins 0.000 description 1
- 101100532090 Oryza sativa subsp. japonica RUB3 gene Proteins 0.000 description 1
- 241000192520 Oscillatoria sp. Species 0.000 description 1
- 241001386755 Parvibaculum lavamentivorans Species 0.000 description 1
- 241000606856 Pasteurella multocida Species 0.000 description 1
- 241000142651 Pelotomaculum thermopropionicum Species 0.000 description 1
- 241000983938 Petrotoga mobilis Species 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical class OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 241001599925 Polaromonas naphthalenivorans Species 0.000 description 1
- 241001472610 Polaromonas sp. Species 0.000 description 1
- 108010068086 Polyubiquitin Proteins 0.000 description 1
- 102100037935 Polyubiquitin-C Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000590028 Pseudoalteromonas haloplanktis Species 0.000 description 1
- 102000014450 RNA Polymerase III Human genes 0.000 description 1
- 108010078067 RNA Polymerase III Proteins 0.000 description 1
- 241000190984 Rhodospirillum rubrum Species 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 241000191982 Staphylococcus hyicus Species 0.000 description 1
- 241000937219 Staphylococcus microti Species 0.000 description 1
- 241000193817 Staphylococcus pasteuri Species 0.000 description 1
- 241001501869 Streptococcus pasteurianus Species 0.000 description 1
- 241000194022 Streptococcus sp. Species 0.000 description 1
- 241000194020 Streptococcus thermophilus Species 0.000 description 1
- 241001518258 Streptomyces pristinaespiralis Species 0.000 description 1
- 241000123713 Sutterella wadsworthensis Species 0.000 description 1
- 241000192560 Synechococcus sp. Species 0.000 description 1
- 241000206213 Thermosipho africanus Species 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 241000589892 Treponema denticola Species 0.000 description 1
- 241000078013 Trichormus variabilis Species 0.000 description 1
- 101710087750 Ubiquitin-like protein ISG15 Proteins 0.000 description 1
- 241000545067 Venus Species 0.000 description 1
- 241000605939 Wolinella succinogenes Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241001673106 [Bacillus] selenitireducens Species 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000011374 additional therapy Methods 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- PPQRONHOSHZGFQ-LMVFSUKVSA-N aldehydo-D-ribose 5-phosphate Chemical group OP(=O)(O)OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PPQRONHOSHZGFQ-LMVFSUKVSA-N 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 125000006350 alkyl thio alkyl group Chemical group 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000002431 aminoalkoxy group Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 229940011019 arthrospira platensis Drugs 0.000 description 1
- 125000004104 aryloxy group Chemical group 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 108091005948 blue fluorescent proteins Proteins 0.000 description 1
- 125000001246 bromo group Chemical group Br* 0.000 description 1
- 125000001369 canonical nucleoside group Chemical group 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 108020001778 catalytic domains Proteins 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 125000001309 chloro group Chemical group Cl* 0.000 description 1
- 239000011035 citrine Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 108010082025 cyan fluorescent protein Proteins 0.000 description 1
- 125000004093 cyano group Chemical group *C#N 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 229910003460 diamond Inorganic materials 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 239000010976 emerald Substances 0.000 description 1
- 229910052876 emerald Inorganic materials 0.000 description 1
- 230000002616 endonucleolytic effect Effects 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 239000005090 green fluorescent protein Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 201000000585 muscular atrophy Diseases 0.000 description 1
- 210000003098 myoblast Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000002923 oximes Chemical class 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 229940051027 pasteurella multocida Drugs 0.000 description 1
- 150000003014 phosphoric acid esters Chemical class 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 208000026526 progressive weakness Diseases 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 102000005912 ran GTP Binding Protein Human genes 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 101150024074 rub1 gene Proteins 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- JRPHGDYSKGJTKZ-UHFFFAOYSA-N selenophosphoric acid Chemical class OP(O)([SeH])=O JRPHGDYSKGJTKZ-UHFFFAOYSA-N 0.000 description 1
- 230000005783 single-strand break Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 125000000547 substituted alkyl group Chemical group 0.000 description 1
- PXQLVRUNWNTZOS-UHFFFAOYSA-N sulfanyl Chemical class [SH] PXQLVRUNWNTZOS-UHFFFAOYSA-N 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 108091005946 superfolder green fluorescent proteins Proteins 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 125000005309 thioalkoxy group Chemical group 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- GWBUNZLLLLDXMD-UHFFFAOYSA-H tricopper;dicarbonate;dihydroxide Chemical compound [OH-].[OH-].[Cu+2].[Cu+2].[Cu+2].[O-]C([O-])=O.[O-]C([O-])=O GWBUNZLLLLDXMD-UHFFFAOYSA-H 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/32—Special delivery means, e.g. tissue-specific
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/33—Alteration of splicing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/008—Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination
Definitions
- MMD Muscular dystrophies
- DMD Duchenne muscular dystrophy
- Cardiomyopathy and heart failure are common, incurable and lethal features of DMD.
- CRISPR-based genome editing can provide sequence-specific cleavage of genomic DNA using a Cas9 and a guide RNA.
- a nucleic acid encoding the Cas9 enzyme and a nucleic acid encoding for the appropriate guide RNA can be provided on separate vectors or together on a single vector and administered in vivo or in vitro to knockout or correct a genetic mutation, for example.
- the approximately 20 nucleotides at the 5′ end of the guide RNA serves as the guide or spacer sequence that can be any sequence complementary to one strand of a genomic target location that has an adjacent protospacer adjacent motif (PAM).
- the PAM sequence is a short sequence adjacent to the Cas9 nuclease cut site that the Cas9 molecule requires for appropriate binding.
- the nucleotides 3’ of the guide or spacer sequence of the guide RNA serve as a scaffold sequence for interacting with Cas9. When a guide RNA and a Cas9 are expressed, the guide RNA will bind to Cas9 and direct it to the sequence complementary to the guide sequence, where it will then initiate a double-stranded break (DSB).
- DSB double-stranded break
- NHEJ non-homologous end joining
- Streptococcus pyogenes spCas9
- AAV-based CRISPR/Cas systems requires two AAV vectors – one vector carrying the nucleic acid encoding the spCas9, and the other carrying the nucleic acid encoding the guide RNA.
- One possible way to overcome this technical hurdle is to take advantage of the smaller orthologs of Cas9 derived from different prokaryotic species.
- Smaller Cas9 such as Staphylococcus aureus (SaCas9) and Staphylococcus lugdunensis (SluCas9) may be able to be manufactured on a single AAV vector together with a nucleic acid encoding one or more guide RNAs.
- SaCas9 Staphylococcus aureus
- Staphylococcus lugdunensis Staphylococcus lugdunensis
- One advantage of incorporating one or more guide RNAs on a single vector together with the smaller SaCas9 or SluCas9 is that doing so allows extreme design flexibility in situations where more than one guide RNA is desired for optimal performance.
- one vector may be utilized to express SaCas9 or SluCas9 and one or more guide RNAs targeting a first genomic target (e.g., a pair of guide RNAs that together bind regions flanking a genomic target), and a second vector may be utilized to express multiple copies of the same (e.g., the same pair of guides in the first vector) or different guide RNAs targeting the same or a different genomic target.
- a second vector may be utilized to express multiple copies of the same (e.g., the same pair of guides in the first vector) or different guide RNAs targeting the same or a different genomic target.
- multiple copies of the same guide RNA may be beneficial, and the use of smaller Cas9’s allow for multiple copies of guide RNA to be incorporated on the same vector as the Cas9, and also for even more copies of guide RNA when combined with a second vector.
- compositions and methods utilizing these configurations have the benefit of reducing manufacturing costs, reducing complexity of administration routes and protocols, and allowing maximum flexibility with regard to using multiple copies of the same or different guide RNAs targeting the same or different genomic target sequences. In some instances, providing multiple copies of the same guide RNA improves the efficiency of the guide, improving an already successful system.
- compositions and methods for treating DMD utilizing the smaller Cas9s from Staphylococcus aureus (SaCas9) and Staphylococcus lugdunensis (SluCas9).
- Embodiment A1 is a composition comprising: a. a single nucleic acid molecule comprising: i. a nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least one, at least two, or at least three guide RNAs; or ii.
- nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or iii. a nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and 1, 2, or 3 guide RNAs; or b. two nucleic acid molecules comprising: i.
- a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9); and a second nucleic acid that does not encode a SaCas9 or SluCas9 and encodes any one of the following: 1. at least one, at least two, at least three, at least four, at least five, or at least six guide RNAs; or 2. from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or 3. from one to six guide RNAs; or ii.
- a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and 1. at least one, at least two, or at least three guide RNAs; or 2. from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or 3. 1, 2, or 3 guide RNAs; and a second nucleic acid that does not encode a SaCas9 or SluCas9, optionally wherein the second nucleic acid comprises any one of the following: 1.
- RNAs at least one, at least two, at least three, at least four, at least five, or at least six guide RNAs; or 2. from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or 3. from one to six guide RNAs; or iii.
- a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least one, at least two, or at least three guide RNAs; and a second nucleic acid that does not encode a SaCas9 or SluCas9 and encodes from one to six guide RNAs; or iv.
- a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least two guide RNAs, wherein at least one guide RNA binds upstream of a target sequence and at least one guide RNA binds downstream of the target sequence; and a second nucleic acid that does not encode a SaCas9 or SluCas9 and encodes at least one additional copy of each of the guide RNAs encoded in the first nucleic acid, wherein the guide RNA(s) target a region in the dystrophin gene.
- Embodiment A2 is a composition comprising two nucleic acid molecules comprising i) a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and a first and a second guide RNA that function to excise a portion of a DMD gene; and ii) a second nucleic acid encoding at least 2 or at least 3 copies of the first guide RNA and at least 2 or at least 3 copies of the second guide RNA.
- a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and a first and a second guide RNA that function to excise a portion of a DMD gene
- Embodiment A3 is a composition comprising one or more nucleic acid molecules encoding an endonuclease and a pair of guide RNAs, wherein each guide RNA targets a different sequence in a DMD gene, wherein the endonuclease and pair of guide RNAs are capable of excising a DNA fragment from the DMD gene; wherein the DNA fragment is between 5-250 nucleotides in length.
- Embodiment A4 is the composition of claim 3, wherein the endonuclease is a class 2, type II Cas endonuclease.
- Embodiment A5 is the composition of claim 3, wherein the class 2, type II Cas endonuclease is SpCas9, SaCas9, or SluCas9.
- Embodiment A6 is the composition of claim 3, wherein the endonuclease is not a class 2, type V Cas endonuclease.
- Embodiment A7 is the composition of claim 3, wherein the excised DNA fragment comprises a splice acceptor site or a splice donor site.
- Embodiment A8 is the composition of claim 3, wherein the excised DNA fragment comprises a premature stop codon in the DMD gene.
- Embodiment A9 is the composition of claim 3, wherein the excised DNA fragment does not comprise an entire exon of the DMD gene.
- Embodiment A10 is the composition of any one of claims 1-9, wherein the guide RNA comprises any one of the following: a. when SaCas9 is used, one or more spacer sequences selected from any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or b. when SluCas9a is used, one or more spacer sequences selected from any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; or c. when SaCas9 is used, one or more spacer sequences comprising at least 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or d.
- SluCas9a when SluCas9a is used, one or more spacer sequences comprising at least 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; or e. when SaCas9 is used, one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or f. when SluCas9 is used, one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; or g.
- a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or h.
- a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or i.
- a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or j.
- a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or k.
- SluCas9 when used with at least two guide RNAs, at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or l.
- SluCas9 when used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or m.
- SluCas9 when used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: i. SEQ ID NOS: 148 and 134, ii. SEQ ID Nos: 145 and 131, iii. SEQ ID Nos: 144 and 149; iv. SEQ ID Nos: 144 and 150; and v. SEQ ID Nos: 146 and 148; or n. when a SaCas9-KKH is used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: i.
- Embodiment A11 is a composition comprising a single nucleic acid molecule encoding one or more guide RNAs and a Cas9, wherein the single nucleic acid molecule comprises: a. a first nucleic acid encoding one or more spacer sequences selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); or b.
- a first nucleic acid encoding one or more spacer sequences selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); or c. a first nucleic acid encoding one or more spacer sequences comprising at least 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); or d.
- a first nucleic acid encoding one or more spacer sequences comprising at least 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); or e. a first nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); or f.
- a first nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); or g.
- a first nucleic acid encoding a pair of guide RNAs comprising a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); or h.
- SEQ ID NOs 10 and 15; 10 and 16; 12 and 16
- a first nucleic acid encoding a pair of guide RNAs comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); or i.
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); or j.
- SEQ ID NOs 10 and 15; 10 and
- a first nucleic acid encoding a pair of guide RNAs comprising a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas
- a first nucleic acid encoding a pair of guide RNAs comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and 134 and 148; 135 and 149; 135 and
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunensis (S
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: i. SEQ ID NOS: 148 and 134, ii. SEQ ID Nos: 145 and 131, iii. SEQ ID Nos: 144 and 149; iv. SEQ ID Nos: 144 and 150; v. SEQ ID Nos: 146 and 148; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); or n.
- SluCas9 Staphylococcus lugdunensis
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: i. SEQ ID NOs: 12 and 1013; and ii. SEQ ID Nos: 12 and 1016; iii. and a second nucleic acid encoding a SaCas9-KKH.
- Embodiment A12 is a composition comprising one or more nucleic acid molecules encoding a Staphylococcus lugdunensis (SluCas9) and at least two guide RNAs, wherein a first and second guide RNA target different sequences in a DMD gene, wherein the first and a second guide RNA comprise a sequence that is at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: i. SEQ ID NOS: 148 and 134, ii. SEQ ID Nos: 145 and 131, iii. SEQ ID Nos: 144 and 149; iv. SEQ ID Nos: 144 and 150; v.
- Embodiment A13 is a composition comprising one or more nucleic acid molecules encoding an endonuclease and at least two guide RNAs, wherein the guide RNAs each target a different sequence in a DMD gene, wherein the guide RNAs each comprise a sequence that is at least 90% identical to a first and second spacer sequence selected from any one of the following pairs of spacer sequences: i. SEQ ID NOs: 12 and 1013; and ii. SEQ ID Nos: 12 and 1016; and b. a second nucleic acid encoding a SaCas9-KKH.
- Embodiment A14 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least two guide RNAs.
- Embodiment A15 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least three guide RNAs.
- Embodiment A16 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least four guide RNAs.
- Embodiment A17 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least five guide RNAs.
- Embodiment A18 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least six guide RNAs.
- Embodiment A19 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least seven guide RNAs.
- Embodiment A20 is the composition of any one of the preceding claims, wherein the first and/or the second nucleic acid, if present, encodes at least eight guide RNAs.
- Embodiment A21 is the composition of any one of the preceding claims, wherein the first nucleic acid comprises a nucleotide sequence encoding an endonuclease and at least one, at least two, or at least three guide RNAs.
- Embodiment A22 is the composition of any one of the preceding claims, wherein the first nucleic acid comprises a nucleotide sequence encoding an endonuclease and from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid.
- Embodiment A23 is the composition of any one of the preceding claims, wherein the first nucleic acid comprises a nucleotide sequence encoding an endonuclease and from one to three guide RNAs.
- Embodiment A24 is the composition of any one of the preceding claims, wherein the second nucleic acid, if present, encodes at least one, at least two, at least three, at least four, at least five, or at least six guide RNAs.
- Embodiment A25 is the composition of any one of the preceding claims, wherein the second nucleic acid, if present, encodes from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid.
- Embodiment A26 is the composition of any one of the preceding claims, wherein the second nucleic acid, if present, encodes from one to six guide RNAs.
- Embodiment A27 is the composition of any one of the preceding claims, wherein the second nucleic acid, if present, encodes 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, or 2-3 guide RNAs.
- Embodiment A28 is the composition of any one of the preceding claims, wherein the second nucleic acid, if present, encodes 2, 3, 4, 5, or 6 guide RNAs.
- Embodiment A29 is the composition of any one of the preceding claims, comprising at least two nucleic acid molecules, wherein the guide RNA encoded by the first nucleic acid and the second nucleic acid are the same.
- Embodiment A30 is the composition of any one of the preceding claims, comprising at least two nucleic acid molecules, wherein the guide RNA encoded by the first nucleic acid and the second nucleic acid are different.
- Embodiment A31 is the composition of any one of the preceding claims, comprising at least two nucleic acid molecules encoding at least two guide RNAs, wherein at least one guide RNA binds to a target sequence within an exon in the DMD gene that is upstream of a premature stop codon, and wherein at least one guide RNA binds to a target sequence within an exon in the DMD gene that is downstream of a premature stop codon.
- Embodiment A32 is the composition of any one of the preceding claims, comprising at least two nucleic acid molecules, wherein the first nucleic acid molecule and the second nucleic acid molecule each encode the same guide RNA.
- Embodiment A33 is the composition of any one of the preceding claims, comprising at least two nucleic acid molecules each encoding at least one guide RNA, wherein the second nucleic acid molecule encodes a guide RNA that binds to the same target sequence as the guide RNA in the first nucleic acid molecule.
- Embodiment A34 is the composition of any one of the preceding claims, comprising at least two nucleic acid molecules, wherein the second nucleic acid molecule encodes at least 2, at least 3, at least 4, at least 5, or at least 6 guide RNAs, wherein the guide RNAs in the second nucleic acid molecule bind to the same target sequence as the guide RNA in the first nucleic acid molecule.
- Embodiment A35 is the composition of any one of the preceding claims, wherein the composition comprises at least two nucleic acid molecules, wherein the first nucleic acid molecule comprises a sequence encoding an endonuclease, wherein the second nucleic acid molecule encodes a first guide RNA and a second guide RNA, wherein the first guide RNA and the second guide RNA are not the same sequence, and wherein the second nucleic acid molecule does not encode an endonuclease.
- Embodiment A36 is the composition of claim 35, wherein the first nucleic acid molecule also encodes a copy of the first guide RNA and a copy of the second guide RNA.
- Embodiment A37 is the composition of claim 35 or 36, wherein the second nucleic acid molecule encodes two copies of the first guide RNA and two copies of the second guide RNA.
- Embodiment A38 is the composition of any one of claims 35-37, wherein the second nucleic acid molecule encodes three copies of the first guide RNA and three copies of the second guide RNA.
- Embodiment A39 is the composition of any one of claims 35-37, wherein the first nucleic acid molecule comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first guide RNA scaffold sequence, the reverse complement of a nucleotide sequence encoding the first guide RNA sequence, the reverse complement of a promoter for expression of the nucleotide sequence encoding the first guide RNA sequence, a promoter for expression of a nucleotide sequence encoding the endonuclease, a nucleotide sequence encoding an endonuclease, a polyadenylation sequence, a promoter for expression of the second guide RNA in the same direction as the promoter for the endonuclease, the second guide RNA sequence, and a second guide RNA scaffold sequence.
- Embodiment A40 is the composition of claim 39, wherein the promoter for expression of the nucleotide sequence encoding the first guide RNA sequence in the first nucleic acid molecule is a U6 promoter and the promoter for expression of the nucleotide sequence encoding the second guide RNA in the first nucleic acid molecule is a U6 promoter.
- Embodiment A41 is the composition of any one of claims 35-40, wherein the first nucleic acid molecule is in a first vector, and wherein the second nucleic acid is in a separate second vector.
- Embodiment A42 is the composition of any one of claims 35-41, wherein the first nucleic acid molecule encodes a Staphylococcus aureus Cas9 (SaCas9) endonuclease, and wherein the first guide RNA comprises the first sequence and the second guide RNAs comprises the second sequence from any one the following pairs of sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018.
- Embodiment A43 is the composition of claim 42, wherein the first guide RNA comprises the sequence of SEQ ID NO: 12 and the second guide RNA comprises the sequence of SEQ ID NO: 1013.
- Embodiment A44 is the composition of any one of claims 35-43, wherein the first nucleic acid molecule encodes a Staphylococcus lugdunensis (SluCas9) endonuclease, and wherein the first guide RNA comprises the first sequence and the second guide RNAs comprises the second sequence from any one the following pairs of sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150;
- Embodiment A45 is the composition of claim 44, wherein: i. the first guide RNA comprises the sequence of SEQ ID NO: 148 and the second guide RNA comprises the sequence of SEQ ID NO: 134; or ii. the second guide RNA comprises the sequence of SEQ ID NO: 145 and the second guide RNA comprises the sequence of SEQ ID NO: 131.
- Embodiment A46 is the composition of any one of claims 35-45, wherein the first nucleic acid is in a first vector, and wherein the second nucleic acid is in a separate second vector.
- Embodiment A47 is the composition of claim 46, wherein the first and second vectors are viral vectors.
- Embodiment A48 is the composition of claim 47, wherein the viral vectors are AAV9 vectors.
- Embodiment A49 is the composition of claim 48, wherein the AAV9 vectors are each less than 5kb, less than 4.9kb, less than 4.85, less than 4.8, or less than 4.75 kb from ITR to ITR in size, inclusive of both ITRs.
- Embodiment A50 is the composition of claim 48 or 49, wherein the AAV9 vectors are each between 3.9-5 kb, 4-5 kb, 4.2-5 kb, 4.4-5 kb, 4.6-5 kb, 4.7-5 kb, 3.9-4.9 kb, 4.2-4.9 kb, 4.4- 4.9 kb, 4.7-4.9 kb, 3.9-4.85 kb, 4.2-4.85 kb, 4.4-4.85 kb, 4.6-4.85 kb, 4.7-4.85 kb, 4.7-4.9 kb, 3.9-4.8 kb, 4.2-4.8 kb, 4.4-4.8 kb or 4.6-4.8 kb from ITR to ITR in size, inclusive of both ITRs.
- Embodiment A51 is the composition of any one of claims 47-50, wherein the first vector is between 4.4 - 4.85 kb from ITR to ITR in size, inclusive of both ITRs.
- Embodiment A52 is the composition of any one of the preceding claims, wherein the guide RNA binds to one or more target sequences within a DMD gene.
- Embodiment A53 is the composition of any one of the preceding claims, wherein the guide RNA binds to one or more target sequences within an exon of the DMD gene.
- Embodiment A54 is the composition of any one of the preceding claims, comprising two guide RNAs, wherein i) each guide RNA targets a sequence within an exon; ii) one guide RNA targets a sequence within an exon and one targets a sequence within an intron; or iii) each guide RNA targets a sequence within an intron.
- Embodiment A55 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein i) each guide RNA targets the same genomic target sequence; ii) each guide RNA targets a different target sequence; or iii) at least one guide RNA targets one sequence and at least one guide RNA targets a different sequence.
- Embodiment A56 is the composition of any one of the preceding claims, comprising a guide RNA that binds to an exon of the DMD gene, wherein the exon is selected from exon 43, 44, 45, 50, 51, and 53.
- Embodiment A57 is the composition of any one of the preceding claims, comprising at least two guide RNAs that binds to an exon of the DMD gene, wherein at least one guide RNA binds to a target sequence within an exon in the DMD gene, and at least one guide RNA binds to a different target sequence within the same exon in the DMD gene.
- Embodiment A58 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein at least one guide RNA binds to a target sequence within an exon that is upstream of a premature stop codon, and at least one guide RNA binds to a target sequence within an exon that is downstream of a premature stop codon.
- Embodiment A59 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein at least one guide RNA binds to a target sequence within an exon in the DMD gene, and at least one guide RNA binds to a different target sequence within the same exon in the DMD gene, wherein when expressed in vivo or in vivo, a portion of the exon is excised.
- Embodiment A60 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein once expressed in vitro or in vivo in combination with an RNA-guided endonuclease, the guide RNAs excise a portion of the exon.
- Embodiment A61 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein once expressed in vitro or in vivo in combination with an RNA-guided endonuclease, the guide RNAs excise a portion of the exon, and wherein the portion of the exon remaining after excision are rejoined with a one nucleotide insertion.
- Embodiment A62 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein once expressed in vitro or in vivo in combination with an RNA-guided endonuclease, the guide RNAs excise a portion of the exon, wherein the portion of the exon remaining after excision is rejoined without a nucleotide insertion.
- Embodiment A63 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein once expressed in vitro or in vivo in combination with an RNA-guided endonuclease, the guide RNAs excise a portion of the exon, wherein the size of the excised portion of the exon is between 5 and 250 nucleotides in length.
- Embodiment A64 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein once expressed in vitro or in vivo in combination with an RNA-guided endonuclease, the guide RNAs excise a portion of the exon, wherein the size of the excised portion of the exon is between 5 and 250, 5 and 200, 5 and 150, 5 and 100, 5 and 75, 5 and 50, 5 and 25, 5 and 10, 20 and 250, 20 and 200, 20 and 150, 20 and 100, 20 and 75, 20 and 50, 20 and 25, 50 and 250, 50 and 200, 50 and 150, 50 and 100, and 50 and 75 nucleotides.
- Embodiment A65 is the composition of any one of the preceding claims, comprising at least two guide RNAs, wherein once expressed in vitro or in vivo in combination with an RNA-guided endonuclesae, the guide RNAs excise a portion of the exon, wherein the size of the excised portion of the exon is between 8 and 167 nucleotides.
- Embodiment A66 is the composition of any one of the preceding claims, wherein the guide RNA is an sgRNA.
- Embodiment A67 is the composition of any one of the preceding claims, wherein the guide RNA is modified.
- Embodiment A68 is the composition of any one of the preceding claims, wherein the guide RNA is modified, and wherein the modification alters one or more 2’ positions and/or phosphodiester linkages.
- Embodiment A69 is the composition of any one of the preceding claims, wherein the guide RNA is modified, and wherein the modification alters one or more, or all, of the first three nucleotides of the guide RNA and/or the last three nucleotides of the sgRNA.
- Embodiment A70 is the composition of any one of claims 66-68, wherein the modification alters one or more, or all, of the last three nucleotides of the guide RNA.
- Embodiment A71 is the composition of any one of the preceding claims, wherein the guide RNA is modified, and wherein the modification includes one or more of a phosphorothioate modification, a 2’-OMe modification, a 2’-O-MOE modification, a 2’-F modification, a 2′-O- methine-4′ bridge modification, a 3′-thiophosphonoacetate modification, or a 2’-deoxy modification.
- Embodiment A72 is the composition of any one of the preceding claims, wherein the composition further comprises a pharmaceutically acceptable excipient.
- Embodiment A73 is the composition of any one of the preceding claims, wherein the composition is associated with a lipid nanoparticle (LNP).
- LNP lipid nanoparticle
- Embodiment A74 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector.
- Embodiment A75 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, and wherein the viral vector is an adeno-associated virus vector, a lentiviral vector, an integrase-deficient lentiviral vector, an adenoviral vector, a vaccinia viral vector, an alphaviral vector, or a herpes simplex viral vector.
- Embodiment A76 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, and wherein the viral vector is an adeno-associated virus (AAV) vector.
- AAV adeno-associated virus
- Embodiment A77 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector is an adeno-associated virus (AAV) vector, and wherein the AAV vector is an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh10, AAVrh74, or AAV9 vector, wherein the number following AAV indicates the AAV serotype.
- Embodiment A78 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector is an adeno-associated virus (AAV) vector, and wherein the AAV vector is an AAV serotype 9 (AAV9) vector.
- Embodiment A79 is the composition of claim 78, wherein the AAV serotype 9 vector is less than 5kb, less than 4.9kb, less than 4.85, less than 4.8, or less than 4.75 kb from ITR to ITR in size, inclusive of both ITRs.
- Embodiment A80 is the composition of claim 78 or 79, wherein the AAV serotype 9 vector is between 3.9-5 kb, 4-5 kb, 4.2-5 kb, 4.4-5 kb, 4.6-5 kb, 4.7-5 kb, 3.9-4.9 kb, 4.2-4.9 kb, 4.4- 4.9 kb, 4.7-4.9 kb, 3.9-4.85 kb, 4.2-4.85 kb, 4.4-4.85 kb, 4.6-4.85 kb, 4.7-4.85 kb, 4.7-4.9 kb, 3.9-4.8 kb, 4.2-4.8 kb, 4.4-4.8 kb or 4.6-4.8 kb from ITR to ITR in size, inclusive of both ITRs.
- Embodiment A81 is the composition of any one of claims 78-80, wherein the AAV serotype 9 vector is between 4.4-4.85 kb from ITR to ITR in size, inclusive of both ITRs.
- Embodiment A82 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector is an adeno-associated virus (AAV) vector, and wherein the AAV vector is an AAVrh10 vector.
- Embodiment A83 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector is an adeno-associated virus (AAV) vector, and wherein the AAV vector is an AAVrh74 vector.
- Embodiment A84 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector comprises a tissue-specific promoter.
- Embodiment A85 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector comprises a muscle-specific promoter, optionally wherein the muscle-specific promoter is a muscle creatine kinase promoter, a desmin promoter, an MHCK7 promoter, an SPc5-12 promoter, or a CK8e promoter.
- Embodiment A86 is the composition of any one of the preceding claims, wherein the composition is associated with a viral vector, wherein the viral vector comprises any one or more of the following promoters: U6, H1, and 7SK promoter.
- Embodiment A87 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SaCas9, wherein at least one guide RNA comprises a spacer sequence selected from any one of SEQ ID NOs: 12, 15, 16, 20, 27, 28, 32, 33, and 35.
- Embodiment A88 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SaCas9, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 711.
- Embodiment A89 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SaCas9, wherein the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 711.
- Embodiment A90 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SaCas9, wherein the SaCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 715-717.
- Embodiment A91 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SluCas9, wherein at least one guide RNA comprises a spacer sequence selected from any one of SEQ ID NOs: 131, 134, 135, 136 ,139, 144, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, and 225.
- Embodiment A92 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SluCas9, wherein the SluCas9 comprises the amino acid sequence of SEQ ID NO: 712.
- Embodiment A93 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SluCas9, wherein the SluCas9 is a variant of the amino acid sequence of SEQ ID NO: 712.
- Embodiment A94 is the composition of any one of the preceding claims, comprising a nucleic acid encoding SluCas9, wherein the SluCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 718-720.
- Embodiment A95 is the composition of claim 1, wherein the single nucleic acid molecule or the f irst nucleic acid comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a nucleotide sequence encoding a first guide RNA scaffold sequence, the reverse complement of a nucleotide sequence encoding the first guide RNA sequence, t he reverse complement of a promoter for expression of the nucleotide sequence encoding the first guide RNA sequence, a promoter for expression of a nucleotide sequence encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9), a nucleotide sequence encoding the SaCas9 or SluCas9, a polyadenylation sequence, a promoter for expression of the second guide RNA in the same direction as the promoter for the SaCas9 or SluC
- Embodiment A96 is the composition of claim 95, wherein the promoter for expression of the nucleic acid encoding the first guide RNA sequence is a U6 promoter and the promoter for expression of the nucleic acid encoding the second guide RNA is a U6 promoter.
- Embodiment A97 is the composition of claim 95 or 96, wherein the SaCas9 or SluCas9 comprise at least two nuclear localization signals (NLSs).
- Embodiment A98 is the composition of claim 97, wherein the SaCas9 or SluCas9 comprise a c- Myc NLS fused to the N-terminus of the SaCas9 or SluCas9, optionally by means of a linker.
- Embodiment A99 is the composition of claim 97 or 98, wherein the SaCas9 or SluCas9 comprise an SV40 NLS fused to the C-terminus of the SaCas9 or SluCas9, optionally by means of a linker.
- Embodiment A100 is the composition of any one of claims 97-99, wherein the SaCas9 or SluCas9 comprise a nucleoplasmin NLS fused to the C-terminus of the SaCas9 or SluCas9, optionally by means of a linker.
- Embodiment A101 is the composition of any one of claims 97-100, wherein the SaCas9 or SluCas9 comprise: i. a c-Myc NLS fused to the N-terminus of the SaCas9 or SluCas9, optionally by means of a linker, ii. an SV40 NLS fused to the C-terminus of the SaCas9 or SluCas9, optionally by means of a linker, and iii.
- Embodiment A102 is the composition of any one of claims 95-101, wherein the scaffold sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901.
- Embodiment A103 is the composition of any one of claims 95-101, wherein the scaffold sequence for the second guide RNA comprises the sequence of SEQ ID NO: 901.
- Embodiment A104 is the composition of any one claims 95-103, wherein the single nucleic acid molecule or the first nucleic acid is less than 5kb, less than 4.9kb, 4.85, 4.8, or 4.75 kb in size.
- Embodiment A105 is the composition of any one of claims 95-104, wherein the single nucleic acid molecule or the first nucleic acid is between 3.9-5 kb, 4-5 kb, 4.2-5 kb, 4.4-5 kb, 4.6-5 kb, 4.7-5 kb, 3.9-4.9 kb, 4.2-4.9 kb, 4.4-4.9 kb, 4.7-4.9 kb, 3.9-4.85 kb, 4.2-4.85 kb, 4.4- 4.85 kb, 4.6-4.85 kb, 4.7-4.85 kb, 4.7-4.9 kb, 3.9-4.8 kb, 4.2-4.8 kb, 4.4-4.8 kb or 4.6-4.8 kb in size.
- Embodiment A106 is the composition of claim 105, wherein the single nucleic acid molecule or the first nucleic acid is between 4.4-4.85 kb from ITR to ITR in size.
- Embodiment A107 is a composition comprising a guide RNA encoded by a sequence comprising any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 or complements thereof.
- Embodiment A108 is a composition comprising a guide RNA encoded by a sequence comprising any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 or complements thereof.
- Embodiment A109 is the composition of any one of claims 1-108 for use in treating Duchenne Muscular Dystrophy (DMD).
- DMD Duchenne Muscular Dystrophy
- Embodiment A110 is the composition of any one of claims 1-108 for use in making one or more double strand breaks in any one or more of exons 43, 44, 45, 50, 51, or 53 of the dystrophin gene.
- Embodiment A111 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell the composition of any one of claims 1-107.
- Embodiment A112 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i. a nucleic acid encoding one or more guide RNAs, wherein the one or more guide RNAs comprise: 1.
- SaCas9 Staphylococcus aureus Cas9
- Embodiment A113 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a. a nucleic acid molecule encoding one or more guide RNAs, wherein the one or more guide RNAs comprise: i. a spacer sequence selected from SEQ ID NOs: 100-225, 2000-2116, or 4000- 4251; ii. a spacer sequence comprising at least 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 100-225, 2000-2116, or 4000-4251; or iii.
- DMD Duchenne Muscular Dystrophy
- Embodiment A114 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i. a nucleic acid encoding a pair of guide RNAs comprising: 1.
- a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; 2.
- a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or 3.
- a first and second spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and ii.
- Embodiment A115 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i. a nucleic acid encoding a pair of guide RNAs comprising: 1.
- DMD Duchenne Muscular Dystrophy
- a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; and 146 and 148; 2.
- a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or 3.
- a first and second spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9).
- SluCas9 Staphylococcus lugdunensis
- Embodiment A116 is the method of any one of the previous method or use claims, wherein the single nucleic acid molecule is delivered to the cell on a single vector.
- Embodiment A117 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SaCas9, wherein the spacer sequence is selected from any one of SEQ ID NOs: 12, 15, 16, 20, 27, 28, 32, 33, and 35.
- Embodiment A118 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 711.
- Embodiment A119 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SaCas9, wherein the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 711.
- Embodiment A120 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 715-717.
- Embodiment A121 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SluCas9, wherein the spacer sequence is selected from any one of SEQ ID NOs: 131, 134, 135, 136 ,139, 144, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, and 225.
- Embodiment A122 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SluCas9, wherein the SluCas9 comprises the amino acid sequence of SEQ ID NO: 712.
- Embodiment A123 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SluCas9, wherein the SluCas9 is a variant of the amino acid sequence of SEQ ID NO: 712.
- Embodiment A124 is the method of any one of the previous method or use claims, comprising a nucleic acid molecule encoding SluCas9, wherein the SluCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 718-720.
- Embodiment A125 is a method of excising a portion of an exon with a premature stop codon in a subject with Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i. a nucleic acid encoding a pair of guide RNAs wherein the first guide RNA binds to a target sequence within the exon that is upstream of the premature stop codon, and wherein the second guide RNA binds to a sequence that is downstream of the premature stop codon and downstream of the sequence bound by the first guide RNA; and ii.
- Embodiment A126 is a method of excising a portion of an exon with a premature stop codon in a subject with Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i.
- a nucleic acid encoding a pair of guide RNAs wherein the first guide RNA binds to a target sequence within the exon that is upstream of the premature stop codon, and wherein the second guide RNA binds to a sequence that is downstream of the premature stop codon and downstream of the sequence bound by the first guide RNA; and ii. a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); wherein the pair of guide RNAs and SaCas9 excise a portion of the exon.
- Staphylococcus lugdunensis SluCas9
- Embodiment A127 is the method of any one of the previous method claims, comprising a single nucleic acid molecule, wherein the single nucleic acid molecule is delivered to the cell on a single vector.
- Embodiment A128 is the method of any one of the previous method claims, wherein a portion of a DMD gene is excised, and wherein the portions of the gene remaining after excision are rejoined with a one-nucleotide insertion.
- Embodiment A129 is the method of any one of the previous method claims, wherein a portion of a DMD gene is excised, and wherein the portions of the exon remaining after excision are rejoined without a nucleotide insertion.
- Embodiment A130 is the method of any one of the previous method claims, wherein a portion of a DMD gene is excised, wherein the size of the excised portion of the gene is between 5 and 250, 5 and 200, 5 and 150, 5 and 100, 5 and 75, 5 and 50, 5 and 25, 5 and 10, 20 and 250, 20 and 200, 20 and 150, 20 and 100, 20 and 75, 20 and 50, 20 and 25, 50 and 250, 50 and 200, 50 and 150, 50 and 100, and 50 and 75 nucleotides.
- Embodiment A131 is the method of any one of the previous method claims, wherein a portion of a DMD gene is excised, wherein the size of the excised portion of the exon is between 8 and 167 nucleotides.
- Embodiment A132 is the method of any one of the previous method claims, wherein a portion of a DMD gene is excised, wherein the portion is within exon 43, 44, 45, 50, 51, or 53.
- Embodiment A133 is the method of any one of the previous method claims, comprising a pair of guide RNAs, wherein the pair of guide RNA comprise a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16
- Embodiment A134 is the method of any one of the previous method claims, comprising a pair of guide RNAs, wherein the pair of guide RNAs comprise a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146.
- Embodiment A135 is the method of any one of the previous method claims, comprising SaCas9, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 715.
- Embodiment A136 is the composition or method of any one of the preceding claims, wherein the single nucleic acid molecule is an AAV vector, wherein the vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of a promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding a SaCas9, a polyadenylation sequence, a promoter for expression of a second sgRNA in the same direction as the promoter for SaCas
- Embodiment A137 is the composition or method of claim 136, wherein the promoter for expression of the first sgRNA guide sequence is an hU6 promoter.
- Embodiment A138 is the composition or method of any one of claims 136-137, wherein the promoter for expression of the second sgRNA guide sequence is an hU6 promoter.
- Embodiment A139 is the composition or method of any one of claims 136-137, wherein the promoter for the expression of the first sgRNA guide sequence is an hU6 promoter, and the promoter for the expression of the second sgRNA guide sequence is an hU6 promoter.
- Embodiment A140 is the composition or method of any one of claims 136-137, wherein the promoter for expression of the nucleic acid encoding the first sgRNA guide sequence is an 7SK promoter.
- Embodiment A141 is the composition or method of any one of claims 136-137, wherein the promoter for expression of the nucleic acid encoding the second sgRNA guide sequence is an 7SK promoter.
- Embodiment A142 is the composition or method of any one of claims 136-137, wherein the promoter for expression of the nucleic acid encoding the second sgRNA guide sequence is an H1m promoter.
- Embodiment A143 is the composition or method of any one of the preceding claims, wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to a nucleic acid sequence encoding one or more nuclear localization sequences (NLSs).
- Embodiment A144 is the composition or method of any one of the preceding claims, wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS).
- Embodiment A145 is the composition or method of any one of the preceding claims, wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- Embodiment A146 is the composition or method of any one of the preceding claims, wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- Embodiment A147 is the composition or method of any one of claims 143-146, wherein the one or more NLSs comprises an SV40 NLS.
- Embodiment A148 is the composition or method of any one of claims 143-147, wherein the one or more NLSs comprises an c-Myc NLS.
- Embodiment A149 is the composition or method of any one of claims 143-148, wherein the one or more NLSs comprises a nucleoplasmin NLS.
- Embodiment A150 is the composition or method of any one of the preceding claims, wherein the nucleic acid encoding the guide RNA or the nucleic acid encoding the pair of guide RNAs comprises a sequence selected from any one of SEQ ID NOs: 600, 601, or 900- 917, and wherein the composition or method comprises a nucleic acid encoding SluCas9.
- Embodiment A151 is the composition or method of any one of the preceding claims, wherein the nucleic acid encoding the guide RNA or the nucleic acid encoding the pair of guide RNAs comprises a sequence selected from any one of SEQ ID NOs: 901-917, and wherein the composition or method comprises a nucleic acid encoding SluCas9.
- Embodiment A152 is the composition of any one of the preceding claims, wherein the nucleic acid molecule encodes at least a first guide RNA and a second guide RNA.
- Embodiment A153 is the composition of claim 152, wherein the nucleic acid molecule encodes a spacer sequence for the first guide RNA, a scaffold sequence for the first guide RNA, a spacer sequence for the second guide RNA, and a scaffold sequence for the second guide RNA.
- Embodiment A154 is the composition of claim 152, wherein the spacer sequence for the first guide RNA and the spacer sequence for the second guide RNA are the same.
- Embodiment A155 is the composition of claim 152, wherein the spacer sequence for the first guide RNA and the spacer sequence for the second guide RNA are different.
- Embodiment A156 is the composition of any one of claims 153-155, wherein the scaffold sequence for the first guide RNA and the scaffold sequence for the second guide RNA are the same.
- Embodiment A157 is the composition of any one of claims 153-154, wherein the scaffold sequence for the first guide RNA and the scaffold sequence for the second guide RNA are different.
- Embodiment A158 is the composition of claim 157, wherein the scaffold sequence for the first guide RNA comprises a sequence selected from the group consisting of SEQ ID NOs: 901-916, and wherein the scaffold sequence for the second guide RNA comprises a different sequence selected from the group consisting of SEQ ID NOs: 901-916. DESCRIPTION OF FIGURES [0009] Fig.
- Fig. 1 provides a simplified description of several representative vector configurations.
- Single-line arrows indicate directionality of expression of the sgRNA(s), while a double-line arrow indicates directionality of expression of the Cas9 protein.
- the Cas9 promoter may be CK8e.
- Fig.2 shows an exemplary schematic of locus-specific indel profiling, as described in Example 2, including editing categories for insertions and deletions.
- FIG. 3A-3B show the editing frequency and indel profile of selected SluCas9 and SaCas9 sgRNAs that target exon 45 of the DMD gene in human HEK293FT cells (Fig. 3A) and mouse Neuro-2a cells (Fig. 3B).
- a high-performing sgRNA for SpCas9 was included as reference (E45Sp52).
- Each bar represents a sgRNA and the bar height depicts the average total indel frequency.
- FIGS. 4A-4B show the editing frequency and indel profile of selected SluCas9 and SaCas9 sgRNAs that target exon 51 of the DMD gene in human HEK293FT cells (Fig. 4A) and mouse Neuro-2a cells (Fig. 4B).
- a high performing sgRNA for SpCas9 was included as reference (E51Sp32).
- Each bar represents a sgRNA and the bar height depicts the average total indel frequency.
- FIGS 5A-5B show the editing frequency and indel profile of selected SluCas9 and SaCas9 sgRNAs within exon 53 of the DMD gene in human HEK293FT cells (Fig. 5A) and mouse Neuro-2a cells (Fig. 5B).
- a high performing sgRNA for SpCas9 was included as reference (E53Sp63).
- Each bar represents a sgRNA and the bar height depicts the average total indel frequency.
- FIG. 6A-D show editing frequency and indel profile of selected SaCas9-KKH and SluCas9 sgRNA pairs within exon 45 in HEK293FT cells (Fig.6B) and Neuro-2a cells (Fig.6D).
- Fig. 6A shows a schematic of editing.
- a single cut sgRNA for SaCas9 (SaCas9-4) was included as reference (Fig. 6C).
- Fig. 7A shows the nucleotide composition and RNA secondary structure of the stem- loop I in different SluCas9 single-guide RNA scaffolds. Key differences in the sequence and secondary structure between Slu-VCGT-4.5, Slu-VCGT-4 and Slu-VCGT-5 are depicted. Squares and triangles show the difference in the secondary structure in the upper stem. Diamond and pentagon shapes show the single nucleotide change in the bottom stem. [0016]
- Fig. 7B is a histogram showing the percentage of different types of indels generated by two SluCas9 sgRNA candidates: SluCas9-23 and SluCas9-24.
- each guide RNA three scaffolds were tested, including Slu-VCGT-4.5, Slu-VCGT-4 and Slu-VCGT-5.
- Each sgRNA was tested at three different RNP doses. The exact amounts of SluCas9 protein and sgRNA tested were: 6.75 pmol:37.5pmol for low dose, 12.5pmol:75pmol for middle dose, and 25pmol:150pmol for high dose.
- the different colors of the bars in the histogram represent different types of indels generated by sgRNAs. Black represents the percentage of +1 bp insertions. White represents the percentage of other insertions and deletions that have the potential to restore the reading frame of particular DMD patient mutations of interest.
- Fig. 8 shows editing frequency and indel profile of selected SluCas9 sgRNA pairs within exon 45 in primary human skeletal muscle myoblasts (HsMMs). Two single cut sgRNAs for SpCas9 (EX-145, E45Sp52) and SluCas9 (SluCas9-24) were included as reference.
- Figs.10A and 10B show editing frequency and indel profile of selected AAV vectors in C2C12 myotubes.
- Three test guides are shown for Fig.10A and 4 test guides for Fig.10B.
- Figs.10A and 10B show editing frequency and indel profile of selected AAV vectors in C2C12 myotubes.
- Three test guides are shown for Fig.10A and 4 test guides for Fig.10B.
- Each bar represents a different AAV configuration and the bar height depicts the average total indel
- FIG. 12A and 12B show transgene expression of selected AAV vectors in C2C12 myotubes.
- Fig.12A each bar represents a different AAV configuration and the bar height depicts the average Cas9 transgene copy per ug RNA. Cas9 nucleases are shown using distinct patterns.
- Fig.13 shows Cas9 localization of selected AAV vectors in C2C12 myotubes. In Fig.
- single-line arrows indicate directionality of expression of the sgRNA(s), while a double-line or “thick” arrow (with or without an embedded “X”) indicates directionality of expression of the Cas9 protein.
- SluCas9’s location is shown in the bottom panel of each; MYOG is shown with representative arrows, DAPI is shown with representative bold, larger arrows. Image shown at 20-25 ⁇ m scale.
- Figs.14A and 14B show editing frequency and indel profile of selected AAV vectors in heart (FIG.14A) and quadriceps (FIG.14B) of dEx44 mouse model. Each bar represents a different AAV configuration and the bar height depicts the average total indel frequency.
- FIG. 15A and 15B show dystrophin restoration of selected AAV vectors in heart (FIG. 15A) and quadriceps (FIG. 15B) of dEx44 mouse model. Each group represents a different AAV configuration and the horizontal bar depicts the average total dystrophin protein level.
- Figs. 16A and 16B show vector genome quantitation of selected AAV vectors in heart (FIG. 16A) and quadriceps (FIG. 16B) of dEx44 mouse model. Each group represents a different AAV configuration and the horizontal bar depicts the average vector genome copy number per ug DNA. [0026] Figs.
- FIG. 17A and 17B show Cas9 and sgRNA transgene expression of selected AAV vectors in heart (FIG. 17A) and quadriceps (FIG. 17B) of dEx44 mouse model. Each group represents a different AAV configuration and the horizontal bar depicts the average transgene copy number per ug RNA. Closed circles indicate Cas9 mRNA expression and open circles indicate sgRNA expression.
- Figs. 18A-18C show editing frequency and indel profile of selected Cas12i2 guide RNAs used with Cas12i2 endonuclease in exon 45 in HEK293FT cells.
- FIG. 18A shows a schematic of the experiment, FIG.
- FIG. 18B shows indel frequency for selected pairs of guide RNAs
- FIG. 18C shows a single cut sgRNA for SaCas9 (SaCas9-4) and for SluCas9 (SluCas9-24) for reference.
- nucleic acid refers to a multimeric compound comprising nucleosides or nucleoside analogs which have nitrogenous heterocyclic bases or base analogs linked together along a backbone, including conventional RNA, DNA, mixed RNA-DNA, and polymers that are analogs thereof.
- a nucleic acid “backbone” can be made up of a variety of linkages, including one or more of sugar-phosphodiester linkages, peptide-nucleic acid bonds (“peptide nucleic acids” or PNA; PCT No.
- Sugar moieties of a nucleic acid can be ribose, deoxyribose, or similar compounds with substitutions, e.g., 2’ methoxy or 2’ halide substitutions.
- Nitrogenous bases can be conventional bases (A, G, C, T, U), analogs thereof (e.g., modified uridines such as 5-methoxyuridine, pseudouridine, or N1-methylpseudouridine, or others); inosine; derivatives of purines or pyrimidines (e.g., N 4 -methyl deoxyguanosine, deaza- or aza- purines, deaza- or aza-pyrimidines, pyrimidine bases with substituent groups at the 5 or 6 position (e.g., 5-methylcytosine), purine bases with a substituent at the 2, 6, or 8 positions, 2-amino-6- methylaminopurine, O 6 -methylguanine, 4-thio-pyrimidines, 4-amino-pyrimidines, 4- dimethylhydrazine-pyrimidines, and O 4 -alkyl-pyrimidines; US Pat.
- Nucleic acids can include one or more “abasic” residues where the backbone includes no nitrogenous base for position(s) of the polymer (US Pat. No. 5,585,481).
- a nucleic acid can comprise only conventional RNA or DNA sugars, bases and linkages, or can include both conventional components and substitutions (e.g., conventional bases with 2’ methoxy linkages, or polymers containing both conventional bases and one or more base analogs).
- Nucleic acid includes “locked nucleic acid” (LNA), an analogue containing one or more LNA nucleotide monomers with a bicyclic furanose unit locked in an RNA mimicking sugar conformation, which enhance hybridization affinity toward complementary RNA and DNA sequences (Vester and Wengel, 2004, Biochemistry 43(42):13233-41).
- LNA locked nucleic acid
- RNA and DNA have different sugar moieties and can differ by the presence of uracil or analogs thereof in RNA and thymine or analogs thereof in DNA.
- RNA refers to either a crRNA (also known as CRISPR RNA), or the combination of a crRNA and a trRNA (also known as tracrRNA).
- the crRNA and trRNA may be associated as a single RNA molecule (single guide RNA, sgRNA) or in two separate RNA molecules (dual guide RNA, dgRNA).
- sgRNA single guide RNA
- dgRNA dual guide RNA
- Guide RNA refers to each type.
- the trRNA may be a naturally-occurring sequence, or a trRNA sequence with modifications or variations compared to naturally-occurring sequences.
- guide RNA or “guide” as used herein, and unless specifically stated otherwise, may refer to an RNA molecule (comprising A, C, G, and U nucleotides) or to a DNA molecule encoding such an RNA molecule (comprising A, C, G, and T nucleotides) or complementary sequences thereof.
- RNA molecule comprising A, C, G, and U nucleotides
- DNA molecule comprising A, C, G, and T nucleotides
- the U residues in any of the RNA sequences described herein may be replaced with T residues
- the T residues may be replaced with U residues.
- a “spacer sequence,” sometimes also referred to herein and in the literature as a “spacer,” “protospacer,” “guide sequence,” or “targeting sequence” refers to a sequence within a guide RNA that is complementary to a target sequence and functions to direct a guide RNA to a target sequence for cleavage by a Cas9.
- a guide sequence can be 24, 23, 22, 21, 20 or fewer base pairs in length, e.g., in the case of Staphylococcus lugdunensis (i.e., SluCas9) or Staphylococcus aureus (i.e., SaCas9) and related Cas9 homologs/orthologs.
- a guide/spacer sequence in the case of SluCas9 or SaCas9 is at least 20 base pairs in length, or more specifically, within 20-25 base pairs in length (see, e.g., Schmidt et al., 2021, Nature Communications, “Improved CRISPR genome editing using small highly active and specific engineered RNA-guided nucleases”). Shorter or longer sequences can also be used as guides, e.g., 15-, 16-, 17-, 18-, 19-, 20-, 21-, 22-, 23-, 24-, or 25-nucleotides in length.
- the guide sequence comprises at least 17, 18, 19, 20, 21, 22, 23, 24, or 25 contiguous nucleotides of a sequence selected from SEQ ID NOs: 1-35 (for SaCas9), and 100-225 (for SluCas9).
- the guide sequence comprises a sequence selected from SEQ ID NOs: 1-35, 100-225, 1000-1078, 2000-2116, 3000-3069, or 4000-4251.
- the target sequence is in a gene or on a chromosome, for example, and is complementary to the guide sequence.
- the degree of complementarity or identity between a guide sequence and its corresponding target sequence may be about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.
- the guide sequence comprises a sequence with about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to at least 17, 18, 19, 20, 21, 22, 23, 24, or 25 contiguous nucleotides of a sequence selected from SEQ ID NOs: 1-35, 100-225, 1000-1078, 2000-2116, 3000- 3069, or 4000-4251.
- the guide sequence comprises a sequence with about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a sequence selected from SEQ ID NOs: 1-35, 100-225, 1000-1078, 2000-2116, 3000-3069, or 4000-4251.
- the guide sequence and the target region may be 100% complementary or identical.
- the guide sequence and the target region may contain at least one mismatch.
- the guide sequence and the target sequence may contain 1, 2, 3, or 4 mismatches, where the total length of the target sequence is at least 17, 18, 19, 20 or more base pairs.
- the guide sequence and the target region may contain 1-4 mismatches where the guide sequence comprises at least 17, 18, 19, 20 or more nucleotides. In some embodiments, the guide sequence and the target region may contain 1, 2, 3, or 4 mismatches where the guide sequence comprises 20 nucleotides. In some embodiments, the guide sequence and the target region do not contain any mismatches. [0037] In some embodiments, the guide sequence comprises a sequence selected from SEQ ID NOs: 1-35, 100-225, 1000-1078, 2000-2116, 3000-3069, or 4000-4251, wherein if the 5’ terminal nucleotide is not guanine, one or more guanine (g) is added to the sequence at its 5’ end.
- Target sequences for Cas9s include both the positive and negative strands of genomic DNA (i.e., the sequence given and the sequence’s reverse compliment), as a nucleic acid substrate for a Cas9 is a double stranded nucleic acid.
- ribonucleoprotein refers to a guide RNA together with a Cas9.
- the guide RNA guides the Cas9 such as Cas9 to a target sequence, and the guide RNA hybridizes with and the agent binds to the target sequence, which can be followed by cleaving or nicking (in the context of a modified “nickase” Cas9).
- a first sequence is considered to “comprise a sequence with at least X% identity to” a second sequence if an alignment of the first sequence to the second sequence shows that X% or more of the positions of the second sequence in its entirety are matched by the first sequence.
- the sequence AAGA comprises a sequence with 100% identity to the sequence AAG because an alignment would give 100% identity in that there are matches to all three positions of the second sequence.
- RNA and DNA generally the exchange of uridine for thymidine or vice versa
- nucleoside analogs such as modified uridines
- adenosine for all of thymidine, uridine, or modified uridine another example is cytosine and 5- methylcytosine, both of which have guanosine or modified guanosine as a complement.
- sequence 5’-AXG where X is any modified uridine, such as pseudouridine, N1-methyl pseudouridine, or 5-methoxyuridine, is considered 100% identical to AUG in that both are perfectly complementary to the same sequence (5’-CAU).
- exemplary alignment algorithms are the Smith- Waterman and Needleman-Wunsch algorithms, which are well-known in the art.
- mRNA is used herein to refer to a polynucleotide that is not DNA and comprises an open reading frame that can be translated into a polypeptide (i.e., can serve as a substrate for translation by a ribosome and amino-acylated tRNAs).
- mRNA can comprise a phosphate-sugar backbone including ribose residues or analogs thereof, e.g., 2’-methoxy ribose residues.
- the sugars of an mRNA phosphate-sugar backbone consist essentially of ribose residues, 2’-methoxy ribose residues, or a combination thereof.
- a “target sequence” refers to a sequence of nucleic acid in a target gene that has complementarity to at least a portion of the guide sequence of the guide RNA. The interaction of the target sequence and the guide sequence directs a Cas9 to bind, and potentially nick or cleave (depending on the activity of the agent), within the target sequence.
- treatment refers to any administration or application of a therapeutic for disease or disorder in a subject, and includes inhibiting the disease or development of the disease (which may occur before or after the disease is formally diagnosed, e.g., in cases where a subject has a genotype that has the potential or is likely to result in development of the disease), arresting its development, relieving one or more symptoms of the disease, curing the disease, or preventing reoccurrence of one or more symptoms of the disease.
- treatment of DMD may comprise alleviating symptoms of DMD.
- “ameliorating” refers to any beneficial effect on a phenotype or symptom, such as reducing its severity, slowing or delaying its development, arresting its development, or partially or completely reversing or eliminating it. In the case of quantitative phenotypes such as expression levels, ameliorating encompasses changing the expression level so that it is closer to the expression level seen in healthy or unaffected cells or individuals.
- a “pharmaceutically acceptable excipient” refers to an agent that is included in a pharmaceutical formulation that is not the active ingredient. Pharmaceutically acceptable excipients may e.g., aid in drug delivery or support or enhance stability or bioavailability.
- Saphylococcus aureus Cas9 may also be referred to as SaCas9, and includes wild type SaCas9 (e.g., SEQ ID NO: 711) and variants thereof.
- a variant of SaCas9 comprises one or more amino acid changes as compared to SEQ ID NO: 711, including insertion, deletion, or substitution of one or more amino acids, or a chemical modification to one or more amino acids.
- SluCas9 may also be referred to as SluCas9, and includes wild type SluCas9 (e.g., SEQ ID NO: 712) and variants thereof.
- a variant of SluCas9 comprises one or more amino acid changes as compared to SEQ ID NO: 712, including insertion, deletion, or substitution of one or more amino acids, or a chemical modification to one or more amino acids.
- compositions useful for treating Duchenne Muscular Dystrophy e.g., using a single or multiple (e.g., at least 2) nucleic acid molecule encoding 1) one or more guide RNAs comprising one or more guide sequences of Table 1A, Table 1B, or Table 5; and 2) SaCas9 (for SEQ ID NOs: 1-35, 1000-1078 or 3000-3069) or SluCas9 (for SEQ ID NOs: 100-225, 2000-2116, or 4000-4251).
- DMD Duchenne Muscular Dystrophy
- Such compositions may be administered to subjects having or suspected of having DMD.
- a composition comprising, consisting of, or consisting essentially of a single nucleic acid molecule comprising: i) a nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least one, at least two, or at least three guide RNAs; or ii) a nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or iii) a nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least one, at
- a composition comprising, consisting of, or consisting essentially of at least two nucleic acid molecules comprising a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9); and a second nucleic acid that does not encode a SaCas9 or SluCas9 and encodes any one of i) at least one, at least two, at least three, at least four, at least five, or at least six guide RNAs; or ii) from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or iii) from one to six guide RNAs.
- a composition comprising, consisting of, or consisting essentially of at least two nucleic acid molecules comprising a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and i) at least one, at least two, or at least three guide RNAs; or ii) from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid; or iii) one to three guide RNAs; and a second nucleic acid that does not encode a SaCas9 or SluCas9, optionally wherein the second nucleic acid comprises any one of i) at least one, at least two, at least three, at least four, at least five, or at least six guide RNAs; or ii) from one to n guide RNAs, where
- a composition comprising, consisting of, or consisting essentially of at least two nucleic acid molecules comprising a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least one, at least two, or at least three guide RNAs; and a second nucleic acid that does not encode a SaCas9 or SluCas9 and encodes from one to six guide RNAs.
- a composition comprising, consisting of, or consisting essentially of at least two nucleic acid molecules comprising a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and at least two guide RNAs, wherein at least one guide RNA binds upstream of sequence to be excised and at least one guide RNA binds downstream of sequence to be excised; and a second nucleic acid that does not encode a SaCas9 or SluCas9 and encodes at least one additional copy of the guide RNAs encoded in the first nucleic acid.
- the guide RNA excises a portion of a DMD gene, optionally an exon, intron, or exon/intron junction.
- a composition comprising, consisting of, or consisting essentially of at least two nucleic acid molecules comprising a first nucleic acid encoding Staphylococcus aureus Cas9 (SaCas9) or Staphylococcus lugdunensis (SluCas9) and a first and a second guide RNA that function to excise a portion of a DMD gene; and a second nucleic acid encoding at least 2 or at least 3 copies of the first guide RNA and at least 2 or at least 3 copies of the second guide RNA.
- a composition comprising, consisting of, or consisting essentially of one or more nucleic acid molecules encoding an endonuclease and a pair of guide RNAs, wherein each guide RNA targets a different sequence in a DMD gene, wherein the endonuclease and pair of guide RNAs are capable of excising a target sequence in DNA that is between 5-250 nucleotides in length.
- the endonuclease is a class 2, type II Cas endonuclease.
- the class 2, type II Cas endonuclease is SpCas9, SaCas9, or SluCas9.
- the endonuclease is not a class 2, type V Cas endonuclease.
- the excised target sequence comprises a splice acceptor site or a splice donor site.
- the excised target sequence comprises a premature stop codon in the DMD gene.
- the excised target sequence does not comprise an entire exon of the DMD gene.
- any of the methods and/or ribonucleoprotein complexes disclosed herein do not destroy/specifically alter the sequence of a splice acceptor site, splice donor site, or premature stop codon site.
- the guide RNA in the composition comprises any one of the following: a.
- SaCas9 when SaCas9 is used, one or more spacer sequences selected from any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or b. when SluCas9a is used, one or more spacer sequences selected from any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; or c. when SaCas9 is used, one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or d.
- SluCas9a when SluCas9a is used, one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; or e. when SaCas9 is used, one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or f. when SluCas9a is used, one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; or g.
- a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or h.
- SaCas9 when SaCas9 is used with at least two guide RNAs, at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or i.
- SaCas9 when SaCas9 is used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or j.
- a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or k.
- SluCas9 when used with at least two guide RNAs, at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or l.
- SluCas9 when used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or m.
- SluCas9 when used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of: i. SEQ ID NOS: 148 and 134, ii. SEQ ID Nos: 145 and 131, iii. SEQ ID Nos: 144 and 149; iv. SEQ ID Nos: 144 and 150; and v. SEQ ID Nos: 146 and 148; or n. when SaCas9 is used with at least two guide RNAs, at least 90% identical to a first and second spacer sequence selected from any one of: i. SEQ ID NOs: 12 and 1013; and ii. SEQ ID Nos: 12 and 1016.
- the disclosure provides for a composition
- a composition comprising: a) one or more nucleic acid molecules encoding a SluCas9 and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 148 and 134.
- the composition comprises: a) one or more nucleic acid molecules encoding a SluCas9 and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 145 and 131.
- the composition comprises: a) one or more nucleic acid molecules encoding a SluCas9 and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 144 and 149. In some embodiments, the composition comprises: a) one or more nucleic acid molecules encoding a SluCas9 and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 144 and 150. In some embodiments, the composition comprises: a) one or more nucleic acid molecules encoding a SluCas9 and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 146 and 148.
- the composition comprises: a) one or more nucleic acid molecules encoding a SaCas9 (e.g., an SaCas9-KKH) and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 12 and 1013.
- the composition comprises: a) one or more nucleic acid molecules encoding a SaCas9 (e.g., an SaCas9-KKH) and b) a first spacer sequence and a second spacer sequence selected from SEQ ID Nos: 12 and 1016.
- the one or more guide RNAs direct the Cas9 to a site in or near any one of exon 43, 44, 45, 50, 51, or 53 of dystrophin.
- the Cas9 may be directed to cut within 10, 20, 30, 40, or 50 nucleotides of a target sequence.
- the disclosure herein may reference a “first and a second spacer” or a “first and a second guide RNA, gRNA, or sgRNA” followed by one or more pairs of specific sequences. It should be noted that the order of the sequences in the pair is not intended to be restricted to the order in which they are presented.
- the phrase “the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 15” could mean that the first sgRNA comprises the sequence of SEQ ID NO: 10 and the second sgRNA sequence comprises the sequence of SEQ ID NO: 15, or this phrase could mean that the first sgRNA comprises the sequence of SEQ ID NO: 15 and the second sgRNA sequence comprises the sequence of SEQ ID NO: 10.
- a composition comprising a single nucleic acid molecule encoding one or more guide RNAs and a Cas9 is provided, wherein the single nucleic acid molecule comprises: a.
- a first nucleic acid encoding one or more spacer sequences selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9);
- a first nucleic acid encoding one or more spacer sequences selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9);
- c a Staphylococcus lugdunensis
- a first nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); d.
- a first nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); e. a first nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); f.
- a first nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); g.
- a first nucleic acid encoding a pair of guide RNAs comprising a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); h.
- SaCas9 Staphylococcus aureus Cas9
- a first nucleic acid encoding a pair of guide RNAs comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); i.
- SaCas9 Staphyloc
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); j.
- SaCas9 Staphylococcus aureus Cas9
- a first nucleic acid encoding a pair of guide RNAs comprising a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); k.
- a first nucleic acid encoding a pair of guide RNAs comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunens
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); m
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of: i. SEQ ID NOS: 148 and 134, ii. SEQ ID Nos: 145 and 131, iii. SEQ ID Nos: 144 and 149; iv. SEQ ID Nos: 144 and 150; v. SEQ ID Nos: 146 and 148; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); or n.
- SluCas9 Staphylococcus lugdunensis
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of: i. SEQ ID NOs: 12 and 1013; and ii. SEQ ID Nos: 12 and 1016; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9).
- a composition comprising, consisting of, or consisting essentially of one or more nucleic acid molecules encoding a Staphylococcus lugdunensis (SluCas9) and at least two guide RNAs, wherein a first and second guide RNA target different sequences in a DMD gene, wherein the first and a second guide RNA comprise a sequence that is at least 90% identical to a first and second spacer sequence selected from any one of: i. SEQ ID NOS: 148 and 134, ii. SEQ ID Nos: 145 and 131, iii. SEQ ID Nos: 144 and 149; iv.
- a composition comprising, consisting of, or consisting essentially of one or more nucleic acid molecules encoding an endonuclease and at least two guide RNAs, wherein the guide RNAs each target a different sequence in a DMD gene, wherein the guide RNAs each comprise a sequence that is at least 90% identical to a first and second spacer sequence selected from any one of: i. SEQ ID NOs: 12 and 1013; and ii.
- the first and/or the second nucleic acid comprises at least two guide RNAs. In some embodiments, the first and/or the second nucleic acid, if present, comprises at least three guide RNAs. In some embodiments, the first and/or the second nucleic acid, if present, comprises at least four guide RNAs. In some embodiments, the first and/or the second nucleic acid, if present, comprises at least five guide RNAs.
- the first and/or the second nucleic acid comprises at least six guide RNAs.
- the first nucleic acid comprises an endonuclease and at least one, at least two, or at least three guide RNAs.
- the first nucleic acid comprises an endonuclease and from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid.
- the first nucleic acid comprises an endonuclease and from one to three guide RNAs.
- the second nucleic acid encodes at least one, at least two, at least three, at least four, at least five, or at least six guide RNAs. In some embodiments, the second nucleic acid, if present, encodes from one to n guide RNAs, wherein n is no more than the maximum number of guide RNAs that can be expressed from said nucleic acid In some embodiments, the second nucleic acid, if present, encodes from one to six guide RNAs. In some embodiments, the second nucleic acid, if present, encodes 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, or 2-3 guide RNAs.
- the second nucleic acid if present, encodes 2, 3, 4, 5, or 6 guide RNAs.
- the guide RNA encoded by the first nucleic acid and the second nucleic acid are the same. In some embodiments comprising at least two nucleic acid molecules, the guide RNA encoded by the first nucleic acid and the second nucleic acid are different.
- At least one guide RNA binds to a target sequence within an exon in the DMD gene that is upstream of a premature stop codon, and wherein at least one guide RNA binds to a target sequence within an exon in the DMD gene that is downstream of a premature stop codon.
- the same guide RNA is encoded by the nucleic acid of the first and second nucleic acid molecule.
- the second nucleic acid molecule encodes a guide RNA that binds to the same target sequence as the guide RNA in the first nucleic acid molecule.
- the second nucleic acid molecule encodes at least 2, at least 3, at least 4, at least 5, or at least 6 guide RNAs, wherein the guide RNAs in the second nucleic acid molecule bind to the same target sequence as the guide RNA in the first nucleic acid molecule.
- the guide RNA binds to one or more target sequences within a DMD gene. In some embodiments, the guide RNA binds to one or more target sequences within an exon of the DMD gene.
- each guide RNA targets a sequence within an exon; ii) one guide RNA targets a sequence within an exon and one targets a sequence within an intron; or iii) each guide RNA targets a sequence within an intron.
- each guide RNA targets the same genomic target sequence; ii) each guide RNA targets a different target sequence; or iii) at least one guide RNA targets one sequence and at least one guide RNA targets a different sequence.
- the exon is selected from exon 43, 44, 45, 50, 51, and 53.
- at least two guide RNAs that binds to an exon of the DMD gene at least one guide RNA binds to a target sequence within an exon in the DMD gene, and at least one guide RNA binds to a different target sequence within the same exon in the DMD gene.
- At least one guide RNA binds to a target sequence within an exon that is upstream of a premature stop codon, and at least one guide RNA binds to a target sequence within an exon that is downstream of a premature stop codon.
- at least one guide RNA binds to a target sequence within an exon in the DMD gene, and at least one guide RNA binds to a different target sequence within the same exon in the DMD gene, wherein when expressed in vivo or in vivo, a portion of the exon is excised.
- the guide RNAs excise a portion of the exon.
- the guide RNAs excise a portion of the exon, and wherein the portion of the exon remaining after excision are rejoined with a one nucleotide insertion.
- the guide RNAs excise a portion of the exon, wherein the portion of the exon remaining after excision is rejoined without a nucleotide insertion.
- the guide RNAs excise a portion of the exon, wherein the size of excised portion of the exon is between 5, 6, 7, 8, 9, 10, 15, or 20 and 250 nucleotides in length.
- the guide RNAs excise a portion of the exon, wherein the size of excised portion of the exon is between 5 and 250, 5 and 200, 5 and 150, 5 and 100, 5 and 75, 5 and 50, 5 and 25, 5 and 10, 20 and 250, 20 and 200, 20 and 150, 20 and 100, 20 and 75, 20 and 50, 20 and 25, 50 and 250, 50 and 200, 50 and 150, 50 and 100, and 50 and 75 nucleotides.
- a guide RNA and a Cas9 are provided on a single nucleic acid molecule.
- the single nucleic acid molecule comprises a nucleic acid encoding a guide RNA and a nucleic acid encoding a SaCas9 or SluCas9.
- two guide RNAs and a Cas9 are provided on a single nucleic acid molecule.
- the single nucleic acid molecule comprises a nucleic acid encoding a first guide RNA, a nucleic acid encoding a second guide RNA, and a nucleic acid encoding a SaCas9 or SluCas9.
- the spacer sequences of the first and second guide RNAs are identical. In some embodiments, the spacer sequences of the first and second guide RNAs are not identical.
- the single nucleic acid molecule is a single vector. In some embodiments, the single vector expresses the one or two guide RNAs and Cas9 according to the schemes of Figure 1.
- a guide RNA and a Cas9 are provided on a single vector.
- the single vector comprises a nucleic acid encoding a guide RNA and a nucleic acid encoding a SaCas9 or SluCas9.
- two guide RNAs and a Cas9 are provided on a single vector.
- the single vector comprises a nucleic acid encoding a first guide RNA, a nucleic acid encoding a second guide RNA, and a nucleic acid encoding a SaCas9 or SluCas9.
- the spacer sequences of the first and second guide RNAs are identical.
- the spacer sequences of the first and second guide RNAs are not identical.
- Each of the guide sequences shown in Table 1A, Table 1B, and Table 5 may further comprise additional nucleotides to form or encode a crRNA, e.g., using any known sequence appropriate for the Cas9 being used.
- the crRNA comprises (5’ to 3’) at least a spacer sequence and a first complementarity domain.
- the first complementary domain is sufficiently complementary to a second complementarity domain, which may be part of the same molecule in the case of an sgRNA or in a tracrRNA in the case of a dual or modular gRNA, to form a duplex.
- a single-molecule guide RNA can comprise, in the 5' to 3' direction, an optional spacer extension sequence, a spacer sequence, a minimum CRISPR repeat sequence, a single- molecule guide linker, a minimum tracrRNA sequence, a 3' tracrRNA sequence and/or an optional tracrRNA extension sequence.
- the optional tracrRNA extension can comprise elements that contribute additional functionality (e.g., stability) to the guide RNA.
- the single-molecule guide linker can link the minimum CRISPR repeat and the minimum tracrRNA sequence to form a hairpin structure.
- the optional tracrRNA extension can comprise one or more hairpins.
- the disclosure provides for an sgRNA comprising a spacer sequence and a tracrRNA sequence.
- An exemplary scaffold sequence suitable for use with SaCas9 to follow the guide sequence at its 3’ end is: GTTTAAGTACTCTGTGCTGGAAACAGCACAGAATCTACTTAAACAAGGCAAAATGCCGT GTTTATCTCGTCAACTTGTTGGCGAGA (SEQ ID NO: 500) in 5’ to 3’ orientation.
- an exemplary scaffold sequence for use with SaCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 500, or a sequence that differs from SEQ ID NO: 500 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- a variant of an SaCas9 scaffold sequence may be used.
- the SaCas9 scaffold to follow the guide sequence at its 3’ end is referred to as “SaScaffoldV1” and is: GTTTTAGTACTCTGGAAACAGAATCTACTAAAACAAGGCAAAATGCCGTGTTTATCTCGT CAACTTGTTGGCGAGAT (SEQ ID NO: 501) in 5’ to 3’ orientation.
- an exemplary scaffold sequence for use with SaCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 910, or a sequence that differs from SEQ ID NO: 910 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- a variant of an SaCas9 scaffold sequence may be used.
- the SaCas9 scaffold to follow the guide sequence at its 3’ end is referred to as “SaScaffoldV2” and is: GTTTAAGTACTCTGTGCTGGAAACAGCACAGAATCTACTTAAACAAGGCAAAATGCCGT GTTTATCTCGTCAACTTGTTGGCGAGAT (SEQ ID NO: 502) in 5’ to 3’ orientation.
- an exemplary scaffold sequence for use with SaCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 911, or a sequence that differs from SEQ ID NO: 911 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- a variant of an SaCas9 scaffold sequence may be used.
- the SaCas9 scaffold to follow the guide sequence at its 3’ end is referred to as “SaScaffoldV3” and is: GTTTAAGTACTCTGGAAACAGAATCTACTTAAACAAGGCAAAATGCCGTGTTTATCTCGT CAACTTGTTGGCGAGAT (SEQ ID NO: 503) in 5’ to 3’ orientation.
- an exemplary scaffold sequence for use with SaCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 912, or a sequence that differs from SEQ ID NO: 912 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- a variant of an SaCas9 scaffold sequence may be used.
- the SaCas9 scaffold to follow the guide sequence at its 3’ end is referred to as “SaScaffoldV5” and is: GTTTCAGTACTCTGGAAACAGAATCTACTGAAACAAGGCAAAATGCCGTGTTTATCTCGT CAACTTGTTGGCGAGAT (SEQ ID NO: 932) in 5’ to 3’ orientation.
- an exemplary scaffold sequence for use with SaCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 932, or a sequence that differs from SEQ ID NO: 932 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- Two exemplary scaffold sequences suitable for use with SluCas9 to follow the guide sequence at its 3’ end is: GTTTTAGTACTCTGGAAACAGAATCTACTGAAACAAGACAATATGTCGTGTTTATCCCAT CAATTTATTGGTGGGA (SEQ ID NO: 900), and GTTTAAGTACTCTGTGCTGGAAACAGCACAGAATCTACTGAAACAAGACAATATGTCGT GTTTATCCCATCAATTTATTGGTGGGA (SEQ ID NO: 601) in 5’ to 3’ orientation.
- an exemplary sequence for use with SluCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 900 or SEQ ID NO: 601, or a sequence that differs from SEQ ID NO: 900 or SEQ ID NO: 601 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- Exemplary scaffold sequences suitable for use with SluCas9 to follow the guide sequence at its 3’ end are also shown below in the 5’ to 3’ orientation: Scaffold SEQ Scaffold Sequence (5’ to 3’) Homology Streak of ID ID NO to Slu v5 Homology to TcGacccAT Slu_v5-8 909 GTTTCAGTACTCTGGAAACAGAATCTACTGAA 90.91% 37 , q e guide sequence at its 3’ end is selected from any one of SEQ ID NOs: 900 or 601, or 901-917 in 5’ to 3 orientation (see below).
- an exemplary sequence for use with SluCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one off SEQ ID NOs: 900 or 601, or 901-917, or a sequence that differs from any one of SEQ ID NOs: 900 or 601, or 901-917 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- the scaffold sequence suitable for use with SluCas9 to follow the guide sequence at its 3’ end is selected from any one of SEQ ID NOs: 901-917 in 5’ to 3 orientation (see below).
- an exemplary sequence for use with SluCas9 to follow the 3’ end of the guide sequence is a sequence that is at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to any one off SEQ ID NOs: 901-917, or a sequence that differs from any one of SEQ ID NOs: 901-917 by no more than 1, 2, 3, 4, 5, 10, 15, 20, or 25 nucleotides.
- the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 900. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 601. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 900. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 901.
- the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 902. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 903. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 904. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 905.
- the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 906. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 907. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 908. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 909.
- the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 910. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 911. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 912. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 913.
- the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 914. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 915. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 916. In some embodiments, the nucleic acid encoding the gRNA or the nucleic acid encoding the pair of gRNAs comprises a sequence comprising SEQ ID NO: 917.
- one of the gRNAs comprises a sequence selected from any one of SEQ ID NOs: 900 or 601, or 901-917. In some embodiments, comprising a pair of gRNAs, both of the gRNAs comprise a sequence selected from any one of SEQ ID NOs: 900 or 601, or 901-917. In some embodiments, comprising a pair of gRNAs, the nucleotides 3’ of the guide sequence of the gRNAs are the same sequence. In some embodiments, comprising a pair of gRNAs, the nucleotides 3’ of the guide sequence of the gRNAs are different sequences.
- the scaffold sequence comprises one or more alterations in the stem loop 1 as compared to the stem loop 1 of a wildtype SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 900) or a reference SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 901).
- a wildtype SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 900
- a reference SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 901.
- the scaffold sequence comprises one or more alterations in the stem loop 2 as compared to the stem loop 2 of a wildtype SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 900) or a reference SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 901).
- a wildtype SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 900
- a reference SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 901.
- the scaffold sequence comprises one or more alterations in the tetraloop as compared to the tetraloop of a wildtype SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 900) or a reference SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 901).
- a wildtype SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 900
- a reference SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 901
- the scaffold sequence comprises one or more alterations in the repeat region as compared to the repeat region of a wildtype SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 900) or a reference SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 901).
- a wildtype SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 900
- a reference SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 901
- the scaffold sequence comprises one or more alterations in the anti-repeat region as compared to the anti-repeat region of a wildtype SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 900) or a reference SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 901).
- a wildtype SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 900
- a reference SluCas9 scaffold sequence e.g., a scaffold comprising the sequence of SEQ ID NO: 901
- the scaffold sequence comprises one or more alterations in the linker region as compared to the linker region of a wildtype SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 900) or a reference SluCas9 scaffold sequence (e.g., a scaffold comprising the sequence of SEQ ID NO: 901). See, e.g., Nishimasu et al., 2015, Cell, 162:1113-1126 for description of regions of a scaffold.
- a tracrRNA comprises (5’ to 3’) a second complementary domain and a proximal domain.
- an sgRNA comprises (5’ to 3’) at least a spacer sequence, a first complementary domain, a linking domain, a second complementary domain, and a proximal domain.
- a sgRNA or tracrRNA may further comprise a tail domain.
- the linking domain may be hairpin-forming.
- compositions comprising one or more guide RNAs or one or more nucleic acids encoding one or more guide RNAs comprising a guide sequence disclosed herein in Table 1A, Table 1B, and Table 5 and throughout the specification.
- a composition is provided comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises 17, 18, 19, or 20 contiguous nucleotides of any one of the guide sequences disclosed herein in Table 1A, Table 1B, and Table 5 and throughout the specification.
- a composition comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises a sequence with about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to at least 17, 18, 19, or 20 contiguous nucleotides of a guide sequence shown in Table 1A, Table 1B, and Table 5 and throughout the specification.
- a composition comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises a sequence with about 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a guide sequence shown in Table 1A, Table 1B, and Table 5 and throughout the specification.
- a composition comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises a spacer sequence selected from any one of SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 1012, 1013, 1016, 1017, and 1018 (for SaCas9).
- the spacer sequence is SEQ ID NO: 10.
- the spacer sequence is SEQ ID NO: 12.
- the spacer sequence is SEQ ID NO: 15.
- the spacer sequence is SEQ ID NO: 16.
- the spacer sequence is SEQ ID NO: 20.
- the spacer sequence is SEQ ID NO: 27. In some embodiments, the spacer sequence is SEQ ID NO: 28. In some embodiments, the spacer sequence is SEQ ID NO: 32. In some embodiments, the spacer sequence is SEQ ID NO: 33. In some embodiments, the spacer sequence is SEQ ID NO: 35. In some embodiments, the spacer sequence is SEQ ID NO: 1001. In some embodiments, the spacer sequence is SEQ ID NO: 1003. In some embodiments, the spacer sequence is SEQ ID NO: 1005. In some embodiments, the spacer sequence is SEQ ID NO: 1010. In some embodiments, the spacer sequence is SEQ ID NO: 1012. In some embodiments, the spacer sequence is SEQ ID NO: 1013.
- the spacer sequence is SEQ ID NO: 1016. In some embodiments, the spacer sequence is SEQ ID NO: 1017. In some embodiments, the spacer sequence is SEQ ID NO: 1018.
- a composition is provided comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises a spacer sequence selected from any one of SEQ ID NOs: 3022, 3023, 3028, 3029, 3030, 3031, 3038, 3039, 3052, 3053, 3054, 3055, 3062, 3063, 3064, 3065, 3068, and 3069 (for SaCas9).
- the spacer sequence is SEQ ID NO: 3022. In some embodiments, the spacer sequence is SEQ ID NO: 3023. In some embodiments, the spacer sequence is SEQ ID NO: 3028. In some embodiments, the spacer sequence is SEQ ID NO: 3029. In some embodiments, the spacer sequence is SEQ ID NO: 3030. In some embodiments, the spacer sequence is SEQ ID NO: 3031. In some embodiments, the spacer sequence is SEQ ID NO: 3038. In some embodiments, the spacer sequence is SEQ ID NO: 3039. In some embodiments, the spacer sequence is SEQ ID NO: 3052. In some embodiments, the spacer sequence is SEQ ID NO: 3053.
- the spacer sequence is SEQ ID NO: 3054. In some embodiments, the spacer sequence is SEQ ID NO: 3055. In some embodiments, the spacer sequence is SEQ ID NO: 3062. In some embodiments, the spacer sequence is SEQ ID NO: 3063. In some embodiments, the spacer sequence is SEQ ID NO: 3064. In some embodiments, the spacer sequence is SEQ ID NO: 3065. In some embodiments, the spacer sequence is SEQ ID NO: 3068. In some embodiments, the spacer sequence is SEQ ID NO: 3069.
- a composition comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises a spacer sequence selected from any one of SEQ ID NOs: 131, 134, 135, 136 ,139, 140, 141, 144, 145, 146, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225 (for SluCas9).
- the spacer sequence is SEQ ID NO: 131.
- the spacer sequence is SEQ ID NO: 134.
- the spacer sequence is SEQ ID NO: 135.
- the spacer sequence is SEQ ID NO: 136. In some embodiments, the spacer sequence is SEQ ID NO: 139. In some embodiments, the spacer sequence is SEQ ID NO: 140. In some embodiments, the spacer sequence is SEQ ID NO: 141. In some embodiments, the spacer sequence is SEQ ID NO: 144. In some embodiments, the spacer sequence is SEQ ID NO: 145. In some embodiments, the spacer sequence is SEQ ID NO: 146. In some embodiments, the spacer sequence is SEQ ID NO: 148. In some embodiments, the spacer sequence is SEQ ID NO: 149. In some embodiments, the spacer sequence is SEQ ID NO: 150.
- the spacer sequence is SEQ ID NO: 151. In some embodiments, the spacer sequence is SEQ ID NO: 179. In some embodiments, the spacer sequence is SEQ ID NO: 184. In some embodiments, the spacer sequence is SEQ ID NO: 201. In some embodiments, the spacer sequence is SEQ ID NO: 223. In some embodiments, the spacer sequence is SEQ ID NO: 224. In some embodiments, the spacer sequence is SEQ ID NO: 225.
- a composition comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA comprises a spacer sequence selected from any one of SEQ ID NOs: 4062, 4063, 4068, 4069, 4070, 4071, 4072, 4073, 4078, 4079, 4088, 4089, 4096, 4097, 4098, 4099, 4100, 4101, 4102, 4103, 4158, 4159, 4168, 4169, 4202, 4203, 4220, 4221, 4246, 4247, 4248, 4249, 4250, 4251 (for SluCas9).
- the spacer sequence is SEQ ID NO: 4062.
- the spacer sequence is SEQ ID NO: 4063. In some embodiments, the spacer sequence is SEQ ID NO: 4068. In some embodiments, the spacer sequence is SEQ ID NO: 4069. In some embodiments, the spacer sequence is SEQ ID NO: 4070. In some embodiments, the spacer sequence is SEQ ID NO: 4071. In some embodiments, the spacer sequence is SEQ ID NO: 4072. In some embodiments, the spacer sequence is SEQ ID NO: 4073. In some embodiments, the spacer sequence is SEQ ID NO: 4078. In some embodiments, the spacer sequence is SEQ ID NO: 4079. In some embodiments, the spacer sequence is SEQ ID NO: 4088.
- the spacer sequence is SEQ ID NO: 4089. In some embodiments, the spacer sequence is SEQ ID NO: 4096. In some embodiments, the spacer sequence is SEQ ID NO: 4097. In some embodiments, the spacer sequence is SEQ ID NO: 4098. In some embodiments, the spacer sequence is SEQ ID NO: 4099. In some embodiments, the spacer sequence is SEQ ID NO: 4100. In some embodiments, the spacer sequence is SEQ ID NO: 4101. In some embodiments, the spacer sequence is SEQ ID NO: 4102. In some embodiments, the spacer sequence is SEQ ID NO: 4103. In some embodiments, the spacer sequence is SEQ ID NO: 4158.
- the spacer sequence is SEQ ID NO: 4159. In some embodiments, the spacer sequence is SEQ ID NO: 4168. In some embodiments, the spacer sequence is SEQ ID NO: 4169. In some embodiments, the spacer sequence is SEQ ID NO: 4202. In some embodiments, the spacer sequence is SEQ ID NO: 4203. In some embodiments, the spacer sequence is SEQ ID NO: 4220. In some embodiments, the spacer sequence is SEQ ID NO: 4221. In some embodiments, the spacer sequence is SEQ ID NO: 4246. In some embodiments, the spacer sequence is SEQ ID NO: 4247. In some embodiments, the spacer sequence is SEQ ID NO: 4248.
- the spacer sequence is SEQ ID NO: 4249. In some embodiments, the spacer sequence is SEQ ID NO: 4250. In some embodiments, the spacer sequence is SEQ ID NO: 4251.
- a composition is provided comprising a guide RNA, or nucleic acid encoding a guide RNA, wherein the guide RNA further comprises a trRNA.
- the crRNA comprising the spacer sequence
- trRNA may be associated as a single RNA (sgRNA) or may be on separate RNAs (dgRNA).
- a composition comprising a single nucleic acid molecule encoding, or two nucleic acid molecules where one molecule encodes, 1) one or more guide RNA that comprises a guide sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000- 3069; and 2) a SaCas9.
- composition comprising a single nucleic acid molecule encoding, or two nucleic acid molecules where one molecule encodes, 1) one or more guide RNA that comprises a guide sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251; and 2) a SluCas9.
- compositions comprising a single nucleic acid molecule encoding, or two nucleic acid molecules where one molecule encodes, 1) one or more guide RNA that comprises a guide sequence that is at least 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, or 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, 3000-3069; and 2) a SaCas9.
- composition comprising a single nucleic acid molecule encoding 1) one or more guide RNA that comprises a guide sequence that is at least 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, or 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251; and 2) a SluCas9.
- compositions comprising a single nucleic acid molecule encoding, or two nucleic acid molecules where one molecule encodes, 1) one or more guide RNA that comprises a guide sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069; and 2) a SaCas9.
- compositions comprising a single nucleic acid molecule encoding, or two nucleic acid molecules where one molecule encodes, 1) one or more guide RNA that comprises a guide sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251; and 2) a SluCas9.
- the nucleic acid molecule may be a vector.
- a composition comprising a single nucleic acid molecule encoding a guide RNA and Cas9, wherein the nucleic acid molecule is a vector.
- the vector is a viral vector.
- the viral vector is a non-integrating viral vector (i.e., that does not insert sequence from the vector into a host chromosome).
- the viral vector is an adeno-associated virus vector (AAV), a lentiviral vector, an integrase-deficient lentiviral vector, an adenoviral vector, a vaccinia viral vector, an alphaviral vector, or a herpes simplex viral vector.
- the vector comprises a muscle-specific promoter.
- Exemplary muscle-specific promoters include a muscle creatine kinase promoter, a desmin promoter, an MHCK7 promoter, or an SPc5-12 promoter. See US 2004/0175727 Al; Wang et al., Expert Opin Drug Deliv. (2014) 11, 345-364; Wang et al., Gene Therapy (2008) 15, 1489-1499.
- the muscle-specific promoter is a CK8 promoter.
- the muscle-specific promoter is a CK8e promoter.
- the vector may be an adeno-associated virus vector (AAV).
- the muscle specific promoter is the CK8 promoter.
- the CK8 promoter has the following sequence (SEQ ID NO. 700):
- the muscle-cell cell specific promoter is a variant of the CK8 promoter, called CK8e.
- the size of the CK8e promoter is 436 bp.
- the CK8e promoter has the following sequence (SEQ ID NO. 701):
- the vector comprises one or more of a U6, Hl, or 7SK promoter.
- the U6 promoter is the human U6 promoter (e.g., the U6L promoter or U6S promoter).
- the promoter is the murine U6 promoter.
- the 7SK promoter is a human 7SK promoter.
- the 7SK promoter is the 7SK1 promoter.
- the 7SK promoter is the 7SK2 promoter.
- the Hl promoter is a human Hl promoter (e.g., the H1L promoter or the HIS promoter).
- the vector comprises multiple guide sequences, wherein each guide sequence is under the control of a separate promoter. In some embodiments, each of the multiple guide sequences comprises a different sequence. In some embodiments, each of the multiple guide sequences comprise the same sequence (e.g., each of the multiple guide sequences comprise the same spacer sequence). In some embodiments, each of the multiple guide sequences comprises the same spacer sequence and the same scaffold sequence. In some embodiments, each of the multiple guide sequences comprises different spacer sequences and different scaffold sequences. In some embodiments, each of the multiple guide sequences comprises the same spacer sequence, but comprises a different scaffold sequence. In some embodiments, each of the multiple guide sequences comprises different spacer sequences and different scaffold sequences.
- each of the separate promoters comprises the same nucleotide sequence (e.g., the U6 promoter sequence). In some embodiments, each of the separate promoters comprises a different nucleotide sequence (e.g. , the U6, Hl, and/or 7SK promoter sequence).
- the U6 promoter comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 702:
- the Hl promoter comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 703: [00113]
- the 7SK promoter comprises a nucleotide sequence that is at least
- the U6 promoter is a hU6c promoter and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 705:
- the U6 promoter is a variant of the hU6c promoter.
- the variant of the hU6c promoter comprises alternative nucleotides as compared to the sequence of SEQ ID NO: 705.
- the variant of the hU6c promoter comprises fewer nucleotides as compared to the 249 nucleotides of SEQ ID NO: 705.
- the variant of the hU6c promoter has fewer nucleotides in the nucleosome binding sequence of the hU6c promoter of SEQ ID NO: 705.
- the variant of the hU6c promoter lacks all of or at least a portion of (e.g., at least 5, 10, 15, 20, 25, or 30 nucleotides) the nucleotides corresponding to nucleotides 96-125 of SEQ ID NO: 705. In some embodiments, the variant of the hU6c promoter lacks all of or at least a portion of (e.g., at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, or 60 nucleotides) the nucleotides corresponding to nucleotides 81-140 of SEQ ID NO: 705.
- the variant of the hU6c promoter lacks all of or at least a portion of (e.g., at least 10, 20, 30, 40, 50, 60, 65, 70, 75, 80, or 85 nucleotides) the nucleotides corresponding to nucleotides 66- 150 of SEQ ID NO: 705. In some embodiments, the variant of the hU6c promoter lacks all of or at least a portion of (e.g., at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 nucleotides) the nucleotides corresponding to nucleotides 51-170 of SEQ ID NO: 705.
- the variant of the hU6c promoter lacks the nucleotides corresponding to nucleotides 96-125 of SEQ ID NO: 705. In some embodiments, the variant of the hU6c promoter comprises 129-219 nucleotides. In some embodiments, the variant of the hU6c promoter comprises 219 nucleotides. In some embodiments, the variant of the hU6c promoter comprises 189 nucleotides. In some embodiments, the variant of the hU6c promoter comprises 159 nucleotides. In some embodiments, the variant of the hU6c promoter comprises 129 nucleotides.
- the U6 promoter is hU6d30 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9001:
- the U6 promoter is hU6d60 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9002:
- the U6 promoter is hU6d90 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9003:
- the U6 promoter is hU6dl20 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9004:
- the 7SK promoter is a 7SK2 promoter and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 706:
- the 7SK promoter is a variant of the 7SK2 promoter.
- the variant of the 7SK2 promoter comprises alternative nucleotides as compared to the sequence of SEQ ID NO: 706.
- the variant of the 7SK2 promoter e.g., comprises fewer nucleotides as compared to the 243 nucleotides of SEQ ID NO: 706.
- the variant of the 7SK2 promoter has fewer nucleotides in the nucleosome binding sequence of the 7SK2 promoter of SEQ ID NO: 706.
- the variant of the 7SK2 promoter lacks all of or at least a portion of (e.g., at least 5, 10, 15, 20, 25, or 30 nucleotides) the nucleotides corresponding to nucleotides 95-124 of SEQ ID NO: 706. In some embodiments, the variant of the 7SK2 promoter lacks all of or at least a portion of (e.g., at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, or 60 nucleotides) the nucleotides corresponding to nucleotides 81-140 of SEQ ID NO: 706.
- the variant of the 7SK2 promoter lacks all of or at least a portion of (e.g., at least 10, 20, 30, 40, 50, 60, 65, 70, 75, 80, 85 or 90 nucleotides) the nucleotides corresponding to nucleotides 67-156 of SEQ ID NO: 706. In some embodiments, the variant of the 7SK2 promoter lacks all of or at least a portion of (e.g., at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 nucleotides) the nucleotides corresponding to nucleotides 52-171 of SEQ ID NO: 706.
- the variant of the 7SK2 promoter comprises 123-213 nucleotides. In some embodiments, the variant of the 7SK2 promoter comprises 213 nucleotides. In some embodiments, the variant of the 7SK2 promoter comprises 183 nucleotides. In some embodiments, the variant of the 7SK2 promoter comprises 153 nucleotides. In some embodiments, the variant of the 7SK2 promoter comprises 123 nucleotides.
- the 7SK promoter is 7SKd30 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9006: CTGCAGTATTTAGCATGCCCCACCCATCTGCAAGGCATTCTGGATAGTGTCAAAACAGCC GGAAATCAAGTCCGTTTATCTCAAACTTTAGCATTTAAATTAGATTTTAGTTAAATTTCCT GCTGAAGCTCTAGTACGATAAGCAACTTGACCTAAGTGTAAAGTTGAGACTTCCTTCAGG TTTATATAGCTTGTGCGCCGCTTGGGTACCTC.
- the 7SK promoter is 7SKd60 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9007: CTGCAGTATTTAGCATGCCCCACCCATCTGCAAGGCATTCTGGATAGTGTCAAAACAGCC GGAAATCAAGTCCGTTTATCTTAAATTTCCTGCTGAAGCTCTAGTACGATAAGCAACTTG ACCTAAGTGTAAAGTTGAGACTTCCTTCAGGTTTATATAGCTTGTGCCGCTTGGGTAC CTC.
- the 7SK promoter is 7SKd90 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9008: CTGCAGTATTTAGCATGCCCCACCCATCTGCAAGGCATTCTGGATAGTGTCAAAACAGCC GGAAATAGCTCTAGTACGATAAGCAACTTGACCTAAGTGTAAAGTTGAGACTTCCTTCAG GTTTATATAGCTTGTGCGCCGCTTGGGTACCTC.
- the 7SK promoter is 7SKd120 and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 9009: [00126] CTGCAGTATTTAGCATGCCCCACCCATCTGCAAGGCATTCTGGATAGTGTCAG CAACTTGACCTAAGTGTAAAGTTGAGACTTCCTTCAGGTTTATATAGCTTGTGCGCCGCTT GGGTACCTC.
- the H1 promoter is a H1m or mH1 promoter and comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 707: AATATTTGCATGTCGCTATGTGTTCTGGGAAATCACCATAAACGTGAAATGTCTTTGGAT TTGGGAATCTTATAAGTTCTGTATGAGACCACTCTTTCCC.
- the Ck8e promoter comprises a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 701 TGCCCATGTAAGGAGGCAAGGCCTGGGGACACCCGAGATGCCTGGTTATAATTAACCCA GACATGTGGCTGCCCCCCCCCCCAACACCTGCTGCCTCTAAAAATAACCCTGCATGCC ATGTTCCCGGCGAAGGGCCAGCTGTCCCCCGCCAGCTAGACTCAGCACTTAGTTTAGGAA CCAGTGAGCAAGTCAGCCCTTGGGGCAGCCCATACAAGGCCATGGGGCTGGGCAAGCTG CACGCCTGGGTCCGGGGTGGGCACGGTGCCCGGGCAACGAGCTGAAAGCTCATCTGCTC TCAGGGGCCCCTGGGGCTGGGCAAGCTG CACGCCTGGGTCCGGGGTGGGCACGGTGCCCGGGCAACGAGCTGAAAGCTCATCTGCTC TCAG
- the vector comprises multiple inverted terminal repeats (ITRs). These ITRs may be of an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, or AAV9 serotype. In some embodiments, the ITRs are of an AAV2 serotype.
- the 5’ ITR comprises a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of SEQ ID NO: 709: GGCCACTCCCTCTCTGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCCG ACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGG CCAACTCCATCACTAGGGGTTCCT.
- the 3’ITR comprises a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of SEQ ID NO: 710: AGGAACCCCTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCTCGCTCGCTCACTGAGG CCGGGCGACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAG CGAGCGCAGAGAGGGA.
- a vector comprising a single nucleic acid molecule encoding 1) one or more guide RNA comprising any one or more of the spacer sequences of SEQ ID Nos: 1-35, 100-225, 1000-1078, 2000-2116, 3000-3069, or 4000-4251; and 2) a SaCas9 (for SEQ ID Nos: 1-35, 1000-1078, and 3000-3069) or SluCas9 (for SEQ ID NO: 100-225, 2000-2116, and 4000-4251) is provided.
- the vector is an AAV vector.
- the AAV vector is administered to a subject to treat DMD.
- the vector comprises a nucleic acid encoding a Cas9 protein (e.g., an SaCas9 or SluCas9 protein) and further comprises a nucleic acid encoding one or more single guide RNA(s).
- the nucleic acid encoding the Cas9 protein is under the control of a CK8e promoter.
- the nucleic acid encoding the guide RNA sequence is under the control of a hU6c promoter.
- the vector is AAV9.
- the vector comprises multiple nucleic acids encoding more than one guide RNA. In some embodiments, the vector comprises two nucleic acids encoding two guide RNA sequences. [00134] In some embodiments, the vector comprises a nucleic acid encoding a Cas9 protein (e.g., an SaCas9 protein or SluCas9 protein), a nucleic acid encoding a first guide RNA, and a nucleic acid encoding a second guide RNA. In some embodiments, the vector does not comprise a nucleic acid encoding more than two guide RNAs.
- a Cas9 protein e.g., an SaCas9 protein or SluCas9 protein
- the vector does not comprise a nucleic acid encoding more than two guide RNAs.
- the nucleic acid encoding the first guide RNA is the same as the nucleic acid encoding the second guide RNA. In some embodiments, the nucleic acid encoding the first guide RNA is different from the nucleic acid encoding the second guide RNA. In some embodiments, the vector comprises a single nucleic acid molecule, wherein the single nucleic acid molecule comprises a nucleic acid encoding a Cas9 protein, a nucleic acid encoding a first guide RNA, and a nucleic acid that is the reverse complement to the coding sequence for the second guide RNA.
- the vector comprises a single nucleic acid molecule, wherein the single nucleic acid molecule comprises a nucleic acid encoding a Cas9 protein, a nucleic acid that is the reverse complement to the coding sequence for the first guide RNA, and a nucleic acid that is the reverse complement to the coding sequence for the second guide RNA.
- the nucleic acid encoding a Cas9 protein e.g., an SaCas9 or SluCas9 protein
- the first guide is under the control of the 7SK2 promoter
- the second guide is under the control of the H1m promoter.
- the first guide is under the control of the H1m promoter, and the second guide is under the control of the 7SK2 promoter. In some embodiments, the first guide is under the control of the hU6c promoter, and the second guide is under the control of the H1m promoter. In some embodiments, the first guide is under the control of the H1m promoter, and the second guide is under the control of the hU6c promoter.
- the nucleic acid encoding the Cas9 protein is: a) between the nucleic acids encoding the guide RNAs, b) between the nucleic acids that are the reverse complement to the coding sequences for the guide RNAs, c) between the nucleic acid encoding the first guide RNA and the nucleic acid that is the reverse complement to the coding sequence for the second guide RNA, d) between the nucleic acid encoding the second guide RNA and the nucleic acid that is the reverse complement to the coding sequence for the first guide RNA, e) 5’ to the nucleic acids encoding the guide RNAs, f) 5’ to the nucleic acids that are the reverse complements to the coding sequences for the guide RNAs, g) 5’ to a nucleic acid encoding one of the guide RNAs and 5’ to a nucleic acid that is the reverse complement to the coding sequence for the other guide RNA, h) 3’ to the nucleic acids
- any of the vectors disclosed herein is AAV9.
- the AAV9 vector is less than 5 kb from ITR to ITR in size, inclusive of both ITRs. In particular embodiments, the AAV9 vector is less than 4.9 kb from ITR to ITR in size, inclusive of both ITRs. In further embodiments, the AAV9 vector is less than 4.85 kb from ITR to ITR in size, inclusive of both ITRs. In further embodiments, the AAV9 vector is less than 4.8 kb from ITR to ITR in size, inclusive of both ITRs. In further embodiments, the AAV9 vector is less than 4.75 kb from ITR to ITR in size, inclusive of both ITRs.
- the AAV9 vector is less than 4.7 kb from ITR to ITR in size, inclusive of both ITRs.
- the vector is between 3.9-5 kb, 4-5 kb, 4.2-5 kb, 4.4-5 kb, 4.6-5 kb, 4.7-5 kb, 3.9-4.9 kb, 4.2-4.9 kb, 4.4-4.9 kb, 4.7-4.9 kb, 3.9-4.85 kb, 4.2-4.85 kb, 4.4-4.85 kb, 4.6-4.85 kb, 4.7-4.85 kb, 4.7-4.9 kb, 3.9-4.8 kb, 4.2-4.8 kb, 4.4-4.8 kb or 4.6-4.8 kb from ITR to ITR in size, inclusive of both ITRs.
- any of the vectors disclosed herein comprises a nucleic acid encoding at least a first guide RNA and a second guide RNA.
- the nucleic acid comprises a spacer-encoding sequence for the first guide RNA, a scaffold-encoding sequence for the first guide RNA, a spacer-encoding sequence for the second guide RNA, and a scaffold-encoding sequence of the second guide RNA.
- the spacer-encoding sequence (e.g., encoding any of the spacer sequences disclosed herein) for the first guide RNA is identical to the spacer-encoding sequence for the second guide RNA. In some embodiments, the spacer-encoding sequence (e.g., encoding any of the spacer sequences disclosed herein) for the first guide RNA is different from the spacer-encoding sequence for the second guide RNA. In some embodiments, the scaffold-encoding sequence for the first guide RNA is identical to the scaffold-encoding sequence for the second guide RNA. In some embodiments, the scaffold-encoding sequence for the first guide RNA is different from the scaffold-encoding sequence for the nucleic acid encoding the second guide RNA.
- the scaffold-encoding sequence for the first guide RNA comprises a sequence selected from the group consisting of SEQ ID Nos: 901-916
- the scaffold-encoding sequence for the second guide RNA comprises a different sequence selected from the group consisting of SEQ ID Nos: 901-916.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 902.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 903.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 904.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 905.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 906.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 907.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold- encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 908.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 909.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 910.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold- encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 911.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 912.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 913.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold- encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 914.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 915.
- the scaffold-encoding sequence for the first guide RNA comprises the sequence of SEQ ID NO: 901
- the scaffold-encoding sequence for the second guide RNA comprises the sequence of SEQ ID NO: 916.
- the spacer encoding sequence for the first guide RNA is the same as the spacer-encoding sequence in the second guide RNA
- the scaffold-encoding sequence for the first guide RNA is different from the scaffold- encoding sequence in the nucleic acid encoding the second guide RNA.
- a promoter for expression of element X means that the promoter is oriented in a manner to facilitate expression of the recited element X.
- references to an “sgRNA scaffold sequence” or “a guide RNA scaffold sequence” are synonymous with “a nucleotide sequence/nucleic acid encoding an sgRNA scaffold sequence” or “a nucleotide sequence/nucleic acid encoding a guide RNA scaffold sequence.”
- the disclosure provides for a nucleic acid encoding an SaCas9 (e.g., an SaCas9-KKH) or SluCas9.
- the nucleic acid encodes for one or more nuclear localization signals (e.g., the SV40 NLS and/or the c-Myc NLS) on the C-terminus of the encoded SaCas9 or SluCas9.
- the nucleic acid encodes for one or more NLSs (e.g., the SV40 NLS and/or the c-Myc NLS) on the C-terminus of the encoded SaCas9 or SluCas9, and the nucleic acid does not encode for an NLS on the N-terminus of the encoded SaCas9 or SluCas9.
- the nucleic acid encodes for one or more nuclear localization signals (e.g., the SV40 NLS and/or the c-Myc NLS) on the N-terminus of the encoded SaCas9 or SluCas9.
- the nucleic acid encodes for one or more NLSs (e.g., the SV40 NLS and/or the c-Myc NLS) on the N-terminus of the encoded SaCas9 or SluCas9, and the nucleic acid does not encode for an NLS on the C-terminus of the encoded SaCas9 or SluCas9.
- the nucleic acid encodes for one or more nuclear localization signals (e.g., the SV40 NLS and/or the c-Myc NLS) on the C-terminus of the encoded SaCas9 or SluCas9 and also encodes for one or more NLSs on the N- terminus of the encoded SaCas9 or SluCas9 (e.g., the SV40 NLS and/or the c-Myc NLS).
- the nucleic acid encodes one NLS.
- the nucleic acid encodes two NLSs.
- the nucleic acid encodes three NLSs.
- the one, two, or three NLS may all be C-terminal, N-terminal, or any combination of C- and N-terminal.
- the NLS may be fused/attached directly to the C- or N-terminus or to another NLS, or may be fused/attached indirectly attached through a linker.
- an additional domain may be: a) fused to the N- or C-terminus of the Cas protein (e.g., a Cas9 protein), b) fused to the N-terminus of an NLS fused to the N-terminus of a Cas protein, or c) fused to the C-terminus of an NLS fused to the C-terminus of a Cas protein, with or without a linker.
- an NLS is fused to the N- and/or C-terminus of the Cas protein by means of a linker. In some embodiments, an NLS is fused to the N-terminus of an N-terminally-fused NLS on a Cas protein by means of a linker, and/or an NLS is fused to the C- terminus of a C-terminally fused NLS on a Cas protein by means of a linker. In some embodiments, the linker is GSVD (SEQ ID NO: 550) or GSGS (SEQ ID NO: 551).
- the Cas protein comprises a c-Myc NLS fused to the N-terminus of the Cas protein (or to an N-terminally- fused NLS on the Cas protein), optionally by means of a linker.
- the Cas protein comprises an SV40 NLS fused to the C-terminus of the Cas protein (or to a C-terminally- fused NLS on the Cas protein), optionally by means of a linker.
- the Cas protein comprises a nucleoplasmin NLS fused to the C-terminus of the Cas protein (or to a C- terminally-fused NLS on the Cas protein), optionally by means of a linker.
- the Cas protein comprises: a) a c-Myc NLS fused to the N-terminus of the Cas protein, optionally by means of a linker, b) an SV40 NLS fused to the C-terminus of the Cas protein, optionally by means of a linker, and c) a nucleoplasmin NLS fused to the C-terminus of the SV40 NLS, optionally by means of a linker.
- the Cas protein comprises: a) a c-Myc NLS fused to the N- terminus of the Cas protein, optionally by means of a linker, b) a nucleoplasmin NLS fused to the C- terminus of the Cas protein, optionally by means of a linker, and c) an SV40 NLS fused to the C- terminus of the nucleoplasmin NLS, optionally by means of a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of a promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9, a polyadenylation sequence, a promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SaCas9 e.g., CK8e
- the promoter for expression of the nucleic acid encoding the first sgRNA is any of the hU6c promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 705. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9001. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9002. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9003.
- the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9004. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA is any of the 7SK2 promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 705. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9006. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9007.
- the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9008. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9009. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA is any of the hU6c promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 705. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9001.
- the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9002. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9003. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9004. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA is any of the 7SK2 promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 705.
- the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9006. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9007. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9008. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9009. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA is any of the H1m promoters disclosed herein. In some embodiments, the promoter for SaCas9 is the CK8e promoter.
- the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the one or more NLSs is an SV40 NLS. In some embodiments, the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9, a polyadenylation sequence, an hU6c promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018.
- the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9, a polyadenylation sequence, an 7SK promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SaCas9 e.g., CK8e
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018.
- the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9, a polyadenylation sequence, an H1m promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SaCas9 e.g., CK8e
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018.
- the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an 7SK promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9, a polyadenylation sequence, an H1m promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SaCas9 e.g., CK8e
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018.
- the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9-KKH (e.g., a sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 715 or functional fragments thereof), a polyadenylation sequence, an hU6c promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018. In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9-KKH (e.g., a sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 715 or functional fragments thereof), a polyadenylation sequence, an 7SK promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018. In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9-KKH (e.g., a sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 715 or functional fragments thereof), a polyadenylation sequence, an H1m promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018. In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an 7SK promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding SaCas9-KKH (e.g., a sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 715 or functional fragments thereof), a polyadenylation sequence, an H1m promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 15. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1001 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 1005. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1010. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1012. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 12 and 1013. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 10 and 1016. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1017 and 16.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1018 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 15 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1001. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1005 and 1003.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1003 and 16. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1010 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1012 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1013 and 12. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 1016 and 10.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1017. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 16 and 1018. In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SaCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the nucleic acid sequence encoding SaCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- the one or more NLSs is an SV40 NLS.
- the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SaCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of a promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SluCas9 (e.g., CK8e), a nucleic acid encoding SluCas9, a polyadenylation sequence, a promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SluCas9 e.g., CK8e
- the promoter for expression of the nucleic acid encoding the first sgRNA is any of the hU6c promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 705. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9001. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9002. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9003.
- the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9004. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA is any of the 7SK2 promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 7005. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9006. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9007.
- the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9008. In some embodiments the promoter for expression of the nucleic acid encoding the first sgRNA comprises SEQ ID NO: 9009. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA is any of the hU6c promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 705. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9001.
- the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9002. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9003. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9004. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA is any of the 7SK2 promoters disclosed herein. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 705.
- the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9006. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9007. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9008. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA comprises SEQ ID NO: 9009. In some embodiments the promoter for expression of the nucleic acid encoding the second sgRNA is any of the H1m promoters disclosed herein. In some embodiments, the promoter for SluCas9 is the CK8e promoter.
- the nucleic acid sequence encoding SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the one or more NLSs is an SV40 NLS. In some embodiments, the one or more NLSs is a c-Myc NLS.
- the NLS is fused to the SluCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SluCas9 (e.g., CK8e), a nucleic acid encoding SluCas9, a polyadenylation sequence, an hU6c promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 134. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 136. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 136.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 139 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 141 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 149.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 146 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 134 and 148.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 149. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 139.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 141. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 144. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 144.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 146. In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS).
- NLS nuclear localization sequence
- the nucleic acid sequence encoding SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the one or more NLSs is an SV40 NLS. In some embodiments, the one or more NLSs is a c-Myc NLS. In some embodiments, the NLS is fused to the SluCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SluCas9 (e.g., CK8e), a nucleic acid encoding SluCas9, a polyadenylation sequence, an 7SK promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SluCas9 e.g., CK8e
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 134. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 136. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 136.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 139 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 141 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 149.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 146 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 134 and 148.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 149. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 139.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 141. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 144. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 144.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 146. In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS).
- NLS nuclear localization sequence
- the nucleic acid sequence encoding SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the one or more NLSs is an SV40 NLS. In some embodiments, the one or more NLSs is a c-Myc NLS. In some embodiments, the NLS is fused to the SluCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an hU6c promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SluCas9 (e.g., CK8e), a nucleic acid encoding SluCas9, a polyadenylation sequence, an H1m promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SluCas9 e.g., CK8e
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 134. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 136. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 136.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 139 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 141 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 149.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 146 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 134 and 148.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 149. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 139.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 141. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 144. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 144.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 146. In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS).
- NLS nuclear localization sequence
- the nucleic acid sequence encoding SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the one or more NLSs is an SV40 NLS. In some embodiments, the one or more NLSs is a c-Myc NLS. In some embodiments, the NLS is fused to the SluCas9 with a linker.
- the AAV vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of an 7SK promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SluCas9 (e.g., CK8e), a nucleic acid encoding SluCas9, a polyadenylation sequence, an H1m promoter for expression of a second sgRNA, a second sgRNA guide sequence, and a second sgRNA scaffold sequence.
- SluCas9 e.g., CK8e
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 134. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 135. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 136. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 136.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 139 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 140 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 141 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 149.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 144 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 145 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 146 and 148. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 134 and 148.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 149. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 135 and 150. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 131. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 136 and 151. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 139.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 140. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 141. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 149 and 144. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 150 and 144.
- the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 131 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 151 and 145. In some embodiments, the first sgRNA and the second sgRNA comprise the sequences of SEQ ID NOs: 148 and 146. In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS).
- NLS nuclear localization sequence
- the nucleic acid sequence encoding SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the nucleic acid sequence encoding SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS). In some embodiments, the one or more NLSs is an SV40 NLS. In some embodiments, the one or more NLSs is a c-Myc NLS. In some embodiments, the NLS is fused to the SluCas9 with a linker. [00150] In some embodiments, the disclosure provides for a composition comprising at least two nucleic acids.
- the composition comprises at least two nucleic acid molecules, wherein the first nucleic acid molecule comprises a sequence encoding any of the endonucleases disclosed herein (e.g., a SaCas9 or SluCas9), wherein the second nucleic acid molecule encodes a first guide RNA and a second guide RNA, wherein the first guide RNA and the second guide RNA are not the same sequence, and wherein the second nucleic acid molecule does not encode an endonuclease.
- the first nucleic acid molecule also encodes a copy of the first guide RNA and a copy of the second guide RNA.
- the first nucleic acid molecule does not encode any guide RNAs.
- the second nucleic acid molecule encodes two copies of the first guide RNA and two copies of the second guide RNA. In some embodiments, the second nucleic molecule encodes two copies of the first guide RNA, and one copy of the second guide RNA. In some embodiments, the second nucleic acid molecule encodes one copy of the first guide RNA, and two copies of the second guide RNA. In some embodiments, the second nucleic acid molecule comprises two copies of the first guide RNA, and three copies of the second guide RNA. In some embodiments, the second nucleic acid molecule comprises three copies of the first guide RNA, and two copies of the second guide RNA.
- the second nucleic acid molecule encodes three copies of the first guide RNA and three copies of the second guide RNA.
- the first nucleic acid molecule comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first guide RNA scaffold sequence, the reverse complement of a nucleotide sequence encoding the first guide RNA sequence, the reverse complement of a promoter for expression of the nucleotide sequence encoding the first guide RNA sequence, a promoter for expression of a nucleotide sequence encoding the endonuclease, a nucleotide sequence encoding an endonuclease, a polyadenylation sequence, a promoter for expression of the second guide RNA in the same direction as the promoter for the endonuclease, the second guide RNA sequence, and a second guide RNA scaffold sequence.
- the promoter for expression of the nucleotide sequence encoding the first guide RNA sequence in the first nucleic acid molecule is a U6 promoter and the promoter for expression of the nucleotide sequence encoding the second guide RNA in the first nucleic acid molecule is a U6 promoter.
- the first nucleic acid molecule encodes a Staphylococcus aureus Cas9 (SaCas9) endonuclease
- the first guide RNA comprises the first sequence
- the second guide RNA comprises the second sequence from any one the following pairs of sequences: SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018.
- SEQ ID NOs 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001
- the first guide RNA comprises the sequence of SEQ ID NO: 12 and the second guide RNA comprises the sequence of SEQ ID NO: 1013. In some embodiments, the first guide RNA comprises the sequence of SEQ ID NO: 1013 and the second guide RNA comprises the sequence of SEQ ID NO: 12.
- the first nucleic acid molecule encodes a Staphylococcus lugdunensis (SluCas9) endonuclease
- the first guide RNA comprises the first sequence
- the second guide RNAs comprises the second sequence from any one the following pairs of sequences: SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 145; and 145; and
- the first guide RNA comprises the sequence of SEQ ID NO: 148 and the second guide RNA comprises the sequence of SEQ ID NO: 134; b) the second guide RNA comprises the sequence of SEQ ID NO: 145 and the second guide RNA comprises the sequence of SEQ ID NO: 131, c) the first guide RNA comprises the sequence of SEQ ID NO: 134 and the second guide RNA comprises the sequence of SEQ ID NO: 148; d) the second guide RNA comprises the sequence of SEQ ID NO: 131 and the second guide RNA comprises the sequence of SEQ ID NO: 145.
- the first nucleic acid molecule is in a first vector (e.g., AAV9), and the second nucleic acid is in a separate second vector.
- the first vector is AAV9.
- the second vector is AAV9.
- the AAV9 vector is less than 5 kb from ITR to ITR in size, inclusive of both ITRs.
- the AAV9 vector is less than 4.9 kb from ITR to ITR in size, inclusive of both ITRs.
- the AAV9 vector is less than 4.85 kb from ITR to ITR in size, inclusive of both ITRs.
- the AAV9 vector is less than 4.8 kb from ITR to ITR in size, inclusive of both ITRs. In further embodiments, the AAV9 vector is less than 4.75 kb from ITR to ITR in size, inclusive of both ITRs. In further embodiments, the AAV9 vector is less than 4.7 kb from ITR to ITR in size, inclusive of both ITRs.
- the second vector comprises from 5’ to 3’ with respect to the plus strand: a promoter for expression of a first copy of a first guide RNA (e.g., a U6 promoter), a first copy of a nucleotide sequence encoding a first guide RNA, a first copy of a nucleotide sequence encoding a first guide RNA scaffold, a promoter for expression of a second copy of the first guide RNA (e.g., a H1 promoter), a second copy of the nucleotide sequence encoding the first guide RNA, a second copy of the nucleotide sequence encoding the first guide RNA scaffold, a promoter for expression of a second guide RNA (e.g., a 7SK promoter), a nucleotide sequence encoding a second guide RNA, and a nucleotide sequence encoding a second guide RNA scaffold.
- a promoter for expression of a first copy of a first guide RNA
- the second vector comprises from 5’ to 3’ with respect to the plus strand: a promoter for expression of a first guide RNA (e.g., a U6 promoter), a nucleotide sequence encoding a first guide RNA, a nucleotide sequence encoding a first guide RNA scaffold, a promoter for expression of a second guide RNA (e.g., a 7SK promoter), a nucleotide sequence encoding a second guide RNA, and a nucleotide sequence encoding a second guide RNA scaffold.
- a promoter for expression of a first guide RNA e.g., a U6 promoter
- a nucleotide sequence encoding a first guide RNA e.g., a nucleotide sequence encoding a first guide RNA scaffold
- a promoter for expression of a second guide RNA e.g., a 7SK promoter
- the second vector comprises a stuffer sequence (e.g., a 3’UTR desmin sequence) between the nucleotide sequence encoding the first guide scaffold sequence and the promoter for expression of the second guide sequence.
- the second vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a nucleotide sequence encoding a scaffold for a first guide RNA, the reverse complement of a nucleotide sequence encoding a first guide RNA, the reverse complement of a promoter for expression of the first guide RNA (e.g., a U6c promoter), a promoter for expression of a second guide RNA (e.g., a U6c promoter), a nucleotide sequence encoding a second guide RNA, and a nucleotide sequence encoding a second guide RNA scaffold.
- a stuffer sequence e.g., a 3’UTR desmin sequence
- the second vector comprises a stuffer sequence (e.g., a 3’UTR desmin sequence) between the reverse complement of the promoter for expression of the first guide RNA and the promoter for expression of the second guide RNA.
- the second vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a nucleotide sequence encoding a first copy of a first guide RNA scaffold, the reverse complement of a nucleotide sequence encoding a first copy of the first guide RNA, the reverse complement of a promoter for expression of the first copy of the first guide RNA (e.g., a 7SK2 promoter), the reverse complement of a second copy of the nucleotide sequence encoding the first guide RNA scaffold, the reverse complement of a second copy of the nucleotide sequence encoding the first guide RNA, the reverse complement of a promoter for expression of the second copy of the nucleotide sequence encoding the first guide RNA (e.g., a 3’UT
- the second vector comprises a stuffer sequence (e.g., a 3’UTR desmin sequence) between the reverse complement of the promoter for expression of the second copy of the first guide RNA and the promoter for expression of the first copy of the second guide RNA.
- a stuffer sequence e.g., a 3’UTR desmin sequence
- the second vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a nucleotide sequence encoding a first copy of a first guide RNA scaffold, the reverse complement of a first copy of a nucleotide sequence encoding the first guide RNA, the reverse complement of a promoter for expression of the first copy of the first guide RNA (e.g., a 7SK2 promoter), the reverse complement of a first copy of a nucleotide sequence encoding a second guide RNA scaffold, the reverse complement of a nucleotide sequence encoding the first copy of the second guide RNA, the reverse complement of a promoter for expression of the first copy of the second guide RNA (e.g., a hU6c promoter), a promoter for expression of a second copy of the second guide RNA (e.g., a hU6c promoter), a second copy of the nucleotide sequence encoding the second guide RNA,
- the second vector comprises a stuffer sequence (e.g., a 3’UTR desmin sequence) between the reverse complement of the promoter for expression of the first copy of the second guide RNA and the promoter for expression of the second copy of the first guide RNA.
- a stuffer sequence e.g., a 3’UTR desmin sequence
- the second vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a nucleotide sequence encoding a first guide RNA scaffold, the reverse complement of a nucleotide sequence encoding a first guide RNA, the reverse complement of a promoter for expression of a first guide RNA (e.g., a hU6c promoter), a promoter for expression of a second guide RNA (e.g., a hU6c promoter), a nucleotide sequence encoding a second guide RNA, and a nucleotide sequence encoding a second guide RNA scaffold.
- a first guide RNA e.g., a hU6c promoter
- a promoter for expression of a second guide RNA e.g., a hU6c promoter
- a nucleotide sequence encoding a second guide RNA e.g., a hU6c promoter
- the second vector comprises a stuffer sequence (e.g., a 3’UTR desmin sequence) between the reverse complement of the promoter for expression of the first guide RNA and the promoter for expression of the second guide RNA.
- the first guide RNA is different from the second guide RNA.
- the first guide RNA comprises the sequence of SEQ ID NO: 12 and the second guide RNA comprises the sequence of SEQ ID NO: 1013.
- the first guide RNA comprises the sequence of SEQ ID NO: 1013 and the second guide RNA comprises the sequence of SEQ ID NO: 12.
- the first guide RNA comprises the sequence of SEQ ID NO: 148 and the second guide RNA comprises the sequence of SEQ ID NO: 134; b) the second guide RNA comprises the sequence of SEQ ID NO: 145 and the second guide RNA comprises the sequence of SEQ ID NO: 131; c) the first guide RNA comprises the sequence of SEQ ID NO: 134 and the second guide RNA comprises the sequence of SEQ ID NO: 148; or d) the second guide RNA comprises the sequence of SEQ ID NO: 131 and the second guide RNA comprises the sequence of SEQ ID NO: 145.
- the scaffold for the first guide RNA comprises the sequence of SEQ ID NO: 901.
- the scaffold for the second guide RNA comprises the sequence of SEQ ID NO: 901.
- any of the second vectors comprises a stuffer sequence.
- the stuffer sequence is a 3’UTR sequence.
- the 3’UTR desmin sequence comprises a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence of SEQ ID NO: 552 (taattaacagatttgt taatgaagaggaaatatacaaatattaatgaacaaaatagtgtgtttagaacaagactcacatacaggagacatacacatgttaaaggaggcattttga atttgtggggaaaacttacaaattcagtatagggtttggagcactttgatagctaagaggtggggggggggggggggggcagagtggggggcagagtgggggg
- the composition comprises one or more nucleic acids encoding an RNA-targeted endonuclease and one or more guide RNAs
- the one or more nucleic acids are designed such that they express the one or more guide RNAs at an equivalent or higher level (e.g., a greater number of expressed transgene copies) as compared to the expression level of the RNA- targeted endonuclease.
- the one or more nucleic acids are designed such that they express (e.g., on average in 100 cells) the one or more guide RNAs at least a 1.1, 1.2, 1.3, 1.4, or 1.5 times higher level (e.g., a greater number of expressed transgene copies) as compared to the expression level of the RNA-targeted endonuclease.
- the one or more nucleic acids are designed such that they express the one or more guide RNAs at 1.01-1.5, 1.01-1.4, 1.01-1.3, 1.01-1.2, 1.01-1.1, 1.1-2.0, 1.1-1.8, 1.1-1.6, 1.1-1.4, 1.1-1.3, 1.2-2.0, 1.2-1.8, 1.2-1.6, 1.2-1.4, 1.4-2.0, 1.4-1.8, 1.4-1.6, 1.6-2.0, 1.6-1.8, or 1.8-2.0 times higher level (e.g., a greater number of expressed transgene copies) as compared to the expression level of the RNA-targeted endonuclease.
- higher level e.g., a greater number of expressed transgene copies
- the one or more guide RNAs are designed to express a higher level than the RNA- targeted endonuclease by: a) utilizing one or more regulatory elements (e.g., promoters or enhancers) that express the one or more guide RNAs at a higher level as compared to the regulatory elements (e.g., promoters or enhancers) for expression of the RNA-targeted endonuclease; and/or b) expressing more copies of one or more of the guide RNAs as compared to the number of copies of the RNA- targeted endonuclease (e.g., 2x or 3x as many copies of the nucleotide sequences encoding the one or more guide RNAs as compared to the number of copies of the nucleotide sequences encoding the RNA-targeted endonuclease).
- regulatory elements e.g., promoters or enhancers
- the composition comprises multiple nucleic acid molecules (e.g., in multiple vectors), wherein for every nucleotide sequence encoding an RNA-targeted endonuclease in the nucleic acid molecules in the composition, there are two or three copies of the nucleotide sequence encoding the guide RNA in the nucleic acid molecules in the composition.
- the composition comprises a first guide RNA and a second guide RNA, wherein the first guide RNA and the second guide RNA are not the same (e.g., any of the guide RNA pairs disclosed herein), and for every nucleotide sequence encoding an RNA- targeted endonuclease in the nucleic acid molecules in the composition, there are two or three copies of the nucleotide sequence encoding the first guide RNA and/or the second guide RNA.
- any of the nucleic acids disclosed herein encodes an RNA-targeted endonuclease.
- the RNA-targeted endonuclease has cleavase activity, which can also be referred to as double-strand endonuclease activity.
- the RNA- targeted endonuclease comprises a Cas nuclease.
- Cas9 nucleases include those of the type II CRISPR systems of S. pyogenes, S. aureus, and other prokaryotes (see, e.g., the list in the next paragraph), and modified (e.g., engineered or mutant) versions thereof. See, e.g., US2016/0312198 A1; US 2016/0312199 A1.
- the RNA-targeted endonuclease is a type II CRISPR Cas enzyme.
- Cas nucleases include a Csm or Cmr complex of a type III CRISPR system or the Cas10, Csm1, or Cmr2 subunit thereof; and a Cascade complex of a type I CRISPR system, or the Cas3 subunit thereof.
- the Cas nuclease may be from a Type-IIA, Type-IIB, or Type-IIC system.
- Makarova et al., NAT. REV e.g., Makarova et al., NAT. REV.
- Non-limiting exemplary species that the Cas nuclease can be derived from include Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Staphylococcus aureus, Listeria innocua, Lactobacillus gasseri, Francisella novicida, Wolinella succinogenes, Sutterella wadsworthensis, Gammaproteobacterium, Neisseria meningitidis, Campylobacter jejuni, Pasteurella multocida, Fibrobacter succinogene, Rhodospirillum rubrum, Nocardiopsis rougevillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudo
- the nucleic acid encoding SaCas9 encodes an SaCas9 comprising an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 711: KRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRI QRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEE DTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELRSVKYA YNADLYNALNDLNNLVITRDENEKLEYYEKFQI
- the nucleic acid encoding SaCas9 comprises the nucleic acid of SEQ ID NO: 9014: [00157] AAGCGCAATTACATCCTGGGCCTGGATATCGGCATCACCTCCGTGGGCTACG GCATCATCGACTATGAGACACGGGATGTGATCGACGCCGGCGTGAGACTGTTCAAGGAG GCCAACGTGGAGAACAATGAGGGCCGGCGGAGCAAGAGGGGAGCAAGGCGCCTGAAGC GGAGAAGGCGCCACAGAATCCAGAGAGTGAAGAAGCTGCTGTTCGATTACAACCTGCTG ACCGACCACTCCGAGCTGTCTGGCATCAATCCTTATGAGGCCCGGGTGAAGGGCCTGTCC CAGAAGCTGTCTGAGGAGGAGTTTTCTGCCGCCCTGCTGCACCTGGCAAAGAGGAGAGG CGTGCACAACGTGAATGAGGTGGAGGAGGACACCGGCAACGAGCTGAGCACAAAGGAG CAGATCAGCCGCAATTCCAAGGCCCTGGAG CAGATCAGCCGCAATT
- the SaCas9 comprises an amino acid sequence of SEQ ID NO: 711.
- the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an E at the position corresponding to position 781 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an N at the position corresponding to position 967 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an R at the position corresponding to position 1014 of SEQ ID NO: 711.
- the SaCas9 comprises a K at the position corresponding to position 781 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises a K at the position corresponding to position 967 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an H at the position corresponding to position 1014 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an amino acid other than an E at the position corresponding to position 781 of SEQ ID NO: 711; an amino acid other than an N at the position corresponding to position 967 of SEQ ID NO: 711; and an amino acid other than an R at the position corresponding to position 1014 of SEQ ID NO: 711.
- the SaCas9 comprises a K at the position corresponding to position 781 of SEQ ID NO: 711; a K at the position corresponding to position 967 of SEQ ID NO: 711; and an H at the position corresponding to position 1014 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an R at the position corresponding to position 244 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an N at the position corresponding to position 412 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an N at the position corresponding to position 418 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an R at the position corresponding to position 653 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an amino acid other than an R at the position corresponding to position 244 of SEQ ID NO: 711; an amino acid other than an N at the position corresponding to position 412 of SEQ ID NO: 711; an amino acid other than an N at the position corresponding to position 418 of SEQ ID NO: 711; and an amino acid other than an R at the position corresponding to position 653 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an A at the position corresponding to position 244 of SEQ ID NO: 711.
- the SaCas9 comprises an A at the position corresponding to position 412 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an A at the position corresponding to position 418 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an A at the position corresponding to position 653 of SEQ ID NO: 711. In some embodiments, the SaCas9 comprises an A at the position corresponding to position 244 of SEQ ID NO: 711; an A at the position corresponding to position 412 of SEQ ID NO: 711; an A at the position corresponding to position 418 of SEQ ID NO: 711; and an A at the position corresponding to position 653 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid other than an R at the position corresponding to position 244 of SEQ ID NO: 711; an amino acid other than an N at the position corresponding to position 412 of SEQ ID NO: 711; an amino acid other than an N at the position corresponding to position 418 of SEQ ID NO: 711; an amino acid other than an R at the position corresponding to position 653 of SEQ ID NO: 711; an amino acid other than an E at the position corresponding to position 781 of SEQ ID NO: 711; an amino acid other than an N at the position corresponding to position 967 of SEQ ID NO: 711; and an amino acid other than an R at the position corresponding to position 1014 of SEQ ID NO: 711.
- the SaCas9 comprises an A at the position corresponding to position 244 of SEQ ID NO: 711; an A at the position corresponding to position 412 of SEQ ID NO: 711; an A at the position corresponding to position 418 of SEQ ID NO: 711; an A at the position corresponding to position 653 of SEQ ID NO: 711; a K at the position corresponding to position 781 of SEQ ID NO: 711; a K at the position corresponding to position 967 of SEQ ID NO: 711; and an H at the position corresponding to position 1014 of SEQ ID NO: 711.
- the SaCas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 715 (designated herein as SaCas9-KKH or SACAS9KKH): KRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRI QRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEE DTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELRSVKYA YNADLYNALNDLNNLVITRDENEKLEYYY
- the SaCas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 716 (designated herein as SaCas9-HF): KRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRI QRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEE DTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELASVKYA YNADLYNALNDLNNLVITRDENEKLEYYEKFQIIEN
- the SaCas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 717 (designated herein as SaCas9-KKH-HF): KRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRI QRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEE DTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQK AYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELASVKYA YNADLYNALNDLNNLVITRDENEKLEYYEKFQ
- the nucleic acid encoding SluCas9 encodes a SluCas9 comprising an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 712: NQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRLE RVKKLLEDYNLLDQSQIPQSTNPYAIRVKGLSEALSKDELVIALLHIAKRRGIHKIDVIDSNDD VGNELSTKEQLNKNSKLLKDKFVCQIQLERMNEGQVRGEKNRFKTADIIKEIIQLLNVQKNFH QLDENFINKYIELVEMRREYFEGPGKGSPYGWEGDPKAWYETLMGHCTYFPDELRSVKYAY SADLFNALNDLNNLVIQRDGLSKLEYHE
- the SluCas9 is a variant of the amino acid sequence of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an amino acid other than an Q at the position corresponding to position 781 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an amino acid other than an R at the position corresponding to position 1013 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises a K at the position corresponding to position 781 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises a K at the position corresponding to position 966 of SEQ ID NO: 712.
- the SluCas9 comprises an H at the position corresponding to position 1013 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an amino acid other than an Q at the position corresponding to position 781 of SEQ ID NO: 712; and an amino acid other than an R at the position corresponding to position 1013 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises a K at the position corresponding to position 781 of SEQ ID NO: 712; a K at the position corresponding to position 966 of SEQ ID NO: 712; and an H at the position corresponding to position 1013 of SEQ ID NO: 712.
- the SluCas9 comprises an amino acid other than an R at the position corresponding to position 246 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an amino acid other than an N at the position corresponding to position 414 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an amino acid other than a T at the position corresponding to position 420 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an amino acid other than an R at the position corresponding to position 655 of SEQ ID NO: 712.
- the SluCas9 comprises an amino acid other than an R at the position corresponding to position 246 of SEQ ID NO: 712; an amino acid other than an N at the position corresponding to position 414 of SEQ ID NO: 712; an amino acid other than a T at the position corresponding to position 420 of SEQ ID NO: 712; and an amino acid other than an R at the position corresponding to position 655 of SEQ ID NO: 712.
- the SluCas9 comprises an A at the position corresponding to position 246 of SEQ ID NO: 712.
- the SluCas9 comprises an A at the position corresponding to position 414 of SEQ ID NO: 712.
- the SluCas9 comprises an A at the position corresponding to position 420 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an A at the position corresponding to position 655 of SEQ ID NO: 712. In some embodiments, the SluCas9 comprises an A at the position corresponding to position 246 of SEQ ID NO: 712; an A at the position corresponding to position 414 of SEQ ID NO: 712; an A at the position corresponding to position 420 of SEQ ID NO: 712; and an A at the position corresponding to position 655 of SEQ ID NO: 712.
- the SluCas9 comprises an amino acid other than an R at the position corresponding to position 246 of SEQ ID NO: 712; an amino acid other than an N at the position corresponding to position 414 of SEQ ID NO: 712; an amino acid other than a T at the position corresponding to position 420 of SEQ ID NO: 712; an amino acid other than an R at the position corresponding to position 655 of SEQ ID NO: 712; an amino acid other than an Q at the position corresponding to position 781 of SEQ ID NO: 712; a K at the position corresponding to position 966 of SEQ ID NO: 712; and an amino acid other than an R at the position corresponding to position 1013 of SEQ ID NO: 712.
- the SluCas9 comprises an A at the position corresponding to position 246 of SEQ ID NO: 712; an A at the position corresponding to position 414 of SEQ ID NO: 712; an A at the position corresponding to position 420 of SEQ ID NO: 712; an A at the position corresponding to position 655 of SEQ ID NO: 712; a K at the position corresponding to position 781 of SEQ ID NO: 712; a K at the position corresponding to position 966 of SEQ ID NO: 712; and an H at the position corresponding to position 1013 of SEQ ID NO: 712.
- the SluCas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 718 (designated herein as SluCas9-KH or SLUCAS9KH): NQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRLE RVKKLLEDYNLLDQSQIPQSTNPYAIRVKGLSEALSKDELVIALLHIAKRRGIHKIDVIDSNDD VGNELSTKEQLNKNSKLLKDKFVCQIQLERMNEGQVRGEKNRFKTADIIKEIIQLLNVQKNFH QLDENFINKYIELVEMRREYFEGPGKGSPYGWEGDPKAWYETLMGHCTYFPDELRSVKYAY SADLFNALNDLNNLVIQRD
- the SluCas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 719 (designated herein as SluCas9-HF): NQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRLE RVKKLLEDYNLLDQSQIPQSTNPYAIRVKGLSEALSKDELVIALLHIAKRRGIHKIDVIDSNDD VGNELSTKEQLNKNSKLLKDKFVCQIQLERMNEGQVRGEKNRFKTADIIKEIIQLLNVQKNFH QLDENFINKYIELVEMRREYFEGPGKGSPYGWEGDPKAWYETLMGHCTYFPDELASVKYAY SADLFNALNDLNNLVIQRDGLSKLEYHEKYHI
- the SluCas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 720 (designated herein as SluCas9-HF-KH): NQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRLE RVKKLLEDYNLLDQSQIPQSTNPYAIRVKGLSEALSKDELVIALLHIAKRRGIHKIDVIDSNDD VGNELSTKEQLNKNSKLLKDKFVCQIQLERMNEGQVRGEKNRFKTADIIKEIIQLLNVQKNFH QLDENFINKYIELVEMRREYFEGPGKGSPYGWEGDPKAWYETLMGHCTYFPDELASVKYAY SADLFNALNDLNNLVIQRDGLSKLEYHE
- the Cas protein is any of the engineered Cas proteins disclosed in Schmidt et al., 2021, Nature Communications, “Improved CRISPR genome editing using small highly active and specific engineered RNA-guided nucleases.”
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7021 (designated herein as sRGN1): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL DRVKHLLAEYDLLDLTNIPKSTNPYQTRVKGLNEKLSKDELVIALLHIAKRRGIHNVDVAAD KEETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIVREAKKIID
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7022 (designated herein as sRGN2): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL ERVKSLLSEYKIISGLAPTNNQPYNIRVKGLTEQLTKDELAVALLHIAKRRGIHKIDVIDSNDD VGNELSTKEQLNKNSKLLKDKFVCQIQLERMNEGQVRGEKNRFKTADIIKEIIQLLNVQKNFH QLDENFINKYIELVEMRREYFEGPGQGSPFGWNGDLKKWYEMLMGHCTYFPQELRSVKYA YSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVF
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7023 (designated herein as sRGN3): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL ERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIALLHLAKRRGIHNVDVAADKE ETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIVREAKKIIDTQM QYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMGHCTYFPQELRSV KYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFKQ
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7024 (designated herein as sRGN3.1): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL ERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIALLHLAKRRGIHNVDVAADKE ETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIVREAKKIIDTQM QYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMGHCTYFPQELRSV KYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFK
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7025 (designated herein as sRGN3.2): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL ERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIALLHLAKRRGIHNVDVAADKE ETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIVREAKKIIDTQM QYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMGHCTYFPQELRSV KYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFK
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7026 (designated herein as sRGN3.3): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL ERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIALLHLAKRRGIHNVDVAADKE ETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIVREAKKIIDTQM QYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMGHCTYFPQELRSV KYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFK
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7027 (designated herein as sRGN4): MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRRIHRL ERVKKLLEDYNLLDQSQIPQSTNPYAIRVKGLSEALSKDELVIALLHIAKRRGIHNINVSSEDE DASNELSTKEQINRNNKLLKDKYVCEVQLQRLKEGQIRGEKNRFKTTDILKEIDQLLKVQKD YHNLDIDFINQYKEIVETRREYFEGPGKGSPYGWEGDPKAWYETLMGHCTYFPDELRSVKY AYSADLFNALNDLNNLVIQRDGLSKLEYHEKYHIIENVF
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7028 (designated herein as Staphylococcus hyicus Cas9 or ShyCas9): MNNYILGLDIGITSVGYGIVDSDTREIKDAGVRLFPEANVDNNEGRRSKRGARRLKR RRIHRLDRVKHLLAEYDLLDLTNIPKSTNPYQTRVKGLNEKLSKDELVIALLHIAKRRGIHNV NVMMDDNDSGNELSTKDQLKKNAKALSDKYVCELQLERFEQDYKVRGEKNRFKTEDFVRE ARKLLETQSKFFEIDQTFIMRYIELIETRREYFEGPGKGSPFGWEGNIKKWFEQMMGHCTYFP EELRSVKYSYSAELFNALND
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7029 (designated herein as Staphylococcus microti Cas9 or Smi Cas9): MEKDYILGLDIGIGSVGYGLIDYDTKSIIDAGVRLFPEANADNNLGRRAKRGARRLKRRRIHR LERVKSLLSEYKIISGLAPTNNQPYNIRVKGLTEQLTKDELAVALLHIAKRRGIHNVDVAADK EETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIVREAKKIIDTQ MQYYPEIDETFKEKYISLVETRREYYEGPGKGSPYGWDADVKKWYQLMMGHCTYFPVEFRS VKYAYTADLYNALNDLNNLTI
- the Cas9 comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7030 (designated herein as Staphylococcus pasteuri Cas9 or Spa Cas9): MKEKYILGLDLGITSVGYGIINFETKKIIDAGVRLFPEANVDNNEGRRSKRGSRRLKRRRIHRL ERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIALLHLAKRRGIHNINVSSEDED ASNELSTKEQINRNNKLLKDKYVCEVQLQRLKEGQIRGEKNRFKTTDILKEIDQLLKVQKDY HNLDIDFINQYKEIVETRREYFEGPGQGSPFGWNGDLKKWYEMLMGHCTYFPQELRSVKYA YSADLFNALNDLNNLIIQRDNSE
- the Cas protein comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7031 (designated herein as Cas12i1): MSNKEKNASETRKAYTTKMIPRSHDRMKLLGNFMDYLMDGTPIFFELWNQFGGGIDRDIISG TANKDKISDDLLLAVNWFKVMPINSKPQGVSPSNLANLFQQYSGSEPDIQAQEYFASNFDTE KHQWKDMRVEYERLLAELQLSRSDMHHDLKLMYKEKCIGLSLSTAHYITSVMFGTGAKNN RQTKHQFYSKVIQLLEESTQINSVEQLASIILKAGDCDSYRKLRIRCSRKGATPSILKIVQDYEL GTNHDDEVNVPSLIANLKEKLGRFEYECEWKCMEKIKAFLASKVGPYYY
- the Cas protein comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7032 (designated herein as Cas12i2): MSSAIKSYKSVLRPNERKNQLLKSTIQCLEDGSAFFFKMLQGLFGGITPEIVRFSTEQEKQQQD IALWCAVNWFRPVSQDSLTHTIASDNLVEKFEEYYGGTASDAIKQYFSASIGESYYWNDCRQ QYYDLCRELGVEVSDLTHDLEILCREKCLAVATESNQNNSIISVLFGTGEKEDRSVKLRITKKI LEAISNLKEIPKNVAPIQEIILNVAKATKETFRQVYAGNLGAPSTLEKFIAKDGQKEFDLKKLQ TDLKKVIRGKSKERDWCCQEELRSYVEQNTIQYDL
- the Cas protein comprises an amino acid sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of SEQ ID NO: 7033 (designated herein as SpCas9): MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEAT RLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDE VAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQL VQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNF KSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDIL
- Modified guide RNAs [00186]
- the guide RNA is chemically modified.
- a guide RNA comprising one or more modified nucleosides or nucleotides is called a “modified” guide RNA or “chemically modified” guide RNA, to describe the presence of one or more non-naturally and/or naturally occurring components or configurations that are used instead of or in addition to the canonical A, G, C, and U residues.
- a modified guide RNA is synthesized with a non-canonical nucleoside or nucleotide, is here called “modified.”
- Modified nucleosides and nucleotides can include one or more of: (i) alteration, e.g., replacement, of one or both of the non-linking phosphate oxygens and/or of one or more of the linking phosphate oxygens in the phosphodiester backbone linkage (an exemplary backbone modification); (ii) alteration, e.g., replacement, of a constituent of the ribose sugar, e.g., of the 2' hydroxyl on the ribose sugar (an exemplary sugar modification); (iii) wholesale replacement of the phosphate moiety with “dephospho” linkers (an exemplary backbone modification); (iv) modification or replacement of a naturally occurring nucleobase, including with a non-canonical nucleobase (an exemplary base modification); (v) replacement or modification of the rib
- modified guide RNAs comprising nucleosides and nucleotides (collectively “residues”) that can have two, three, four, or more modifications.
- a modified residue can have a modified sugar and a modified nucleobase, or a modified sugar and a modified phosphodiester.
- every base of a guide RNA is modified, e.g., all bases have a modified phosphate group, such as a phosphorothioate group.
- all, or substantially all, of the phosphate groups of an guide RNA molecule are replaced with phosphorothioate groups.
- modified guide RNAs comprise at least one modified residue at or near the 5' end of the RNA. In some embodiments, modified guide RNAs comprise at least one modified residue at or near the 3' end of the RNA. [00188] In some embodiments, the guide RNA comprises one, two, three or more modified residues.
- At least 5% e.g., at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or 100%
- Unmodified nucleic acids can be prone to degradation by, e.g., intracellular nucleases or those found in serum. For example, nucleases can hydrolyze nucleic acid phosphodiester bonds.
- the guide RNAs described herein can contain one or more modified nucleosides or nucleotides, e.g., to introduce stability toward intracellular or serum-based nucleases.
- the modified guide RNA molecules described herein can exhibit a reduced innate immune response when introduced into a population of cells, both in vivo and ex vivo.
- the term “innate immune response” includes a cellular response to exogenous nucleic acids, including single stranded nucleic acids, which involves the induction of cytokine expression and release, particularly the interferons, and cell death.
- the phosphate group of a modified residue can be modified by replacing one or more of the oxygens with a different substituent.
- the modified residue e.g., modified residue present in a modified nucleic acid
- the backbone modification of the phosphate backbone can include alterations that result in either an uncharged linker or a charged linker with unsymmetrical charge distribution.
- modified phosphate groups include, phosphorothioate, phosphoroselenates, borano phosphates, borano phosphate esters, hydrogen phosphonates, phosphoroamidates, alkyl or aryl phosphonates and phosphotriesters.
- the phosphorous atom in an unmodified phosphate group is achiral. However, replacement of one of the non-bridging oxygens with one of the above atoms or groups of atoms can render the phosphorous atom chiral.
- the stereogenic phosphorous atom can possess either the “R” configuration (herein Rp) or the “S” configuration (herein Sp).
- the backbone can also be modified by replacement of a bridging oxygen, (i.e., the oxygen that links the phosphate to the nucleoside), with nitrogen (bridged phosphoroamidates), sulfur (bridged phosphorothioates) and carbon (bridged methylenephosphonates).
- a bridging oxygen i.e., the oxygen that links the phosphate to the nucleoside
- nitrogen bridged phosphoroamidates
- sulfur bridged phosphorothioates
- carbon bridged methylenephosphonates
- moieties which can replace the phosphate group can include, without limitation, e.g., methyl phosphonate, hydroxylamino, siloxane, carbonate, carboxymethyl, carbamate, amide, thioether, ethylene oxide linker, sulfonate, sulfonamide, thioformacetal, formacetal, oxime, methyleneimino, methylenemethylimino, methylenehydrazo, methylenedimethylhydrazo and methyleneoxymethylimino.
- Scaffolds that can mimic nucleic acids can also be constructed wherein the phosphate linker and ribose sugar are replaced by nuclease resistant nucleoside or nucleotide surrogates.
- nucleobases can be tethered by a surrogate backbone.
- examples can include, without limitation, the morpholino, cyclobutyl, pyrrolidine and peptide nucleic acid (PNA) nucleoside surrogates.
- PNA peptide nucleic acid
- the modified nucleosides and modified nucleotides can include one or more modifications to the sugar group, i.e. at sugar modification.
- the 2' hydroxyl group (OH) can be modified, e.g. replaced with a number of different “oxy” or “deoxy” substituents.
- modifications to the 2' hydroxyl group can enhance the stability of the nucleic acid since the hydroxyl can no longer be deprotonated to form a 2'-alkoxide ion.
- Examples of 2' hydroxyl group modifications can include alkoxy or aryloxy (OR, wherein “R” can be, e.g., alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or a sugar); polyethyleneglycols (PEG), O(CH 2 CH 2 O) n CH 2 CH 2 OR wherein R can be, e.g., H or optionally substituted alkyl, and n can be an integer from 0 to 20 (e.g., from 0 to 4, from 0 to 8, from 0 to 10, from 0 to 16, from 1 to 4, from 1 to 8, from 1 to 10, from 1 to 16, from 1 to 20, from 2 to 4, from 2 to 8, from 2 to 10, from 2 to 16, from 2 to 20, from 4 to 8, from 4 to 10,
- the 2' hydroxyl group modification can be 2'-O-Me. In some embodiments, the 2' hydroxyl group modification can be a 2'-fluoro modification, which replaces the 2' hydroxyl group with a fluoride.
- the 2' hydroxyl group modification can include “locked” nucleic acids (LNA) in which the 2' hydroxyl can be connected, e.g., by a C 1 - 6 alkylene or C 1-6 heteroalkylene bridge, to the 4' carbon of the same ribose sugar, where exemplary bridges can include methylene, propylene, ether, or amino bridges; O-amino (wherein amino can be, e.g., NH2; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, or diheteroarylamino, ethylenediamine, or polyamino) and aminoalkoxy, O(CH 2 ) n -amino, (wherein amino can be, e.g., NH 2 ; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, or diheteroary
- the 2' hydroxyl group modification can include "unlocked" nucleic acids (UNA) in which the ribose ring lacks the C2'-C3' bond.
- the 2' hydroxyl group modification can include the methoxyethyl group (MOE), (OCH 2 CH 2 OCH 3 , e.g., a PEG derivative).
- MOE methoxyethyl group
- “Deoxy” 2' modifications can include hydrogen (i.e.
- deoxyribose sugars e.g., at the overhang portions of partially dsRNA
- halo e.g., bromo, chloro, fluoro, or iodo
- amino wherein amino can be, e.g., NH 2 ; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, diheteroarylamino, or amino acid); NH(CH 2 CH 2 NH) n CH2CH 2 - amino (wherein amino can be, e.g., as described herein), -NHC(O)R (wherein R can be, e.g., alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), cyano; mercapto; alkyl-thio-alkyl; thioalkoxy; and alkyl, cycloalkyl, aryl, alkenyl and al
- the sugar modification can comprise a sugar group which may also contain one or more carbons that possess the opposite stereochemical configuration than that of the corresponding carbon in ribose.
- a modified nucleic acid can include nucleotides containing e.g., arabinose, as the sugar.
- the modified nucleic acids can also include abasic sugars. These abasic sugars can also be further modified at one or more of the constituent sugar atoms.
- the modified nucleic acids can also include one or more sugars that are in the L form, e.g. L- nucleosides.
- the modified nucleosides and modified nucleotides described herein, which can be incorporated into a modified nucleic acid, can include a modified base, also called a nucleobase.
- a modified base also called a nucleobase.
- nucleobases include, but are not limited to, adenine (A), guanine (G), cytosine (C), and uracil (U). These nucleobases can be modified or wholly replaced to provide modified residues that can be incorporated into modified nucleic acids.
- the nucleobase of the nucleotide can be independently selected from a purine, a pyrimidine, a purine analog, or pyrimidine analog.
- the nucleobase can include, for example, naturally-occurring and synthetic derivatives of a base.
- each of the crRNA and the tracr RNA can contain modifications. Such modifications may be at one or both ends of the crRNA and/or tracr RNA.
- one or more residues at one or both ends of the sgRNA may be chemically modified, and/or internal nucleosides may be modified, and/or the entire sgRNA may be chemically modified.
- Certain embodiments comprise a 5' end modification.
- Certain embodiments comprise a 3' end modification.
- Modifications of 2’-O-methyl are encompassed.
- Phosphorothioate (PS) linkage or bond refers to a bond where a sulfur is substituted for one nonbridging phosphate oxygen in a phosphodiester linkage, for example in the bonds between nucleotides bases.
- the modified oligonucleotides may also be referred to as S-oligos.
- Abasic nucleotides refer to those which lack nitrogenous bases.
- Inverted bases refer to those with linkages that are inverted from the normal 5’ to 3’ linkage (i.e., either a 5’ to 5’ linkage or a 3’ to 3’ linkage).
- An abasic nucleotide can be attached with an inverted linkage.
- an abasic nucleotide may be attached to the terminal 5’ nucleotide via a 5’ to 5’ linkage, or an abasic nucleotide may be attached to the terminal 3’ nucleotide via a 3’ to 3’ linkage.
- An inverted abasic nucleotide at either the terminal 5’ or 3’ nucleotide may also be called an inverted abasic end cap.
- one or more of the first three, four, or five nucleotides at the 5' terminus, and one or more of the last three, four, or five nucleotides at the 3' terminus are modified.
- the modification is a 2’-O-Me, 2’-F, inverted abasic nucleotide, PS bond, or other nucleotide modification well known in the art to increase stability and/or performance.
- the first four nucleotides at the 5' terminus, and the last four nucleotides at the 3' terminus are linked with phosphorothioate (PS) bonds.
- the first three nucleotides at the 5' terminus, and the last three nucleotides at the 3' terminus comprise a 2'-O-methyl (2'-O-Me) modified nucleotide.
- a composition comprising: a) one or more guide RNAs comprising one or more guide sequences from Table 1A, Table 1B, or Table 5 and b) saCas9 (when combined with a gRNA comprising any one of or combination of SEQ ID Nos: 1-35, 1000- 1078, and 3000-3069) or sluCas9 (when combined with a gRNA comprising any one of or combination of SEQ ID Nos: 100-225, 2000-2116, and 4000-4251), or any of the mutant Cas9 proteins disclosed herein.
- the guide RNA together with a Cas9 is called a ribonucleoprotein complex (RNP).
- the disclosure provides for an RNP complex, wherein the guide RNA (e.g., any of the guide RNAs disclosed herein) binds to or is capable of binding to a target sequence in the dystrophin gene (e.g., a splice acceptor site or a splice donor site for exons 45, 51, or 53, including e.g., the Exon 51 intron-exon junction having the sequence ccagagtaacagtctgagtaggagctaaaatattttgggtttttgcaa (SEQ ID NO: 721), or a target sequence bound by any of the sequences disclosed in Table 1A, Table 1B, and 5), wherein the dystrophin gene comprises a PAM recognition sequence position upstream of the target sequence, and wherein the RNP cuts at a position
- the RNP also cuts at a position that is 2 nucleotides upstream (-2), 4 nucleotides upstream (-4), 5 nucleotides upstream (-5), or 6 nucleotides upstream (-6) of the PAM in the dystrophin gene. In some embodiments, the RNP cuts at a position that is 3 nucleotides upstream (-3) and 4 nucleotides upstream (-4) of the PAM in the dystrophin gene.
- chimeric Cas9 (SaCas9 or SluCas9) nucleases are used, where one domain or region of the protein is replaced by a portion of a different protein.
- a Cas9 nuclease domain may be replaced with a domain from a different nuclease such as Fok1.
- a Cas9 nuclease may be a modified nuclease.
- the Cas9 is modified to contain only one functional nuclease domain.
- the agent protein may be modified such that one of the nuclease domains is mutated or fully or partially deleted to reduce its nucleic acid cleavage activity.
- a conserved amino acid within a Cas9 protein nuclease domain is substituted to reduce or alter nuclease activity.
- a Cas9 nuclease may comprise an amino acid substitution in the RuvC or RuvC-like nuclease domain.
- Exemplary amino acid substitutions in the RuvC or RuvC-like nuclease domain include D10A (based on the S. pyogenes Cas9 protein). See, e.g., Zetsche et al. (2015) Cell Oct 22:163(3): 759-771.
- the Cas9 nuclease may comprise an amino acid substitution in the HNH or HNH-like nuclease domain.
- Exemplary amino acid substitutions in the HNH or HNH-like nuclease domain include E762A, H840A, N863A, H983A, and D986A (based on the S. pyogenes Cas9 protein). See, e.g., Zetsche et al. (2015). Further exemplary amino acid substitutions include D917A, E1006A, and D1255A (based on the Francisella novicida U112 Cpf1 (FnCpf1) sequence (UniProtKB - A0Q7Q2 (CPF1_FRATN)). Further exemplary amino acid substitutions include D10A and N580A (based on the S. aureus Cas9 protein).
- the Cas9 lacks cleavase activity.
- the Cas9 comprises a dCas DNA-binding polypeptide.
- a dCas polypeptide has DNA-binding activity while essentially lacking catalytic (cleavase/nickase) activity.
- the dCas polypeptide is a dCas9 polypeptide.
- the Cas9 lacking cleavase activity or the dCas DNA- binding polypeptide is a version of a Cas nuclease (e.g., a Cas9 nuclease discussed above) in which its endonucleolytic active sites are inactivated, e.g., by one or more alterations (e.g., point mutations) in its catalytic domains. See, e.g., US 2014/0186958 A1; US 2015/0166980 A1.
- the Cas9 comprises one or more heterologous functional domains (e.g., is or comprises a fusion polypeptide).
- the heterologous functional domain may facilitate transport of the Cas9 into the nucleus of a cell.
- the heterologous functional domain may be a nuclear localization signal (NLS).
- the Cas9 may be fused with 1-10 NLS(s).
- the Cas9 may be fused with 1-5 NLS(s).
- the Cas9 may be fused with 1-3 NLS(s).
- the Cas9 may be fused with one NLS. Where one NLS is used, the NLS may be attached at the N-terminus or the C-terminus of the Cas9 sequence, and may be directly fused/attached or fused/attached via a linker.
- the Cas9 may be fused with more than one NLS. In some embodiments, the Cas9 may be fused with 2, 3, 4, or 5 NLSs. In some embodiments, the Cas9 may be fused with two NLSs. In certain circumstances, the two NLSs may be the same (e.g., two SV40 NLSs) or different. In some embodiments, the Cas9 protein is fused with one or more SV40 NLSs. In some embodiments, the SV40 NLS comprises the amino acid sequence of SEQ ID NO: 713 (PKKKRKV).
- the Cas9 protein (e.g., the SaCas9 or SluCas9 protein) is fused to one or more nucleoplasmin NLSs.
- the Cas protein is fused to one or more c-myc NLSs.
- the Cas protein is fused to one or more E1A NLSs.
- the Cas protein is fused to one or more BP (bipartite) NLSs.
- the nucleoplasmin NLS comprises the amino acid sequence of SEQ ID NO: 714 (KRPAATKKAGQAKKKK).
- the Cas9 protein is fused with a c-Myc NLS.
- the c-Myc NLS is encoded by the nucleic acid sequence of SEQ ID NO: 722 (CCGGCAGCTAAGAAAAAGAAACTGGAT).
- the Cas9 is fused to two SV40 NLS sequences linked at the carboxy terminus.
- the Cas9 may be fused with two NLSs, one linked at the N-terminus and one at the C-terminus.
- the Cas9 may be fused with 3 NLSs.
- the Cas9 may be fused with 3 NLSs, two linked at the N-terminus and one linked at the C-terminus.
- the Cas9 may be fused with 3 NLSs, one linked at the N-terminus and two linked at the C-terminus. In some embodiments, the Cas9 may be fused with no NLS. In some embodiments, the Cas9 may be fused with one NLS. In some embodiments, the Cas9 may be fused with an NLS on the C-terminus and does not comprise an NLS fused on the N-terminus. In some embodiments, the Cas9 may be fused with an NLS on the N-terminus and does not comprise an NLS fused on the C-terminus. In some embodiments, the Cas9 protein is fused to an SV40 NLS and to a nucleoplasmin NLS.
- the Cas9 protein is fused to an SV40 NLS and to a c-Myc NLS.
- the SV40 NLS is fused to the C-terminus of the Cas9, while the nucleoplasmin NLS is fused to the N- terminus of the Cas9 protein.
- the SV40 NLS is fused to the C-terminus of the Cas9, while the c-Myc NLS is fused to the N-terminus of the Cas9 protein.
- the SV40 NLS is fused to the N-terminus of the Cas9, while the nucleoplasmin NLS is fused to the C- terminus of the Cas9 protein.
- the SV40 NLS is fused to the N-terminus of the Cas9, while the c-Myc NLS is fused to the C-terminus of the Cas9 protein.
- the SV40 NLS is fused to the Cas9 protein by means of a linker.
- the SV40 NLS and linker is encoded by the nucleic acid sequence of SEQ ID NO: 723 (ATGATGGCCCCAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCC).
- the nucleoplasmin NLS is fused to the Cas9 protein by means of a linker.
- the c-Myc NLS is fused to the Cas9 protein by means of a linker.
- an additional domain may be: a) fused to the N- or C-terminus of the Cas protein (e.g., a Cas9 protein), b) fused to the N-terminus of an NLS fused to the N-terminus of a Cas protein, or c) fused to the C-terminus of an NLS fused to the C-terminus of a Cas protein.
- an NLS is fused to the N- and/or C-terminus of the Cas protein by means of a linker.
- an NLS is fused to the N-terminus of an N-terminally-fused NLS on a Cas protein by means of a linker, and/or an NLS is fused to the C-terminus of a C-terminally fused NLS on a Cas protein by means of a linker.
- the linker is GSVD (SEQ ID NO: 550) or GSGS (SEQ ID NO: 551).
- the Cas protein comprises a c-Myc NLS fused to the N- terminus of the Cas protein (or to an N-terminally-fused NLS on the Cas protein), optionally by means of a linker.
- the Cas protein comprises an SV40 NLS fused to the C- terminus of the Cas protein (or to a C-terminally-fused NLS on the Cas protein), optionally by means of a linker.
- the Cas protein comprises a nucleoplasmin NLS fused to the C- terminus of the Cas protein (or to a C-terminally-fused NLS on the Cas protein), optionally by means of a linker.
- the Cas protein comprises: a) a c-Myc NLS fused to the N- terminus of the Cas protein, optionally by means of a linker, b) an SV40 NLS fused to the C-terminus of the Cas protein, optionally by means of a linker, and c) a nucleoplasmin NLS fused to the C- terminus of the SV40 NLS, optionally by means of a linker.
- the Cas protein comprises: a) a c-Myc NLS fused to the N-terminus of the Cas protein, optionally by means of a linker, b) a nucleoplasmin NLS fused to the C-terminus of the Cas protein, optionally by means of a linker, and c) an SV40 NLS fused to the C-terminus of the nucleoplasmin NLS, optionally by means of a linker.
- the heterologous functional domain may be capable of modifying the intracellular half-life of the Cas9.
- the half-life of the Cas9 may be increased.
- the half-life of the Cas9 may be reduced.
- the heterologous functional domain may be capable of increasing the stability of the Cas9. In some embodiments, the heterologous functional domain may be capable of reducing the stability of the Cas9. In some embodiments, the heterologous functional domain may act as a signal peptide for protein degradation. In some embodiments, the protein degradation may be mediated by proteolytic enzymes, such as, for example, proteasomes, lysosomal proteases, or calpain proteases. In some embodiments, the heterologous functional domain may comprise a PEST sequence. In some embodiments, the Cas9 may be modified by addition of ubiquitin or a polyubiquitin chain. In some embodiments, the ubiquitin may be a ubiquitin-like protein (UBL).
- UBL ubiquitin-like protein
- Non-limiting examples of ubiquitin-like proteins include small ubiquitin-like modifier (SUMO), ubiquitin cross-reactive protein (UCRP, also known as interferon-stimulated gene-15 (ISG15)), ubiquitin-related modifier-1 (URM1), neuronal-precursor-cell-expressed developmentally downregulated protein-8 (NEDD8, also called Rub1 in S. cerevisiae), human leukocyte antigen F-associated (FAT10), autophagy-8 (ATG8) and -12 (ATG12), Fau ubiquitin-like protein (FUB1), membrane-anchored UBL (MUB), ubiquitin fold- modifier-1 (UFM1), and ubiquitin-like protein-5 (UBL5).
- SUMO small ubiquitin-like modifier
- URP ubiquitin cross-reactive protein
- ISG15 interferon-stimulated gene-15
- URM1 ubiquitin-related modifier-1
- NEDD8 neuronal-precursor-cell-ex
- the heterologous functional domain may be a marker domain.
- marker domains include fluorescent proteins, purification tags, epitope tags, and reporter gene sequences.
- the marker domain may be a fluorescent protein.
- Non-limiting examples of suitable fluorescent proteins include green fluorescent proteins (e.g., GFP, GFP-2, tagGFP, turboGFP, sfGFP, EGFP, Emerald, Azami Green, Monomeric Azami Green, CopGFP, AceGFP, ZsGreen1), yellow fluorescent proteins (e.g., YFP, EYFP, Citrine, Venus, YPet, PhiYFP, ZsYellow1), blue fluorescent proteins (e.g., EBFP, EBFP2, Azurite, mKalamal, GFPuv, Sapphire, T-sapphire,), cyan fluorescent proteins (e.g., ECFP, Cerulean, CyPet, AmCyan1, Midoriishi-Cyan), red fluorescent proteins (e.g., mKate, mKate2, mPlum, DsRed monomer, mCherry, mRFP1, DsRed-Express, DsRed2, DsRed-Monomer, Hc
- the marker domain may be a purification tag and/or an epitope tag.
- Non-limiting exemplary tags include glutathione-S-transferase (GST), chitin binding protein (CBP), maltose binding protein (MBP), thioredoxin (TRX), poly(NANP), tandem affinity purification (TAP) tag, myc, AcV5, AU1, AU5, E, ECS, E2, FLAG, HA, nus, Softag 1, Softag 3, Strep, SBP, Glu-Glu, HSV, KT3, S, S1, T7, V5, VSV-G, 6xHis, 8xHis, biotin carboxyl carrier protein (BCCP), poly-His, and calmodulin.
- GST glutathione-S-transferase
- CBP chitin binding protein
- MBP maltose binding protein
- TRX thioredoxin
- poly(NANP) tandem affinity purification
- TAP tandem affinity pur
- Non-limiting exemplary reporter genes include glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT), beta-galactosidase, beta- glucuronidase, luciferase, or fluorescent proteins.
- GST glutathione-S-transferase
- HRP horseradish peroxidase
- CAT chloramphenicol acetyltransferase
- beta-galactosidase beta-glucuronidase
- luciferase or fluorescent proteins.
- the heterologous functional domain may target the Cas9 to a specific organelle, cell type, tissue, or organ.
- the heterologous functional domain may target the Cas9 to muscle.
- the heterologous functional domain may be an effector domain.
- the effector domain may modify or affect the target sequence.
- the effector domain may be chosen from a nucleic acid binding domain or a nuclease domain (e.g., a non-Cas nuclease domain).
- the heterologous functional domain is a nuclease, such as a FokI nuclease. See, e.g., US Pat. No.9,023,649.
- any of the compositions disclosed herein comprising any of the guides and/or endonucleases disclosed herein is sterile and/or substantially pyrogen-free.
- any of the compositions disclosed herein comprise a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier includes any and all solvents (e.g., water), dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, including pharmaceutically acceptable cell culture media.
- compositions comprise a preservative to prevent the growth of microorganisms.
- Determination of efficacy of guide RNAs [00222] In some embodiments, the efficacy of a guide RNA is determined when delivered or expressed together with other components forming an RNP. In some embodiments, the guide RNA is expressed together with a SaCas9 or SluCas9. In some embodiments, the guide RNA is delivered to or expressed in a cell line that already stably expresses an SaCas9 or SluCas9.
- the guide RNA is delivered to a cell as part of an RNP. In some embodiments, the guide RNA is delivered to a cell along with a nucleic acid (e.g., mRNA) encoding SaCas9 or SluCas9.
- a nucleic acid e.g., mRNA
- the efficacy of particular guide RNAs is determined based on in vitro models. In some embodiments, the in vitro model is a cell line. [00224] In some embodiments, the efficacy of particular guide RNAs is determined across multiple in vitro cell models for a guide RNA selection process. In some embodiments, a cell line comparison of data with selected guide RNAs is performed. In some embodiments, cross screening in multiple cell models is performed.
- the efficacy of particular guide RNAs is determined based on in vivo models.
- the in vivo model is a rodent model.
- the rodent model is a mouse which expresses a mutated dystrophin gene, e.g., a mdx mouse.
- the in vivo model is a non-human primate, for example cynomolgus monkey.
- any of the compositions described herein may be administered to a subject in need thereof for use in making a double or single strand break in any one or more of exons 43, 44, 45, 50, 51, or 53 of the dystrophin (DMD) gene.
- pairs of guide RNAs described herein, in any of the vector configurations described herein may be administered to a subject in need thereof to excise a portion of a DMD, thereby treating DMD.
- any of the compositions described herein may be administered to a subject in need thereof for use in treating DMD.
- a nucleic acid molecule comprising a first nucleic acid encoding one or more guide RNAs of Table 1A, Table 1B, or Table 5 and a second nucleic acid encoding either SaCas9 or SluCas9 (depending on the guide) is administered to a subject to treat DMD.
- a single nucleic acid molecule (which may be a vector, including an AAV vector) comprising a first nucleic acid encoding one or more guide RNAs of Table 1A, Table 1B, or Table 5 and a second nucleic acid encoding either SaCas9 or SluCas9 (depending on the guide) is administered to a subject to treat DMD.
- any of the compositions described herein is administered to a subject in need thereof to treat Duchenne Muscular Dystrophy (DMD).
- any of the compositions described herein is administered to a subject in need thereof to induce a double strand break in any one or more of exons 43, 44, 45, 50, 51, or 53 of the dystrophin gene.
- a method of treating Duchenne Muscular Dystrophy (DMD) is provided, the method comprising delivering to a cell any one of the compositions described herein, wherein the cell comprises a mutation in the dystrophin gene that is known to be associated with DMD.
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: 1) a nucleic acid molecule comprising: a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, 3000-3069; and 2) a Staphylococcus aureus Cas9 (SaCas9) or a nucleic acid encoding (SaCas9).
- SaCas9 Staphylococcus aureus Cas9
- SaCas9 nucleic acid encoding
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: 1) a nucleic acid molecule comprising: a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 1-35, 1000-1078, and 3000- 3069; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 1-35, 1000-1078, and 3000- 3069; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, 3000-3069; and 2) a Staphylococcus aureus Cas9 (SaCas9) or a nucleic acid encoding (SaCas9); wherein the cell comprises a mutation in the dystrophin gene that is known to
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, and 3000-3069; and 2) a nucleic acid encoding SaCas9.
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 1012, 1013, 1016, 1017, and 1018; a nucleic acid encoding one or more spacer sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 1012, 1013, 1016, 1017, and 1018; or a nucleic acid encoding one or more spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 1012
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 1012, 1013, 1016, 1017, and 1018; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of one or more spacer sequences selected from SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 1012, 1013, 1016, 1017, and 1018; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 10, 12, 15, 16, 20, 27, 28, 32, 33, 35, 1001, 1003, 1005, 1010, 10
- the spacer sequence is SEQ ID NO: 10. In some embodiments, the spacer sequence is SEQ ID NO: 12. In some embodiments, the spacer sequence is SEQ ID NO: 15. In some embodiments, the spacer sequence is SEQ ID NO: 16. In some embodiments, the spacer sequence is SEQ ID NO: 20. In some embodiments, the spacer sequence is SEQ ID NO: 27. In some embodiments, the spacer sequence is SEQ ID NO: 28. In some embodiments, the spacer sequence is SEQ ID NO: 32. In some embodiments, the spacer sequence is SEQ ID NO: 33. In some embodiments, the spacer sequence is SEQ ID NO: 35. In some embodiments, the spacer sequence is SEQ ID NO: 1001.
- the spacer sequence is SEQ ID NO: 1003. In some embodiments, the spacer sequence is SEQ ID NO: 1005. In some embodiments, the spacer sequence is SEQ ID NO: 1010. In some embodiments, the spacer sequence is SEQ ID NO: 1012. In some embodiments, the spacer sequence is SEQ ID NO: 1013. In some embodiments, the spacer sequence is SEQ ID NO: 1016. In some embodiments, the spacer sequence is SEQ ID NO: 1017. In some embodiments, the spacer sequence is SEQ ID NO: 1018.
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 3022, 3023, 3028, 3029, 3030, 3031, 3038, 3039, 3052, 3053, 3054, 3055, 3062, 3063, 3064, 3065, 3068, and 3069; a nucleic acid encoding one or more spacer sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 3022, 3023, 3028, 3029, 3030, 3031, 3038, 3039, 3052, 3053, 3054, 3055, 3062, 3063, 3064, 3065, 3068, and 3069; or a nucleic acid encoding one or more spacer sequence that is at least 90%
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 3022, 3023, 3028, 3029, 3030, 3031, 3038, 3039, 3052, 3053, 3054, 3055, 3062, 3063, 3064, 3065, 3068, and 3069; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of one or more spacer sequences selected from SEQ ID NOs: 3022, 3023, 3028, 3029, 3030, 3031, 3038, 3039, 3052, 3053, 3054, 3055, 3062, 3063, 3064, 3065, 3068, and 3069; or a nucleic acid encoding one or more spacer sequences that is at least 90%
- the spacer sequence is SEQ ID NO: 3022. In some embodiments, the spacer sequence is SEQ ID NO: 3023. In some embodiments, the spacer sequence is SEQ ID NO: 3028. In some embodiments, the spacer sequence is SEQ ID NO: 3029. In some embodiments, the spacer sequence is SEQ ID NO: 3030. In some embodiments, the spacer sequence is SEQ ID NO: 3031. In some embodiments, the spacer sequence is SEQ ID NO: 3038. In some embodiments, the spacer sequence is SEQ ID NO: 3039. In some embodiments, the spacer sequence is SEQ ID NO: 3052. In some embodiments, the spacer sequence is SEQ ID NO: 3053.
- the spacer sequence is SEQ ID NO: 3054. In some embodiments, the spacer sequence is SEQ ID NO: 3055. In some embodiments, the spacer sequence is SEQ ID NO: 3062. In some embodiments, the spacer sequence is SEQ ID NO: 3063. In some embodiments, the spacer sequence is SEQ ID NO: 3064. In some embodiments, the spacer sequence is SEQ ID NO: 3065. In some embodiments, the spacer sequence is SEQ ID NO: 3068. In some embodiments, the spacer sequence is SEQ ID NO: 3069.
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: 1) a nucleic acid molecule comprising: a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 100- 225, 2000-2116, and 4000-4251; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 100- 225, 2000-2116, and 4000-4251; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; and 2) a Staphylococcus lugdunensis (SluCas9) or a nucleic acid molecule encoding SluCas9.
- DMD Duchenne Muscular Dystrophy
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: 1) a nucleic acid molecule comprising: a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 100- 225, 2000-2116, and 4000-4251; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 100- 225, 2000-2116, and 4000-4251; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; and 2) a Staphylococcus lugdunensis (SluCas9) or a nucleic acid molecule encoding SluCas9; wherein the cell comprises
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 100-225, 2000- 2116, and 4000-4251; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 100-225, 2000- 2116, and 4000-4251; or a nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, and 4000-4251; and 2) a nucleic acid encoding Staphylococcus lugdunensis (SluCas9).
- SluCas9 Staphylococcus lugdunensis
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: 1) a nucleic acid molecule comprising: a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 131, 134, 135, 136, 139, 140, 141, 144, 145, 146, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225; a nucleic acid encoding a spacer sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of one or more spacer sequences selected from SEQ ID NOs: 131, 134, 135, 136, 139, 140, 141, 144, 145, 146, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225; or a nucleic acid encoding one or
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 131, 134, 135, 136 ,139, 140, 141, 144, 145, 146, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of one or more spacer sequences selected from SEQ ID NOs: 131, 134, 135, 136 ,139, 140, 141, 144, 145, 146, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225; or a nucleic acid encoding one or more space
- the spacer sequence is SEQ ID NO: 131. In some embodiments, the spacer sequence is SEQ ID NO: 134. In some embodiments, the spacer sequence is SEQ ID NO: 135. In some embodiments, the spacer sequence is SEQ ID NO: 136. In some embodiments, the spacer sequence is SEQ ID NO: 139. In some embodiments, the spacer sequence is SEQ ID NO: 140. In some embodiments, the spacer sequence is SEQ ID NO: 141. In some embodiments, the spacer sequence is SEQ ID NO: 144. In some embodiments, the spacer sequence is SEQ ID NO: 145. In some embodiments, the spacer sequence is SEQ ID NO: 146.
- the spacer sequence is SEQ ID NO: 148. In some embodiments, the spacer sequence is SEQ ID NO: 149. In some embodiments, the spacer sequence is SEQ ID NO: 150. In some embodiments, the spacer sequence is SEQ ID NO: 151. In some embodiments, the spacer sequence is SEQ ID NO: 179. In some embodiments, the spacer sequence is SEQ ID NO: 184. In some embodiments, the spacer sequence is SEQ ID NO: 201. In some embodiments, the spacer sequence is SEQ ID NO: 223. In some embodiments, the spacer sequence is SEQ ID NO: 224. In some embodiments, the spacer sequence is SEQ ID NO: 225.
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: 1) a nucleic acid molecule comprising: a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 4062, 4063, 4068, 4069, 4070, 4071, 4072, 4073, 4078, 4079, 4088, 4089, 4096, 4097, 4098, 4099, 4100, 4101, 4102, 4103, 4158, 4159, 4168, 4169, 4202, 4203, 4220, 4221, 4246, 4247, 4248, 4249, 4250, 4251; a nucleic acid encoding a spacer sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of one or more spacer sequences selected from SEQ ID NOs: 4062, 4063, 4068, 4069, 4070, 4071, 4072, 4073, 4078, 40
- a method of treating Duchenne Muscular Dystrophy comprising delivering to a cell: a single nucleic acid molecule comprising: 1) a nucleic acid encoding one or more spacer sequences selected from SEQ ID NOs: 4062, 4063, 4068, 4069, 4070, 4071, 4072, 4073, 4078, 4079, 4088, 4089, 4096, 4097, 4098, 4099, 4100, 4101, 4102, 4103, 4158, 4159, 4168, 4169, 4202, 4203, 4220, 4221, 4246, 4247, 4248, 4249, 4250, 4251; a nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of one or more spacer sequences selected from SEQ ID NOs: 4062, 4063, 4068, 4069, 4070, 4071, 4072, 4073, 4078, 4079,
- the spacer sequence is SEQ ID NO: 4062. In some embodiments, the spacer sequence is SEQ ID NO: 4063. In some embodiments, the spacer sequence is SEQ ID NO: 4068. In some embodiments, the spacer sequence is SEQ ID NO: 4069. In some embodiments, the spacer sequence is SEQ ID NO: 4070. In some embodiments, the spacer sequence is SEQ ID NO: 4071. In some embodiments, the spacer sequence is SEQ ID NO: 4072. In some embodiments, the spacer sequence is SEQ ID NO: 4073. In some embodiments, the spacer sequence is SEQ ID NO: 4078. In some embodiments, the spacer sequence is SEQ ID NO: 4079.
- the spacer sequence is SEQ ID NO: 4088. In some embodiments, the spacer sequence is SEQ ID NO: 4089. In some embodiments, the spacer sequence is SEQ ID NO: 4096. In some embodiments, the spacer sequence is SEQ ID NO: 4097. In some embodiments, the spacer sequence is SEQ ID NO: 4098. In some embodiments, the spacer sequence is SEQ ID NO: 4099. In some embodiments, the spacer sequence is SEQ ID NO: 4100. In some embodiments, the spacer sequence is SEQ ID NO: 4101. In some embodiments, the spacer sequence is SEQ ID NO: 4102. In some embodiments, the spacer sequence is SEQ ID NO: 4103.
- the spacer sequence is SEQ ID NO: 4158. In some embodiments, the spacer sequence is SEQ ID NO: 4159. In some embodiments, the spacer sequence is SEQ ID NO: 4168. In some embodiments, the spacer sequence is SEQ ID NO: 4169. In some embodiments, the spacer sequence is SEQ ID NO: 4202. In some embodiments, the spacer sequence is SEQ ID NO: 4203. In some embodiments, the spacer sequence is SEQ ID NO: 4220. In some embodiments, the spacer sequence is SEQ ID NO: 4221. In some embodiments, the spacer sequence is SEQ ID NO: 4246. In some embodiments, the spacer sequence is SEQ ID NO: 4247.
- the spacer sequence is SEQ ID NO: 4248. In some embodiments, the spacer sequence is SEQ ID NO: 4249. In some embodiments, the spacer sequence is SEQ ID NO: 4250. In some embodiments, the spacer sequence is SEQ ID NO: 4251. [00240] In some embodiments, the methods comprise delivering to a cell a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 711. In some embodiments, the methods comprise delivering to a cell a nucleic acid molecule encoding SaCas9, wherein the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 711.
- the methods comprise delivering to a cell a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 715-717. In some embodiments, the methods comprise delivering to a cell a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises the amino acid of SEQ ID NO: 715. [00241] In some embodiments, the methods comprise delivering to a cell a nucleic acid molecule encoding SluCas9, wherein the SluCas9 comprises the amino acid sequence of SEQ ID NO: 712.
- the methods comprise delivering to a cell a nucleic acid molecule encoding SluCas9, wherein the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 712. In some embodiments, the methods comprise delivering to a cell a nucleic acid molecule encoding SluCas9, wherein the SluCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 718-720.
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; and 1018 and 16; and a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9).
- SaCas9 Staphylococcus aureus Cas9
- the first and second spacer sequence are selected from SEQ ID NOs: 10 and 15. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 10 and 16. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 12 and 16. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1001 and 1005. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1001 and 15. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1001 and 16. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1003 and 1005.
- the first and second spacer sequence are selected from SEQ ID NOs: 16 and 1003. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 12 and 1010. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 12 and 1012. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 12 and 1013. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 10 and 1016. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1017 and 16. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1018 and 16.
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; and 1018 and 16; and a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9).
- SaCas9 Staphylococcus aureus Cas9
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence that are selected from spacer sequences that are at least 90% identical to any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; and 1018 and 16; and a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9).
- SaCas9 Staphylococcus aureus Cas9
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence selected from any one of SEQ ID NOs: 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; and 1018 and 16; and a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9), wherein the nucleic acid encoding the SaCas9 comprises the amino acid sequence of SEQ ID NO: 715.
- aCas9 Staphylococcus aureus Cas9
- the first and second spacer sequence are selected from SEQ ID NOs: 1001 and 1005. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1001 and 15. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1001 and 16. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1003 and 1005. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 16 and 1003. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 12 and 1010. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 12 and 1012.
- the first and second spacer sequence are selected from SEQ ID NOs: 12 and 1013. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 10 and 1016. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1017 and 16. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 1018 and 16.
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; and 1018 and 16; and a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9), wherein the nucleic acid encoding the SaCas9 comprises the amino acid sequence of SEQ ID NO: 715.
- aCas9 Staphylococcus aureus Cas9
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; and 1018 and 16; and a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9), wherein the nucleic acid encoding the SaCas9 comprises the amino acid sequence of SEQ ID NO: 715.
- SaCas9 Staphylococcus aureus Cas9
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; and 146 and 148; and a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9).
- SluCas9 Staphylococcus lugdunensis
- the first and second spacer sequence are selected from SEQ ID NOs: 148 and 134. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 149 and 135. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 150 and 135. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 131 and 136. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 151 and 136. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 139 and 131. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 139 and 151.
- the first and second spacer sequence are selected from SEQ ID NOs: 140 and 131. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 140 and 151. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 141 and 148. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 144 and 149. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 144 and 150. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 145 and 131. In some embodiments, the first and second spacer sequence are selected from SEQ ID NOs: 145 and 151.
- the first and second spacer sequence are selected from SEQ ID NOs: 146 and 148.
- methods are provided for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; and 146 and 148; and a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9).
- SluCas9 Staphyloc
- methods for treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: a nucleic acid encoding a pair of guide RNAs comprising: a first and second spacer sequence that are selected from spacer sequences that are at least 90% identical to any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; and 146 and 148; and a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9).
- SluCas9 Staphylococcus lugdunensis
- methods for excising a portion of an exon with a premature stop codon in a subject with Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: (i) a nucleic acid encoding a pair of guide RNAs wherein the first guide RNA binds to a target sequence within the exon that is upstream of the premature stop codon, and wherein the second guide RNA binds to a sequence that is downstream of the premature stop codon and downstream of the sequence bound by the first guide RNA; and (ii) a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); wherein the pair of guide RNAs and SaCas9 excise a portion of the exon.
- DMD Duchenne Muscular Dystrophy
- the single nucleic acid molecule is delivered to the cell on a single vector.
- the portions of the exon remaining after excision are rejoined with a one nucleotide insertion.
- the portions of the exon remaining after excision are rejoined without a nucleotide insertion.
- Precise segmental deletion means that the dual cut process takes out a specific deletion. This precise deletion can lead to exon reframing (see e.g., Figure 6).
- the size of excised portion is between 5 and 250, 5 and 225, 5 and 200, 5 and 190, 5 and 180, 5 and 170, 5 and 160, 5 and 150, 5 and 125, 5 and 120, 5 and 115, 5 and 110, 5 and 100, 5 and 95, 5 and 90, 5 and 85, 5 and 80, 5 and 75, 5 and 70, 5 and 65, 5 and 60, 5 and 55, 5 and 50, 5 and 45, 5 and 40, 5 and 35, 5 and 30, 5 and 25, 5 and 20, 5 and 15, and 5-10 nucleotides.
- the size of excised portion is between 20 and 250, 20 and 225, 20 and 200, 20 and 190, 20 and 180, 20 and 170, 20 and 160, 20 and 150, 20 and 125, 20 and 120, 20 and 115, 20 and 110, 20 and 100, 20 and 95, 20 and 90, 20 and 85, 20 and 80, 20 and 75, 20 and 70, 20 and 65, 20 and 60, 20 and 55, 20 and 50, 20 and 45, 20 and 40, 20 and 35, 20 and 30, and 20 and 25 nucleotides.
- the size of excised portion is between 50 and 250, 50 and 225, 50 and 200, 50 and 190, 50 and 180, 50 and 170, 50 and 160, 50 and 150, 50 and 125, 50 and 120, 50 and 115, 50 and 110, and 50 and 100 nucleotides. In some embodiments, the size of excised portion of the exon is between 8 and 167 nucleotides. In some embodiments, the exon is exon 45 of the dystrophin gene. In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 10 and 15 (or SEQ ID Nos: 15 and 10).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 10 and 16 (or SEQ ID Nos: 16 and 10). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 12 and 16 (or SEQ ID Nos: 16 and 12). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 1001 and 1005 (or SEQ ID Nos: 1005 and 1001). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 1001 and 15 (or SEQ ID Nos: 15 and 1001).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 1001 and 16 (or SEQ ID Nos: 16 and 1001). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 1003 and 1005 (or SEQ ID Nos: 1005 and 1003). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 16 and 1003 (or SEQ ID Nos: 1003 and 16). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 12 and 1010 (or SEQ ID Nos: 1010 and 12).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 12 and 1012 (or SEQ ID Nos: 1012 and 12). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 12 and 1013 (or SEQ ID Nos: 1013 and 12). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 10 and 1016 (or SEQ ID Nos: 1016 and 10). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 1017 and 16 (or SEQ ID Nos: 16 and 1017).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 1018 and 16 (or SEQ ID Nos: 16 and 1018).
- the SaCas9 comprises the amino acid sequence of SEQ ID NO: 715.
- methods for excising a portion of an exon with a premature stop codon in a subject with Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: (i) a nucleic acid encoding a pair of guide RNAs wherein the first guide RNA binds to a target sequence within the exon that is upstream of the premature stop codon, and wherein the second guide RNA binds to a sequence that is downstream of the premature stop codon and downstream of the sequence bound by the first guide RNA; and (ii) a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); wherein the pair of guide RNAs and SluCas9 excise a portion of the exon.
- DMD Duchenne Muscular Dystrophy
- the single nucleic acid molecule is delivered to the cell on a single vector.
- the portions of the exon remaining after excision are rejoined with a one nucleotide insertion.
- the portions of the exon remaining after excision are rejoined without a nucleotide insertion.
- the size of excised portion of the exon is between 8 and 167 nucleotides.
- the exon is exon 45 of the dystrophin gene.
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 148 and 134 (or SEQ ID Nos: 134 and 148).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 149 and 135 (or SEQ ID Nos: 135 and 149). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 150 and 135 (or SEQ ID Nos: 135 and 150). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 131 and 136 (or SEQ ID Nos: 136 and 131). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 151 and 136 (or SEQ ID Nos: 136 and 151).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 139 and 131 (or SEQ ID Nos: 131 and 139). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 139 and 151 (or SEQ ID Nos: 151 and 139). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 140 and 131 (or SEQ ID Nos: 131 and 140). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 140 and 151 (or SEQ ID Nos: 151 and 140).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 141 and 148 (or SEQ ID Nos: 148 and 141). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 144 and 149 (or SEQ ID Nos: 149 and 144). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 144 and 150 (or SEQ ID Nos: 150 and 144). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 145 and 131 (or SEQ ID Nos: 131 and 145).
- the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 145 and 151 (or SEQ ID Nos: 151 and 145). In some embodiments, the pair of guide RNAs comprise a first and second spacer sequence of SEQ ID NOs: 146 and 148 (or SEQ ID Nos: 148 and 146). [00253] In some embodiments, the subject is a mammal. In some embodiments, the subject is human. [00254] For treatment of a subject (e.g., a human), any of the compositions disclosed herein may be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- compositions may be readily administered in a variety of dosage forms, such as injectable solutions.
- parenteral administration in an aqueous solution for example, the solution will generally be suitably buffered and the liquid diluent first rendered isotonic with, for example, sufficient saline or glucose.
- aqueous solutions may be used, for example, for intravenous, intramuscular, subcutaneous, and/or intraperitoneal administration.
- Combination Therapy [00255]
- the invention comprises combination therapies comprising any of the methods or uses described herein together with an additional therapy suitable for ameliorating DMD. Delivery of Guide RNA Compositions [00256]
- the methods and uses disclosed herein may use any suitable approach for delivering the guide RNAs and compositions described herein.
- Exemplary delivery approaches include vectors, such as viral vectors; lipid nanoparticles; transfection; and electroporation.
- vectors or LNPs associated with the single-vector guide RNAs/Cas9’s disclosed herein are for use in preparing a medicament for treating DMD.
- a vector may be a viral vector, such as a non-integrating viral vector.
- viral vector is an adeno-associated virus vector, a lentiviral vector, an integrase- deficient lentiviral vector, an adenoviral vector, a vaccinia viral vector, an alphaviral vector, or a herpes simplex viral vector.
- the viral vector is an adeno-associated virus (AAV) vector.
- AAV vector is an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh10 (see, e.g., SEQ ID NO: 81 of US 9,790,472, which is incorporated by reference herein in its entirety), AAVrh74 (see, e.g., SEQ ID NO: 1 of US 2015/0111955, which is incorporated by reference herein in its entirety), or AAV9 vector, wherein the number following AAV indicates the AAV serotype.
- the AAV vector is a single-stranded AAV (ssAAV).
- the AAV vector is a double-stranded AAV (dsAAV). Any variant of an AAV vector or serotype thereof, such as a self-complementary AAV (scAAV) vector, is encompassed within the general terms AAV vector, AAV1 vector, etc. See, e.g., McCarty et al., Gene Ther. 2001;8:1248–54, Naso et al., BioDrugs 2017; 31:317-334, and references cited therein for detailed discussion of various AAV vectors.
- the AAV vector size is measured in length of nucleotides from ITR to ITR, inclusive of both ITRs.
- the AAV vector is less than 5 kb in size from ITR to ITR, inclusive of both ITRs. In particular embodiments, the AAV vector is less than 4.9 kb from ITR to ITR in size, inclusive of both ITRs. In further embodiments, the AAV vector is less than 4.85 kb in size from ITR to ITR, inclusive of both ITRs. In further embodiments, the AAV vector is less than 4.8 kb in size from ITR to ITR, inclusive of both ITRs. In further embodiments, the AAV vector is less than 4.75 kb in size from ITR to ITR, inclusive of both ITRs.
- the AAV vector is less than 4.7 kb in size from ITR to ITR, inclusive of both ITRs.
- the vector is between 3.9-5 kb, 4-5 kb, 4.2-5 kb, 4.4-5 kb, 4.6-5 kb, 4.7-5 kb, 3.9-4.9 kb, 4.2-4.9 kb, 4.4-4.9 kb, 4.7-4.9 kb, 3.9-4.85 kb, 4.2-4.85 kb, 4.4-4.85 kb, 4.6-4.85 kb, 4.7-4.85 kb, 4.7-4.9 kb, 3.9-4.8 kb, 4.2-4.8 kb, 4.4-4.8 kb or 4.6-4.8 kb from ITR to ITR in size, inclusive of both ITRs.
- the vector is between 4.4-4.85 kb in size from ITR to ITR, inclusive of both ITRs.
- the vector is an AAV9 vector.
- the vector e.g., viral vector, such as an adeno-associated viral vector
- the vector comprises a tissue-specific (e.g., muscle-specific) promoter, e.g., which is operatively linked to a sequence encoding the guide RNA.
- the muscle-specific promoter is a muscle creatine kinase promoter, a desmin promoter, an MHCK7 promoter, or an SPc5-12 promoter.
- the muscle-specific promoter is a CK8 promoter.
- the muscle-specific promoter is a CK8e promoter. Muscle-specific promoters are described in detail, e.g., in US2004/0175727 A1; Wang et al., Expert Opin Drug Deliv. (2014) 11, 345–364; Wang et al., Gene Therapy (2008) 15, 1489–1499.
- the tissue-specific promoter is a neuron- specific promoter, such as an enolase promoter. See, e.g., Naso et al., BioDrugs 2017; 31:317-334; Dashkoff et al., Mol Ther Methods Clin Dev.
- the vectors further comprise nucleic acids that do not encode guide RNAs.
- Nucleic acids that do not encode guide RNA and Cas9 include, but are not limited to, promoters, enhancers, and regulatory sequences.
- the vector comprises one or more nucleotide sequence(s) encoding a crRNA, a trRNA, or a crRNA and trRNA.
- Lipid nanoparticles are a known means for delivery of nucleotide and protein cargo, and may be used for delivery of the guide RNAs, compositions, or pharmaceutical formulations disclosed herein.
- the LNPs deliver nucleic acid, protein, or nucleic acid together with protein.
- Electroporation is a well-known means for delivery of cargo, and any electroporation methodology may be used for delivering the single vectors disclosed herein.
- the invention comprises a method for delivering any one of the single vectors disclosed herein to an ex vivo cell, wherein the guide RNA is encoded by a vector, associated with an LNP, or in aqueous solution.
- the guide RNA/LNP or guide RNA is also associated with a Cas9 or sequence encoding Cas9 (e.g., in the same vector, LNP, or solution).
- the disclosure provides for methods of using any of the guides, endonucleases, cells, or compositions disclosed herein in research methods.
- any of the guides or endonucleases disclosed herein may be used alone or in combination in experiments under various parameters (e.g., temperatures, pH, types of cells) or combined with other reagents to evaluate the activity of the guides and/or endonucleases.
- Further embodiments encompassed by the disclosure are as follows.
- Embodiment B 1 is a composition comprising a single nucleic acid molecule encoding one or more guide RNAs and a Cas9, wherein the single nucleic acid molecule comprises: a. a first nucleic acid encoding one or more spacer sequences selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); b.
- a first nucleic acid encoding one or more spacer sequences selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9);
- a first nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9);
- d a Staphylococcus aureus Cas9
- a first nucleic acid encoding one or more spacer sequences comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); e. a first nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069 and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); f.
- a first nucleic acid encoding one or more spacer sequences that is at least 90% identical to any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251 and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); g.
- a first nucleic acid encoding a pair of guide RNAs comprising a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9).
- SaCas9 Staphylococcus aureus Cas9
- a first nucleic acid encoding a pair of guide RNAs comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); i.
- SaCas9 Staphy
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and a second nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); j.
- SaCas9 Staphylococcus aureus Cas9
- a first nucleic acid encoding a pair of guide RNAs comprising a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); k.
- a first nucleic acid encoding a pair of guide RNAs comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunens
- a first nucleic acid encoding a pair of guide RNAs that is at least 90% identical to a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and a second nucleic acid encoding a Staphylococcus lugdunensis (SluCas9).
- Embodiment B 2 is the composition of claim 1, wherein the guide RNA is an sgRNA.
- Embodiment B 3 is the composition of claim 1, wherein the guide RNA is modified.
- Embodiment B 4 is the composition of claim 3, wherein the modification alters one or more 2’ positions and/or phosphodiester linkages.
- Embodiment B 5 is the composition of any one of claims 3-4, wherein the modification alters one or more, or all, of the first three nucleotides of the guide RNA.
- Embodiment B 6 is the composition of any one of claims 3-5, wherein the modification alters one or more, or all, of the last three nucleotides of the guide RNA.
- Embodiment B 7 is the composition of any one of claims 3-6, wherein the modification includes one or more of a phosphorothioate modification, a 2’-OMe modification, a 2’-O-MOE modification, a 2’-F modification, a 2′-O-methine-4′ bridge modification, a 3′- thiophosphonoacetate modification, or a 2’-deoxy modification.
- Embodiment B 8 is the composition of any one of the preceding claims, wherein the composition further comprises a pharmaceutically acceptable excipient.
- Embodiment B 9 is the composition of any one of the preceding claims, wherein the single nucleic acid molecule is associated with a lipid nanoparticle (LNP).
- LNP lipid nanoparticle
- Embodiment B 10 is the composition of any one of claims 1-8, wherein the single nucleic acid molecule is a viral vector.
- Embodiment B 11 is the composition of claim 10, wherein the viral vector is an adeno-associated virus vector, a lentiviral vector, an integrase-deficient lentiviral vector, an adenoviral vector, a vaccinia viral vector, an alphaviral vector, or a herpes simplex viral vector.
- Embodiment B 12 is the composition of claim 10, wherein the viral vector is an adeno-associated virus (AAV) vector.
- AAV adeno-associated virus
- Embodiment B 13 is the composition of claim 12, wherein the AAV vector is an AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAVrh10, AAVrh74, or AAV9 vector, wherein the number following AAV indicates the AAV serotype.
- Embodiment B 14 is the composition of claim 13, wherein the AAV vector is an AAV serotype 9 vector.
- Embodiment B 15 is the composition of claim 13, wherein the AAV vector is an AAVrh10 vector.
- Embodiment B 16 is the composition of claim 13, wherein the AAV vector is an AAVrh74 vector.
- Embodiment B 17 is the composition of any one of claims 10-16, comprising a viral vector, wherein the viral vector comprises a tissue-specific promoter.
- Embodiment B 18 is the composition of any one of claims 10-16, comprising a viral vector, wherein the viral vector comprises a muscle-specific promoter, optionally wherein the muscle-specific promoter is a muscle creatine kinase promoter, a desmin promoter, an MHCK7 promoter, an SPc5-12 promoter, or a CK8e promoter.
- Embodiment B 19 is the composition of any one of claims 10-16, comprising a viral vector, wherein the viral vector comprises a U6, H1, or 7SK promoter.
- Embodiment B 20 is the composition of any one of claims 1-19, comprising a nucleic acid encoding SaCas9, wherein the spacer sequence is selected from any one of SEQ ID NOs: 12, 15, 16, 20, 27, 28, 32, 33, and 35.
- Embodiment B 21 is the composition of any one of claims 1-20, comprising a nucleic acid encoding SaCas9, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 711.
- Embodiment B 22 is the composition of any one of claims 1-20, comprising a nucleic acid encoding SaCas9, wherein the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 711.
- Embodiment B 23 is the composition of any one of claims 1-20, comprising a nucleic acid encoding SaCas9, wherein the SaCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 715-717.
- Embodiment B 24 is the composition of any one of claims 1-19, comprising a nucleic acid encoding SluCas9, wherein the spacer sequence is selected from any one of SEQ ID NOs: 131, 134, 135, 136 ,139, 144, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225.
- Embodiment B 25 is the composition of any one of claims 1-19, or 24, comprising a nucleic acid encoding SluCas9, wherein the SluCas9 comprises the amino acid sequence of SEQ ID NO: 712.
- Embodiment B 26 is the composition of any one of claims 1-19, or 24, comprising a nucleic acid encoding SluCas9, wherein the SluCas9 is a variant of the amino acid sequence of SEQ ID NO: 712.
- Embodiment B 27 is the composition of any one of claims 1-19, or 24, comprising a nucleic acid encoding SluCas9, wherein the SluCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 718-720.
- Embodiment B 28 is the composition of any one of claims 1-27 and a pharmaceutically acceptable excipient.
- Embodiment B 29 is a composition comprising a guide RNA comprising any one of SEQ ID NOs: 1-35, 1000-1078, or 3000-3069.
- Embodiment B 30 is a composition comprising a guide RNA comprising any one of SEQ ID NOs: 100-225, 2000-2116, or 4000-4251.
- Embodiment B 31 is the composition of any one of claims 1-30 for use in treating Duchenne Muscular Dystrophy (DMD).
- Embodiment B 32 is the composition of any one of claims 1-30 for use in making a double strand break in any one or more of exons 43, 44, 45, 50, 51, or 53 of the dystrophin gene.
- Embodiment B 33 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell the composition of any one of claims 1-30.
- Embodiment B 34 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i) a nucleic acid encoding one or more guide RNAs, wherein the one or more guide RNAs comprise: a. a spacer sequence selected from SEQ ID NOs: 1-35, 1000-1078, or 3000-3069; b. a spacer sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 1-35, 1000-1078, or 3000-3069; or c.
- DMD Duchenne Muscular Dystrophy
- Embodiment B 35 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i) a nucleic acid molecule encoding one or more guide RNAs, wherein the one or more guide RNAs comprise: a. a spacer sequence selected from SEQ ID NOs: 100-225, 2000-2116, or 4000- 4251; b.
- DMD Duchenne Muscular Dystrophy
- a spacer sequence comprising at least 17, 18, 19, or 20 contiguous nucleotides of a spacer sequence selected from SEQ ID NOs: 100-225, 2000-2116, or 4000- 4251; or c. a spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 100- 225, 2000-2116, or 4000-4251; and ii) a nucleic acid molecule encoding Staphylococcus lugdunensis (SluCas9).
- Embodiment B 36 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i) a nucleic acid encoding a pair of guide RNAs comprising: m.
- DMD Duchenne Muscular Dystrophy
- a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; n.
- a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; or o.
- a first and second spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018; and ii) a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9).
- SaCas9 Staphylococcus aureus Cas9
- Embodiment B 37 is a method of treating Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i) a nucleic acid encoding a pair of guide RNAs comprising: p. a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; and 146 and 148; q.
- DMD Duchenne Muscular Dystrophy
- a first and second spacer sequence comprising at least 17, 18, 19, 20, or 21 contiguous nucleotides of any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; or r.
- a first and second spacer sequence that is at least 90% identical to any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146; and ii) a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9).
- Embodiment B 38 is the method of any one of claims 34-37, wherein the single nucleic acid molecule is delivered to the cell on a single vector.
- Embodiment B 39 is the method of any one of claims 34-38, comprising a nucleic acid molecule encoding SaCas9, wherein the spacer sequence is selected from any one of SEQ ID NOs: 12, 15, 16, 20, 27, 28, 32, 33, and 35.
- Embodiment B 40 is the method of any one of claims 34-39, comprising a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 711.
- Embodiment B 41 is the method of any one of claims 34-39, comprising a nucleic acid molecule encoding SaCas9, wherein the SaCas9 is a variant of the amino acid sequence of SEQ ID NO: 711.
- Embodiment B 42 is the method of any one of claims 34-39, comprising a nucleic acid molecule encoding SaCas9, wherein the SaCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 715-717.
- Embodiment B 43 is the method of any one of claims 34-38, comprising a nucleic acid molecule encoding SluCas9, wherein the spacer sequence is selected from any one of SEQ ID NOs: 131, 134, 135, 136 ,139, 144, 148, 149, 150, 151, 179, 184, 201, 210, 223, 224, 225.
- Embodiment B 44 is the method of any one of claims 34-38, or 43, comprising a nucleic acid molecule encoding SluCas9, wherein the SluCas9 comprises the amino acid sequence of SEQ ID NO: 712.
- Embodiment B 45 is the method of any one of claims 34-38, or 43, comprising a nucleic acid molecule encoding SluCas9, wherein the SluCas9 is a variant of the amino acid sequence of SEQ ID NO: 712.
- Embodiment B 46 is the method of any one of claims 34-38, or 43, comprising a nucleic acid molecule encoding SluCas9, wherein the SluCas9 comprises an amino acid sequence selected from any one of SEQ ID NOs: 718-720.
- Embodiment B 47 is a method of excising a portion of an exon with a premature stop codon in a subject with Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i) a nucleic acid encoding a pair of guide RNAs wherein the first guide RNA binds to a target sequence within the exon that is upstream of the premature stop codon, and wherein the second guide RNA binds to a sequence that is downstream of the premature stop codon and downstream of the sequence bound by the first guide RNA; and ii) a nucleic acid encoding a Staphylococcus aureus Cas9 (SaCas9); wherein the pair of guide RNAs and SaCas9 excise a portion of the exon.
- DMD Duchenne Muscular Dystrophy
- Embodiment B 48 is a method of excising a portion of an exon with a premature stop codon in a subject with Duchenne Muscular Dystrophy (DMD), the method comprising delivering to a cell a single nucleic acid molecule comprising: i) a nucleic acid encoding a pair of guide RNAs wherein the first guide RNA binds to a target sequence within the exon that is upstream of the premature stop codon, and wherein the second guide RNA binds to a sequence that is downstream of the premature stop codon and downstream of the sequence bound by the first guide RNA; and ii) a nucleic acid encoding a Staphylococcus lugdunensis (SluCas9); wherein the pair of guide RNAs and SaCas9 excise a portion of the exon.
- DMD Duchenne Muscular Dystrophy
- Embodiment B 49 is the method of any one of claims 47-48, wherein the single nucleic acid molecule is delivered to the cell on a single vector.
- Embodiment B 50 is the method of any one of claims 47-49, wherein the portions of the exon remaining after excision are rejoined with a one nucleotide insertion.
- Embodiment B 51 is the method of any one of claims 47-49, wherein the portions of the exon remaining after excision are rejoined without a nucleotide insertion.
- Embodiment B 52 is the method of claim 51, wherein the size of excised portion of the exon is between 8 and 167 nucleotides.
- Embodiment B 53 is the method of any one of claims 47-52, wherein the exon is exon 45.
- Embodiment B 54 is the method of any one of claims 47, and 49-53, wherein the pair of guide RNA comprise a first and second spacer sequence selected from any one of SEQ ID NOs: 10 and 15; 10 and 16; 12 and 16; 1001 and 1005; 1001 and 15; 1001 and 16; 1003 and 1005; 16 and 1003; 12 and 1010; 12 and 1012; 12 and 1013; 10 and 1016; 1017 and 1005; 1017 and 16; 1018 and 16; 15 and 10; 16 and 10; 16 and 12; 1005 and 1001; 15 and 1001; 16 and 1001; 1005 and 1003; 1003 and 16; 1010 and 12; 1012 and 12; 1013 and 12; 1016 and 10; 1005 and 1017; 16 and 1017; and 16 and 1018;.
- Embodiment B 55 is the method of any one of claims 48-53, wherein the pair of guide RNA comprise a first and second spacer sequence selected from any one of SEQ ID NOs: 148 and 134; 149 and 135; 150 and 135; 131 and 136; 151 and 136; 139 and 131; 139 and 151; 140 and 131; 140 and 151; 141 and 148; 144 and 149; 144 and 150; 145 and 131; 145 and 151; 146 and 148; 134 and 148; 135 and 149; 135 and 150; 136 and 131; 136 and 151; 131 and 139; 151 and 139; 131 and 140; 151 and 140; 148 and 141; 149 and 144; 150 and 144; 131 and 145; 151 and 145; and 148 and 146;.
- Embodiment B 56 is the method of any one of claims 34, 36, 38-39, 47, and 49-54, wherein the SaCas9 comprises the amino acid sequence of SEQ ID NO: 715.
- Embodiment B 57 is the composition or method of any one of the preceding claims, wherein the single nucleic acid molecule is an AAV vector, wherein the vector comprises from 5’ to 3’ with respect to the plus strand: the reverse complement of a first sgRNA scaffold sequence, the reverse complement of a nucleic acid encoding a first sgRNA guide sequence, the reverse complement of a promoter for expression of the nucleic acid encoding the first sgRNA, a promoter for expression of a nucleic acid encoding SaCas9 (e.g., CK8e), a nucleic acid encoding a SaCas9, a polyadenylation sequence, a promoter for expression of a second sgRNA in the same direction as the promoter for Sa
- Embodiment B 58 is the composition or method of claim 57, wherein the promoter for expression of the nucleic acid encoding the first sgRNA guide sequence is an hU6 promoter.
- Embodiment B 59 is the composition or method of any one of claims 57-58, wherein the promoter for expression of the nucleic acid encoding the second sgRNA guide sequence is an hU6 promoter.
- Embodiment B 60 is the composition or method of claim 57, wherein the promoter for expression of the nucleic acid encoding the first sgRNA guide sequence is an 7SK promoter.
- Embodiment B 61 is the composition or method of any one of claims 57-58, or 60, wherein the promoter for expression of the nucleic acid encoding the second sgRNA guide sequence is an 7SK promoter.
- Embodiment B 62 is the composition or method of any one of claims 57-58, or 60, wherein the promoter for expression of the nucleic acid encoding the second sgRNA guide sequence is an H1m promoter.
- Embodiment B 63 is the composition or method of any one of the preceding claims wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to a nucleic acid sequence encoding one or more nuclear localization sequences (NLSs).
- NLSs nuclear localization sequences
- Embodiment B 64 is the composition or method of any one of the preceding claims wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to a nucleic acid sequence encoding a nuclear localization sequence (NLS).
- Embodiment B 65 is the composition or method of any one of the preceding claims wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to two nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- Embodiment B 66 is the composition or method of any one of the preceding claims wherein the nucleic acid sequence encoding SaCas9 or SluCas9 is fused to three nucleic acid sequences each encoding a nuclear localization sequence (NLS).
- Embodiment B 67 is the composition or method of any one of claims 64-66, wherein the one or more NLSs is an SV40 NLS.
- Embodiment B 68 is the composition or method of any one of claims 64-66, wherein the one or more NLSs is an c-Myc NLS.
- Example 1 Exemplary DMD sgRNAs
- Guide RNA comprising the guide sequences shown in Table 1A and Table 1B below are prepared according to standard methods in a single guide (sgRNA) format.
- a single AAV vector is prepared that expresses one or more of the guide RNAs and a SaCas9 (for guide sequences having SEQ ID NOs: 1-35, or SEQ ID NOs: 3000-3069) or SluCas9 (for guide sequences having SEQ ID NOs: 100-225, or SEQ ID NOs: 4000-4251). See, Table 1A and Table 1B.
- the AAV vector is administered to cells in vitro and to mice (e.g., mdx mice) in vivo to assess the ability of the AAV to express the guide RNA and Cas9, edit the targeted exon (see Table 1A and Table 1B), and thereby treat DMD.
- mice e.g., mdx mice
- Table 1A Exemplary DMD guide sequences (human-hg38.p12)
- Table 1B Exemplary DMD guide sequences (20-nucleotides and 21-nucleotides) Sequence ID No of
- Example 2 Evaluation of DMD sgRNAs A. Materials and Methods 1.
- sgRNA selection [00267] A subset of sgRNAs targeting the DMD gene were selected for indel frequency and profile evaluation. The selected sgRNAs are shown in Table 2 and were prepared according to standard methods. The criteria used to select these sgRNAs included their potential to induce exon reframing and or skipping, in addition to the existence of a mouse, dog and a non-human primate (NHP) homologue counterpart. This selection included 13 sgRNAs located within exon 45, three sgRNAs located within exon 51 and ten sgRNAs located within exon 53. The number of predicted off target sites was determined for each sgRNA.
- NHS non-human primate
- HEK293FT and Neuro-2a cells were transfected in 12-well plates with 750 ng plasmid + 2.25 ⁇ L of Lipofectamine 2000. Three days after transfection, cells were trypsinized and sorted for green fluorescent protein (GFP). GFP-positive cells were sorted directly into lysis buffer, and DNA extraction was performed using the GeneJet Genomic DNA Purification Kit. PCR was then performed on the DNA using exon-specific primers that targeted the relevant cut site. 3.
- GFP green fluorescent protein
- a set of exemplary DMD sgRNAs were evaluated for indel frequency and editing profde with either SaCas9 or SluCas9 (as indicated in Table 2). Among this selection, 13 sgRNAs were located within exon 45, 3 sgRNAs were located within exon 51 and 10 sgRNAs were located within exon 53. To evaluate indel frequency and profile, plasmid transfection was performed in HEK293FT and Neuro-2a cell lines.
- sgRNAs E51Sa2 and E51SL10 do not have a mouse homolog and see Figure 4B.
- the average indel frequency of sgRNAs targeting exon 53 was determined in HEK293FT cells ( Figure 5A) and in Neuro-2a cells ( Figure 5B), with a high-performing SpCas9 sgRNA (E55Sp63) included as a reference.
- Figure 5A shows an indel frequency higher than 50% for 4 sgRNAs within exon 53 in HEK293FT cells
- Figure 5B shows a comparable result for 2 sgRNAs in Neuro-2a cells.
- E53Sa3 and mE53SL23 show the highest percent of combined indels with potential for reframing / skipping in both cell lines.
- Example 3 Exemplary DMD Guide RNAs for SaCas9 and SluCas9 Variants
- Additional exemplary DMD guide RNAs were designed that may be used with SaCas9 and variants of SaCas9 (e.g., guide sequences having SEQ ID NOs: 1000-1078) and SluCas9 and variants of SluCas9 (e.g., guide sequences having SEQ ID NOs: 2000-2116) in Table 5 below.
- guide RNAs were designed based on SaCas9-KKH (for guide sequences having SEQ ID NOs: 1000-1078) with a PAM sequence NNNRRT (N is any nucleotide, R is purine) and SluCas9- KH (for guide sequences having SEQ ID NOs: 2000-2116) with a PAM sequence NNRG.
- Guide RNAs were designed focusing on genomic coordinate regions within exons 45, 51, and 53. For exon 45, the design region was genomic coordinates chrX: 31968307-31968546. For exon 51, the design region was genomic coordinates chrX: 31773928-31774224.
- RNA comprising the guide sequences shown in Table 5 below are prepared according to standard methods in a single guide (sgRNA) format.
- a single AAV vector is prepared that expresses the guide RNA and a variant SaCas9 (for guide sequences having SEQ ID NOs: 1000- 1078) or the guide RNA and a variant SluCas9 (for guide sequences having SEQ ID NOs: 2000- 2116).
- the AAV vector is administered to cells in vitro and to mice (e.g., mdx mice) in vivo to assess the ability of the AAV to express the guide RNA and Cas9, edit the targeted exon (see Table 5), and thereby treat DMD.
- mice e.g., mdx mice
- the ability of in vivo single AAV-mediated delivery of gene-editing components to successfully remove the mutant genomic sequence by exon skipping in the cardiac and skeletal muscle cells of mdx mice is tested.
- Example 4 Evaluation of sgRNA Pairs A. Materials and Methods 1.
- sgRNA selection [00280] A subset of SaCas9-KKH or SluCas9 sgRNAs found within the DMD gene was selected for indel frequency and profile evaluation. The criteria used to select these sgRNAs included their potential to induce exon reframing and or skipping as a pair, in addition to the existence of a mouse, dog and NHP homologue counterpart. This selection included 27 sgRNAs located within exon 45, 39 sgRNAs located within exon 51 and 29 sgRNAs located within exon 53. The number of predicted off target sites was determined for each sgRNA. 2.
- HEK293FT cells were transfected in 12-well plates with 750 ng plasmid + 2.25 uL of Lipofectamine 2000. Three days after transfection, cells were trypsinized and sorted for GFP. GFP- positive cells were sorted directly into lysis buffer, and DNA extraction was performed using the Promega Maxwell RSC Blood DNA Kit. PCR was then performed on the DNA using exon-specific primers that targeted the relevant cut site. 3. Amplicon deep sequencing library preparation and data analysis [00282] The relevant loci for each exon were amplified by PCR and the products were used to prepare sequencing libraries using MiSeq reagent kit V3 600 cycle.
- Indel analysis was performed using CRISPResso2 ⁇ 10-nt quantification window. Indel profiling consisted of 8 indel categories listed in Table 6. Table 6. Indel group Ranking order Definition Wild-type amplicon t n n
- a combination of promoter orientations, promoter configurations, NLSs and scaffolds were selected for generating AAV plasmids and evaluation on sgRNA transgene expression, AAV manufacturability, and editing efficiency in vitro and in vivo.
- a set of sgRNAs found within the DMD gene was selected for evaluation of indel frequency and profde. Among this selection, 27 sgRNAs were located within exon 45, 39 sgRNAs were located within exon 51 and 29 sgRNAs were located within exon 53.
- plasmid transfection was performed in HEK293FT ( Figure 6B) and Neuro-2a cell lines ( Figure 6D). The average indel frequency of sgRNAs targeting exon 45 was determined in HEK293FT cells ( Figure 6B) and in Neuro-2a cells ( Figure 6D), with a high- performing SpCas9 sgRNA (E45Sp52) included as a reference.
- HsMM Primary human skeletal muscle myoblasts (HsMM; Lonza CC-2580: lot# 20TL070666, P0) were recovered and passaged in SkBM®-2 Skeletal Muscle Myoblast Basal Medium plus SkGM®-2 SingleQuots (CC-3246, CC-3244; Lonza) in the incubator at 37°C with 5% CO2.
- HsMM culture reached approximately 80% to 90% confluence and were actively proliferating, the cells were harvested for SluCas9 ribonucleoprotein (RNP) delivery. After thawing, the cells were passaged once before SluCas9 RNP delivery.
- RNP SluCas9 ribonucleoprotein
- SluCas9 RNPs To form SluCas9 RNPs, the appropriate amount of synthetic sgRNA (Synthego: SO# 7292552) and recombinant SluCas9 protein (Aldevron: Lot# M22536-01) were mixed in supplemented P5 Primary Cell nucleofection solution (Lonza V4XP-5032). In total, three sgRNA:SluCas9 doses were tested, including a low dose with 37.5pmol:6.25pmol, a middle dose 75pmol: 12.5pmol, and a high dose 150:25. The sgRNAs and SluCas9 proteins were incubated for at least 10 minutes at room temperature for Cas9-sgRNA RNP formation.
- HsMMs were rinsed with HEPES buffered saline solution, dissociated from tissue culture flasks by trypsin, and centrifuge at 90xg for 10 minutes. The cell pellets were resuspended in fresh, pre-warmed, complete growth medium. The number of cells were counted. Appropriate number of cells were transfer into a new centrifuge tube, pelleted by centrifugation at 90xg for 10 minutes, and resuspended in supplemented nucleofection solution. About 200,000 cells in 15 ⁇ l nucleofection solution were mixed with about 7 ⁇ l of preformed SluCas9:sgRNA RNP complex.
- the genomic DNAs were amplified using primers flanking the DMD exon 45 genomic region.
- the following primer sequences were used: MiSeq_hE45_F TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGgtctttctgtcttgtatcctttgg (SEQ ID NO: 724) and MiSeq_hE45_R GTCTCGTGGGCTCGGAGATGTGTATAAGAGACAGaatgttagtgcctttcaccc (SEQ ID NO: 725).
- the size of the amplicons was verified by analyze a small amount of the PCR products on 2% E-gels (Thermo Fisher Scientific).
- a portion of the PCR product and the forward primer were then sent for sanger sequencing at Genewiz.
- the sequencing results that pass the quality filter were used to determine editing efficiency and indel profile using the TIDE (Tracking of Indels by DEcomposition) algorithm.
- the following version of the algorithm was used for analysis https://shiny.vrtx.com/app/orrj/tide/ with the appropriate sgRNA sequence, the default analysis parameters, and a mock nucleofected sample as the control. Percentage of other insertions and deletions that have the potential to restore the reading frame of particular DMD patient mutations of interest were referred to as “RF other”.
- sgRNA scaffold sequences were tested in primary human skeletal muscle myoblasts (HsMM) using synthetic sgRNAs as shown in Table 11 below. Two spacer sequences were tested: E45SL23 (SEQ ID NO: 150 (DNA); SEQ ID NO: 930 (RNA)) and E45SL24 (SEQ ID NO: 151 (DNA); SEQ ID NO: 931 (RNA)).
- Slu- VCGT-4.5 SEQ ID NO: 601 (DNA); SEQ ID NO: 918 (RNA)
- Slu-VCGT-4 SEQ ID NO: 917 (DNA); SEQ ID NO: 919 (RNA)
- Slu-VCGT-5 SEQ ID NO: 901 (DNA); SEQ ID NO: 920 (RNA)
- Table 11 Exemplary sgRNAs for testing
- the three scaffold sequences differ by the nucleotide identity, and thus the stem-loop I in RNA secondary structure (FIG. 7A).
- Slu-VCGT-4.5 lacks the last nucleotide U at the 3’ end of Stem 3 (not shown). The results indicate that, Slu-VCGT-5 scaffold produces higher editing efficiency compared to guides with a V4 or V4.5 scaffold in most conditions tested (shown in FIG. 7B).
- N2a Neuro2a cells were transfected in 12-well plates after 24-hour of growth with lOOOng plasmid + 3 pL of Lipofectamine 2000. Three days after transfection, cell were trypsinized and sorted for GFP (green fluroescent protein). GFP-positive cells were sorted via FACS (flurorescence-activated cell sorting) directly into lysis buffer, and DNA extraction was performed using the Promega Maxwell RSC Blood DNA Kit. PCR was then performed on the DNA using exonspecific primers that targeted the relevant cut site.
- GFP green fluroescent protein
- Genomic DNA were extracted after sorting for 100k GFP positive cells and were subjected for amplification by locus specific amplicon.
- the amplified products were purified by AMPure beads (0.8x) followed by QC with 1% E-gel and concentrations were measured using QuBiT for normalization of samples.
- Barcoding PCR was carried out with i5 and i7 indices and they were purified by 0.7x AMPure beads followed by QC with Tapestation or 1% E-gel.
- HsMMs Human primary skeletal muscle myoblasts
- HsMM cells were nucleofected with RNP using the Lonza 4D nucleofector. For each sample, 7 ⁇ L of RNP were combined with 0.3e6 cells in 15 ⁇ L P5 solution. RNP was prepared in a 6:1 gRNA:Cas9 ratio at various concentrations. For dual-cut samples that contain 2 gRNAs, RNP was pre-formed with a single gRNA first.
- RNP was formed by incubating gRNA and protein for 20 min at room temperature. After electroporation, 80 ⁇ L of complete growth media was added to each sample and samples were incubated in a 37°C, 5% CO2, humidified incubator. After 10 minutes, the samples were transferred to 12-well plates containing 2 mL of complete growth media that had been previously equilibrated in a 37°C, 5% CO2, humidified incubator. [00306] Cell harvesting and gDNA extraction [00307] To determine cell viability 48 hours after nucleofection, the cells were stained with Hoechst and Propidium Iodide (Life Technologies). Cell viability was then assessed using ImageXpress Micro (Molecular Devices).
- samples with an overall cell viability above 70% were harvested and analyzed for indel analysis.
- genomic DNA from HsMMs
- the cells were washed with saline buffer, trypsinized and centrifuged.
- the cell pellets were treated with lysis buffer from the Maxwell RSC Blood DNA Kit (Promega #AS1400), and genomic DNAs were extracted using a Maxwell® RSC48 instrument (Promega #AS8500) according to the manufacturer’s instruction.
- the concentrations of genomic DNAs were determined using QubitTM 1x dsDNA HS Assay Kit (Thermo Fisher Scientific Q33231) according to the manufacturer’s instruction.
- the size of the amplicons was verified by analyze a small amount of the PCR products on 2% E-gels (Thermo Fisher Scientific).
- the PCR product was purified by AMPure XP beads (A63881).
- the purified PCR product was amplified again with primers that contain barcodes and Illumina adaptors. Multiple barcoded samples were pooled, combined with PhiX library, and loaded onto the Illumina Mi-Seq platform. MiSeq Reagent Kit v3 (MS-102-3003) was used to produce a 600-cycle run.
- C2C12 are maintained in DMEM supplemented with 10% FBS (Fetal Bovine Serum) and 1% Pen/Strep. For culture purposes, cells should not be allowed to reach >75% confluency.
- C2C12 myoblasts are differentiated in DMEM supplemented with 2% HS and 1% Pen/Strep. Briefly, cells are seeded at 42-45k/cm2 and differentiation is started 24hr after seeding (once cells reach ⁇ 90- 95% confluency). Differentiation medium is changed on day 1 and then refreshed every other day.
- C2C12 myoblasts were allowed to differentiate to myotubes in differentiation medium (DMEM with 2% horse serum and 1% Pen/Strep) for 6 days. Two hours before viral transduction, myotubes were treated with Neuraminidase type III (Sigma-Aldrich, 50 mU/ml), followed by washing with differentiation medium twice. Myotubes were incubated with AAV (MOI 1.0E7) and centrifuged at 1000xg at 4C for 1.5 hours. After spin transduction, the virus is aspirated, and the myotubes are washed with cold PBS once followed by two washes with differentiation medium.
- differentiation medium DMEM with 2% horse serum and 1% Pen/Strep
- the myotubes are cultured in differentiation medium for an additional week (7 days) before being harvested for INDEL analysis (ICE/NGS) or fixed for immunohistochemistry analysis (IHC). DNA/RNA extraction was performed using the Qiagen AllPrep DNA/RNA Minikit.
- Cas9 nuclear localization by immunofluorescence staining of C2C12 myotubes [00315] 7 days post AAV transduction (day 12 of myotube differentiation) C2C12 myotubes were fixed with 4% paraformaldehyde (PFA) for 20 mins at room temperature (RT). After fixation, cells were washed twice with PBS followed by permeabilization with PBS-0.5% Triton for 15 mins at RT.
- PFA paraformaldehyde
- qPCR Quantitative polymerase chain reaction
- gDNA was extracted using the Qiagen AllPrep kit and quantified using the Qubit 4 Fluorometer and diluted to a final concentration of 2.5 ng/ ⁇ L.
- Absolute quantification of AAV9 vectors was performed by constructing a standard curve prepared from known quality of linearized plasmids encoding the region of interest.
- a set of Quality control (QC) were included to validate the methods of quantification.
- NTC non-template control
- qPCR reactions were conducted in triplicate using a QuantStudio 6 Flex Real-Time PCR System (Thermo Fisher). A linear regression analysis was performed using threshold cycle (Ct) values of the standard curve. From this linear regression, the Ct values of the samples were used to quantify the number of copies per ⁇ g of gDNA of AAV9 present in each sample.
- Ct threshold cycle
- Cas9 and sgRNA transgene expression were used to quantify levels of Cas9 mRNA and the expression of gRNA in C2C12 differentiated cells.
- Ct threshold cycle
- Next generation sequencing data analysis A custom bioinformatic workflow was used to process the Illumina sequencing data. First, poor quality reads were removed. Reads that passed the quality filter were trimmed using Trimmomatic to remove adapters and low quality bases. Then reads mapping to the PhiX genome were removed, and paired end reads were merged using PEAR. Based on the expected cut sites corresponding to the two guides, three reference amplicon sequences were created —wildtype amplicon, deletion amplicon with a deletion between the cutsites for the two guides, and inversion amplicon with an inversion of the sequence between the two the cutsites for the two guides.
- the merged reads were assigned to one of three amplicons (wild-type, deletion, inversion) based on the alignment score provided by the Needleman Wunsch algorithm as implemented in ParasailNeedle.
- the CIGAR string provided by the alignment algorithm was parsed to identify the sequence of indel events.
- the summarized table of indel events and their frequencies was overlaid with information on exon length, exon frame, and position of the premature stop codon introduced as a result of the DMD disease causing mutation, to characterize Cas9-associated indel events as productive (e.g., precise deletion, RF +1, RF Other, Exon skipping) or non-productive (e.g., OE) (Table 13).
- productive e.g., precise deletion, RF +1, RF Other, Exon skipping
- non-productive e.g., OE
- This study was designed to evaluate all-in-one gene editing vector candidates that have been created to include both the sgRNA and a Cas9 endonuclease to mediate gene editing at the DMD locus.
- the efficacy of the one-vector gene editing candidates was assessed in vivo by measuring dystrophin restoration, on-target gene editing, tissue vector genomes, and Cas9 and sgRNA transgene expression following an intraperitoneal administration to dEx44 mice at postnatal day 4 or 5.
- Table 14A describes the in-vivo study design:
- gDNA was extracted from mouse heart, quadricep, and triceps tissue using the Maxwell RSC Tissue DNA Kit and quantified via Qubit.
- the relevant locus of exon 45 of the mouse DMD gene was amplified using PCR.
- PCR products were visualized using both E-gel and TapeStation to confirm proper size and were purified using AMPure XP beads.
- PCR products then underwent a second PCR reaction to add unique 5’ and 3’ barcodes corresponding to each sample. These PCR products were quantified via Qubit and normalized to 4 nM each. The normalized products were then pooled, combined with a PhiX library to increase diversity, and loaded onto a MiSeq instrument.
- the library was sequenced using a MiSeq Reagent Kit v3 (600-cycle) and raw data was transferred to the DCS team.
- Next generation sequencing data analysis for in vivo study [00333] A custom bioinformatic workflow was used to process the Illumina sequencing data. First, poor quality reads (below Q30) were removed. The surviving reads were trimmed using using Trimmomatic Trimmomatic to remove adapters and low quality bases. Then reads mapping to the PhiX genome were removed, and paired end reads were merged using PEAR.
- three reference amplicon sequences were created — wildtype amplicon, deletion amplicon with a deletion between the cut sites for the two guides, and inversion amplicon with an inversion of the sequence between the two the cut sites for the two guides.
- the merged reads were assigned to one of three amplicons (wild-type, deletion, inversion) based on the alignment score provided by the Needleman Wunsch algorithm as implemented in ParasailNeedle.
- the CIGAR string provided by the alignment algorithm was parsed to identify the sequence of indel events.
- Table 14B shows the sgRNA ID and the spacer sequence for each sgRNA pairing shown in Figure 9, where the pairings shown on the X-axis in Figure 9 (e.g., 2 + 6) are within the sgRNA ID as the last character of each term (e.g., E51Sa2_E51Sa6).
- a combination of promoter orientations, and configurations, NLS sequences and sgRNA scaffolds were selected for generating AAV plasmids and evaluation on sgRNA transgene expression, AAV manufacturability, and editing efficiency in vitro and in vivo.
- AAV plasmid configurations are listed in Table 15 and Table 16.
- Promoter, NLS and scaffold sequences are listed in Table 17.
- Guide RNA were prepared according to standard methods in a single guide (sgRNA) format.
- a single AAV vector was prepared that expresses the guide RNA pair and a variant SaCas9 or the guide RNA pair and a variant SluCas9.
- the AAV vectors were administered to C2C12 cells in vitro and to mice (e.g., dEx44 mice) in vivo to assess the ability of the AAV to express the guide RNA and Cas9, edit the targeted exon, and reframe the dystrophin gene (in vivo studies only).
- mice e.g., dEx44 mice
- Table 15 Pol III Orientation Configuration NLS1 Endonuclease NLS2 NLS3 Scaffold Promoter
- Table 17 [00340] In particular, the ability of in vitro single AAV-mediated delivery of gene-editing components to introduce productive editing and precise segmental deletion in the C2C12 mouse myotubes was tested (Table 18B, Figure 10).
- vector IDs vVT 046, 047, 048, 054, and 052 are shown in Table 18B with their associated sgRNA pairs.
- vVT009 has a 7SK2- SluCas9-H1m configuration, with a SluV2 scaffold, and a SV40 NLS on the N-terminus and nucleoplasmin NLS on the C-terminus.
- vVT053B has the same configuration and sequences as vVT053.
- the B stands for an A deletion on the backbone of pVT053B (outside of ITRs) that was introduced during cloning.
- the spacer sequences used in these sgRNA pairs are as follows (Table 18A): Table 18A: sgRNA ID Protospacer sequence (a comma separates the two protospacer sequences) E45SL18 E45SL4 TTGTCAGAACAcTGAATGCAAC (SEQ ID NO: 553) [00341] Selected AAV configurations were evaluated for vector genome quantitation ( Figure 11) and transgene expression (Figure 12), and immunofluorescence in C2C12 mouse myotubes ( Figure 13).
- vVT054, vVT046, vVT047 and vVT048 showed an average total dystrophin protein restoration higher than 10% of WT in quadriceps of dEx44 DMD mice (Figure 15B).
- AAV vectors with 2xNLS+ and 3xNLS enhances editing efficiency and dystrophin restoration in skeletal muscles ( Figure 15B).
- Equivalent AAV vector genome was observed in all groups in heart and skeletal muscles. Higher overall AAV vector copy was observed in heart than compared to skeletal muscle ( Figure 16A and 16B).
- the upstream sgRNA was more efficiently expressed than the downstream cassette in vVT046, vVT047, vVT048 AAV vectors ( Figure 17A and 17B).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Neurology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Crystallography & Structural Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
Abstract
Description
Claims
Applications Claiming Priority (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063076250P | 2020-09-09 | 2020-09-09 | |
| US202163152114P | 2021-02-22 | 2021-02-22 | |
| US202163166174P | 2021-03-25 | 2021-03-25 | |
| US202163179850P | 2021-04-26 | 2021-04-26 | |
| PCT/US2021/049468 WO2022056000A1 (en) | 2020-09-09 | 2021-09-08 | Compositions and methods for treatment of duchenne muscular dystrophy |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP4211242A1 true EP4211242A1 (en) | 2023-07-19 |
Family
ID=85685062
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21786687.0A Pending EP4211242A1 (en) | 2020-09-09 | 2021-09-08 | Compositions and methods for treatment of duchenne muscular dystrophy |
Country Status (7)
| Country | Link |
|---|---|
| EP (1) | EP4211242A1 (en) |
| JP (1) | JP2023540783A (en) |
| KR (1) | KR20230084491A (en) |
| AU (1) | AU2021342057A1 (en) |
| CA (1) | CA3193753A1 (en) |
| IL (1) | IL300949A (en) |
| MX (1) | MX2023002755A (en) |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2016344609B2 (en) * | 2015-10-28 | 2022-05-12 | Vertex Pharmaceuticals Incorporated | Materials and methods for treatment of duchenne muscular dystrophy |
| JOP20190166A1 (en) * | 2017-01-05 | 2019-07-02 | Univ Texas | Optimized strategy for exon skipping modifications using crispr/cas9 with triple guide sequences |
| CN111801417B (en) * | 2017-12-14 | 2024-10-29 | 克里斯珀医疗股份公司 | New RNA-programmable endonuclease system and its use in genome editing and other applications |
| JP7550648B2 (en) * | 2018-03-19 | 2024-09-13 | クリスパー セラピューティクス アーゲー | Novel rna-programmable endonuclease system and uses thereof |
-
2021
- 2021-09-08 MX MX2023002755A patent/MX2023002755A/en unknown
- 2021-09-08 EP EP21786687.0A patent/EP4211242A1/en active Pending
- 2021-09-08 AU AU2021342057A patent/AU2021342057A1/en active Pending
- 2021-09-08 JP JP2023515281A patent/JP2023540783A/en active Pending
- 2021-09-08 KR KR1020237011456A patent/KR20230084491A/en active Pending
- 2021-09-08 CA CA3193753A patent/CA3193753A1/en active Pending
- 2021-09-08 IL IL300949A patent/IL300949A/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| JP2023540783A (en) | 2023-09-26 |
| KR20230084491A (en) | 2023-06-13 |
| MX2023002755A (en) | 2023-05-19 |
| AU2021342057A1 (en) | 2023-04-06 |
| IL300949A (en) | 2023-04-01 |
| CA3193753A1 (en) | 2022-03-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2022056000A1 (en) | Compositions and methods for treatment of duchenne muscular dystrophy | |
| US11795460B2 (en) | Compositions and methods for TTR gene editing and treating ATTR amyloidosis | |
| US20230035659A1 (en) | Compositions and Methods for TTR Gene Editing and Treating ATTR Amyloidosis Comprising a Corticosteroid or Use Thereof | |
| US20230414648A1 (en) | Compositions and Methods for Treatment of DM1 with SLUCAS9 and SACAS9 | |
| KR20240055835A (en) | Liver-specific expression cassettes, vectors and their uses for expression of therapeutic proteins | |
| WO2022229851A1 (en) | Compositions and methods for using slucas9 scaffold sequences | |
| US20240252683A1 (en) | Precise Excisions of Portions of Exon 51 for Treatment of Duchenne Muscular Dystrophy | |
| US20240173432A1 (en) | Compositions and Methods for Treatment of Myotonic Dystrophy Type 1 with CRISPR/SluCas9 | |
| AU2021342057A1 (en) | Compositions and methods for treatment of duchenne muscular dystrophy | |
| WO2022234519A1 (en) | Compositions and methods for using sacas9 scaffold sequences | |
| CN116529365A (en) | Compositions and methods for treating duchenne muscular dystrophy | |
| US20240415984A1 (en) | Precise Excisions of Portions of Exons for Treatment of Duchenne Muscular Dystrophy | |
| US20250090686A1 (en) | Precise Excisions of Portions of Exon 44, 50, and 53 for Treatment of Duchenne Muscular Dystrophy | |
| US20240181081A1 (en) | Compositions and Methods for Treatment of Myotonic Dystrophy Type 1 with CRISPR/SACAS9 | |
| WO2025184186A1 (en) | Excision of exon 53 for treatment of duchenne muscular dystrophy | |
| HK40065742A (en) | Compositions and methods for ttr gene editing and treating attr amyloidosis comprising a corticosteroid or use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20230406 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40095944 Country of ref document: HK |
|
| P01 | Opt-out of the competence of the unified patent court (upc) registered |
Effective date: 20240418 |