EP4054324A1 - A murine model of fetal/neonatal alloimmune thrombocytopenia - Google Patents
A murine model of fetal/neonatal alloimmune thrombocytopeniaInfo
- Publication number
- EP4054324A1 EP4054324A1 EP19835940.8A EP19835940A EP4054324A1 EP 4054324 A1 EP4054324 A1 EP 4054324A1 EP 19835940 A EP19835940 A EP 19835940A EP 4054324 A1 EP4054324 A1 EP 4054324A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- gpiiia
- mouse
- hpa
- antibody
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000001605 fetal effect Effects 0.000 title claims description 40
- 208000009567 Neonatal Alloimmune Thrombocytopenia Diseases 0.000 title description 12
- 238000010172 mouse model Methods 0.000 title description 4
- 238000000034 method Methods 0.000 claims abstract description 86
- 230000035772 mutation Effects 0.000 claims abstract description 75
- 238000012360 testing method Methods 0.000 claims abstract description 53
- 102220562539 Angiotensin-converting enzyme_S32P_mutation Human genes 0.000 claims abstract description 48
- 102200128633 rs104893843 Human genes 0.000 claims abstract description 48
- 238000011830 transgenic mouse model Methods 0.000 claims abstract description 46
- 108010020950 Integrin beta3 Proteins 0.000 claims abstract description 35
- 102220131569 rs759461234 Human genes 0.000 claims abstract description 15
- 241000699666 Mus <mouse, genus> Species 0.000 claims description 107
- 241001529936 Murinae Species 0.000 claims description 70
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 claims description 48
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 claims description 44
- 102100032999 Integrin beta-3 Human genes 0.000 claims description 39
- 108091033409 CRISPR Proteins 0.000 claims description 36
- 102220504838 Choline transporter-like protein 4_N29D_mutation Human genes 0.000 claims description 33
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 26
- 239000000427 antigen Substances 0.000 claims description 23
- 108020005004 Guide RNA Proteins 0.000 claims description 22
- 108091007433 antigens Proteins 0.000 claims description 21
- 102000036639 antigens Human genes 0.000 claims description 21
- 230000000740 bleeding effect Effects 0.000 claims description 21
- 241000699670 Mus sp. Species 0.000 claims description 20
- 230000035935 pregnancy Effects 0.000 claims description 20
- 108091034117 Oligonucleotide Proteins 0.000 claims description 19
- 239000002773 nucleotide Substances 0.000 claims description 18
- 125000003729 nucleotide group Chemical group 0.000 claims description 18
- 239000000758 substrate Substances 0.000 claims description 17
- 230000004044 response Effects 0.000 claims description 13
- 230000037432 silent mutation Effects 0.000 claims description 12
- 102000039446 nucleic acids Human genes 0.000 claims description 10
- 108020004707 nucleic acids Proteins 0.000 claims description 10
- 150000007523 nucleic acids Chemical class 0.000 claims description 10
- 210000000287 oocyte Anatomy 0.000 claims description 10
- 238000012216 screening Methods 0.000 claims description 10
- 230000008685 targeting Effects 0.000 claims description 10
- 238000001727 in vivo Methods 0.000 claims description 9
- 108700039855 mouse a Proteins 0.000 claims description 9
- 230000029087 digestion Effects 0.000 claims description 8
- 238000000338 in vitro Methods 0.000 claims description 8
- 101710163270 Nuclease Proteins 0.000 claims description 7
- 238000003556 assay Methods 0.000 claims description 7
- 239000011324 bead Substances 0.000 claims description 7
- 230000002829 reductive effect Effects 0.000 claims description 7
- 230000003252 repetitive effect Effects 0.000 claims description 7
- 239000000523 sample Substances 0.000 claims description 7
- 210000000805 cytoplasm Anatomy 0.000 claims description 6
- 210000002826 placenta Anatomy 0.000 claims description 6
- 102000057154 human ITGB3 Human genes 0.000 claims description 4
- 210000003101 oviduct Anatomy 0.000 claims description 4
- 101100113065 Mus musculus Cfi gene Proteins 0.000 claims description 3
- 210000002257 embryonic structure Anatomy 0.000 claims description 3
- 239000012528 membrane Substances 0.000 claims description 3
- 239000002245 particle Substances 0.000 claims description 3
- 239000011347 resin Substances 0.000 claims description 3
- 229920005989 resin Polymers 0.000 claims description 3
- 102200067132 rs3219484 Human genes 0.000 claims description 2
- 102000008607 Integrin beta3 Human genes 0.000 abstract description 27
- 150000001875 compounds Chemical class 0.000 abstract description 5
- 235000001014 amino acid Nutrition 0.000 description 55
- 150000001413 amino acids Chemical class 0.000 description 37
- 208000017118 fetal and neonatal alloimmune thrombocytopenia Diseases 0.000 description 37
- 101000880344 Homo sapiens Elongation factor G, mitochondrial Proteins 0.000 description 31
- 102100037642 Elongation factor G, mitochondrial Human genes 0.000 description 30
- 208000015228 acquired partial lipodystrophy Diseases 0.000 description 30
- 238000006467 substitution reaction Methods 0.000 description 26
- 210000004027 cell Anatomy 0.000 description 25
- 108090000623 proteins and genes Proteins 0.000 description 25
- 210000004369 blood Anatomy 0.000 description 21
- 239000008280 blood Substances 0.000 description 21
- 208000032843 Hemorrhage Diseases 0.000 description 20
- 208000034158 bleeding Diseases 0.000 description 19
- 230000008774 maternal effect Effects 0.000 description 19
- 241001465754 Metazoa Species 0.000 description 17
- 102100030802 Beta-2-glycoprotein 1 Human genes 0.000 description 15
- 101000793425 Homo sapiens Beta-2-glycoprotein 1 Proteins 0.000 description 15
- 208000003441 Transfusion reaction Diseases 0.000 description 14
- 230000009261 transgenic effect Effects 0.000 description 14
- 239000013612 plasmid Substances 0.000 description 13
- 102000004169 proteins and genes Human genes 0.000 description 13
- 108090000765 processed proteins & peptides Proteins 0.000 description 12
- 235000018102 proteins Nutrition 0.000 description 12
- 239000012634 fragment Substances 0.000 description 11
- YQNRVGJCPCNMKT-LFVJCYFKSA-N 2-[(e)-[[2-(4-benzylpiperazin-1-ium-1-yl)acetyl]hydrazinylidene]methyl]-6-prop-2-enylphenolate Chemical compound [O-]C1=C(CC=C)C=CC=C1\C=N\NC(=O)C[NH+]1CCN(CC=2C=CC=CC=2)CC1 YQNRVGJCPCNMKT-LFVJCYFKSA-N 0.000 description 10
- 101000838335 Homo sapiens Dual specificity protein phosphatase 2 Proteins 0.000 description 10
- 101001080401 Homo sapiens Proteasome assembly chaperone 1 Proteins 0.000 description 10
- 229960005552 PAC-1 Drugs 0.000 description 10
- 102100027583 Proteasome assembly chaperone 1 Human genes 0.000 description 10
- 238000000684 flow cytometry Methods 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 230000000961 alloantigen Effects 0.000 description 9
- 238000003032 molecular docking Methods 0.000 description 9
- 206010043554 thrombocytopenia Diseases 0.000 description 9
- 238000010354 CRISPR gene editing Methods 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 102000003886 Glycoproteins Human genes 0.000 description 7
- 108090000288 Glycoproteins Proteins 0.000 description 7
- 108010029485 Protein Isoforms Proteins 0.000 description 7
- 102000001708 Protein Isoforms Human genes 0.000 description 7
- 102000006495 integrins Human genes 0.000 description 7
- 108010044426 integrins Proteins 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 238000011282 treatment Methods 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- 238000002965 ELISA Methods 0.000 description 6
- 206010050455 Refractoriness to platelet transfusion Diseases 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 230000003582 thrombocytopenic effect Effects 0.000 description 6
- 241000283707 Capra Species 0.000 description 5
- 101001078143 Homo sapiens Integrin alpha-IIb Proteins 0.000 description 5
- 238000012300 Sequence Analysis Methods 0.000 description 5
- 208000037927 alloimmune thrombocytopaenia Diseases 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 238000009395 breeding Methods 0.000 description 5
- 230000001488 breeding effect Effects 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 230000009257 reactivity Effects 0.000 description 5
- 102200159310 rs28936077 Human genes 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- 108700028369 Alleles Proteins 0.000 description 4
- 238000011740 C57BL/6 mouse Methods 0.000 description 4
- 238000011814 C57BL/6N mouse Methods 0.000 description 4
- 206010018985 Haemorrhage intracranial Diseases 0.000 description 4
- 208000008574 Intracranial Hemorrhages Diseases 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 108700019146 Transgenes Proteins 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 4
- 210000003754 fetus Anatomy 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000013011 mating Effects 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 206010060935 Alloimmunisation Diseases 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 101150044523 ITGB3 gene Proteins 0.000 description 3
- 102100025306 Integrin alpha-IIb Human genes 0.000 description 3
- 102000015795 Platelet Membrane Glycoproteins Human genes 0.000 description 3
- 108010010336 Platelet Membrane Glycoproteins Proteins 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- -1 aromatic amino acids Chemical class 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 235000013601 eggs Nutrition 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 210000001161 mammalian embryo Anatomy 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 238000000520 microinjection Methods 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 238000010403 protein-protein docking Methods 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 2
- 239000012114 Alexa Fluor 647 Substances 0.000 description 2
- 108010032595 Antibody Binding Sites Proteins 0.000 description 2
- 102000009024 Epidermal Growth Factor Human genes 0.000 description 2
- 102000008946 Fibrinogen Human genes 0.000 description 2
- 108010049003 Fibrinogen Proteins 0.000 description 2
- 208000009329 Graft vs Host Disease Diseases 0.000 description 2
- 102100040482 HLA class II histocompatibility antigen, DR beta 3 chain Human genes 0.000 description 2
- 108010061311 HLA-DRB3 Chains Proteins 0.000 description 2
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 2
- 108010085220 Multiprotein Complexes Proteins 0.000 description 2
- 102000007474 Multiprotein Complexes Human genes 0.000 description 2
- 101001015002 Mus musculus Integrin beta-3 Proteins 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 208000012346 Venoocclusive disease Diseases 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 238000001994 activation Methods 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000002224 dissection Methods 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 229940012952 fibrinogen Drugs 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 208000024908 graft versus host disease Diseases 0.000 description 2
- 208000031169 hemorrhagic disease Diseases 0.000 description 2
- 230000008348 humoral response Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 238000007917 intracranial administration Methods 0.000 description 2
- 238000011835 investigation Methods 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 238000007726 management method Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 238000000302 molecular modelling Methods 0.000 description 2
- 208000030372 neonatal thrombocytopenia Diseases 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 239000013615 primer Substances 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000007423 screening assay Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 101710132383 66 kDa protein Proteins 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 238000010453 CRISPR/Cas method Methods 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000034656 Contusions Diseases 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102400001368 Epidermal growth factor Human genes 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108010012088 Fibrinogen Receptors Proteins 0.000 description 1
- 206010055690 Foetal death Diseases 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 208000028622 Immune thrombocytopenia Diseases 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102000004195 Isomerases Human genes 0.000 description 1
- 108090000769 Isomerases Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 208000035752 Live birth Diseases 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101100460719 Mus musculus Noto gene Proteins 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- GHAZCVNUKKZTLG-UHFFFAOYSA-N N-ethyl-succinimide Natural products CCN1C(=O)CCC1=O GHAZCVNUKKZTLG-UHFFFAOYSA-N 0.000 description 1
- HDFGOPSGAURCEO-UHFFFAOYSA-N N-ethylmaleimide Chemical compound CCN1C(=O)C=CC1=O HDFGOPSGAURCEO-UHFFFAOYSA-N 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 239000012124 Opti-MEM Substances 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 208000034530 PLAA-associated neurodevelopmental disease Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010035030 Platelet Membrane Glycoprotein IIb Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 206010037549 Purpura Diseases 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 102000014105 Semaphorin Human genes 0.000 description 1
- 108050003978 Semaphorin Proteins 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010041660 Splenomegaly Diseases 0.000 description 1
- 101100226845 Strongylocentrotus purpuratus EGF2 gene Proteins 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 241000009298 Trigla lyra Species 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 101150117115 V gene Proteins 0.000 description 1
- 241000269370 Xenopus <genus> Species 0.000 description 1
- 108010037096 Xenopus Proteins Proteins 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 229940124532 absorption promoter Drugs 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 101150063416 add gene Proteins 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 208000033571 alveolar capillary dysplasia with misalignment of pulmonary veins Diseases 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000002482 anti-endothelial effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000013176 antiplatelet therapy Methods 0.000 description 1
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 1
- 235000013405 beer Nutrition 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 238000012575 bio-layer interferometry Methods 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 230000035606 childbirth Effects 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 238000002967 competitive immunoassay Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000009849 deactivation Effects 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001066 destructive effect Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000012850 discrimination method Methods 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 208000009190 disseminated intravascular coagulation Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 230000005782 double-strand break Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 229960001484 edetic acid Drugs 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000012921 fluorescence analysis Methods 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 102000043652 human GFM1 Human genes 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000012750 in vivo screening Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 150000002484 inorganic compounds Chemical class 0.000 description 1
- 229910010272 inorganic material Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 231100001046 intrauterine death Toxicity 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000000696 magnetic material Substances 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000001123 neurodevelopmental effect Effects 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 238000003305 oral gavage Methods 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 150000002902 organometallic compounds Chemical class 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 208000004594 persistent fetal circulation syndrome Diseases 0.000 description 1
- 206010034754 petechiae Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 102000002022 plexin Human genes 0.000 description 1
- 108050009312 plexin Proteins 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 238000011533 pre-incubation Methods 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 230000000452 restraining effect Effects 0.000 description 1
- 102220005424 rs33991779 Human genes 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 238000000547 structure data Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 201000003067 thrombocytopenia due to platelet alloimmunization Diseases 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000036266 weeks of gestation Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
- A01K67/0278—Knock-in vertebrates, e.g. humanised vertebrates
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/072—Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/0306—Animal model for genetic diseases
- A01K2267/0325—Animal model for autoimmune diseases
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/035—Animal model for multifactorial diseases
- A01K2267/0387—Animal model for diseases of the immune system
Definitions
- PTP Post-transfusion purpura
- RPT refractoriness to platelet transfusion
- FNAIT fetal/neonatal alloimmune thrombocytopenia
- RPT is seen in patients who are multiply transfused with platelets and remains a clinical challenge, resulting in bleeding complications and lengthened hospitalization.
- RPT can be separated into immune and non ⁇ immune causes.
- Immune causes include alloimmunization to HLA and/or platelet ⁇ specific antigens due to prior exposure from pregnancy, transfusions and/or transplantation.
- Non ⁇ immune causes based on studies in patients with acute myeloid leukaemia (AML) or haematopoietic progenitor cell transplants, include fever, sepsis, splenomegaly, disseminated intravascular coagulation (DIC), bleeding, venoocclusive disease (VOD), graft ⁇ versus ⁇ host disease (GVHD) and medications 54 .
- AML acute myeloid leukaemia
- VOD venoocclusive disease
- GVHD graft ⁇ versus ⁇ host disease
- FNAIT is a fairly common disorder, leading to severe fetal and/or neonatal thrombocytopenia in approximately 1 in 1000 to 1 in 2000 live births 2,3 . Although many infants recover uneventfully, FNAIT is a leading cause of severe thrombocytopenia in the fetus and neonate, with nearly half experiencing bleeding serious enough to require transfusion with “antigen-negative” platelets 4 . The most destructive consequences of FNAIT, however, are intracranial hemorrhage and intrauterine death as early as 20-24 weeks of gestation 2,5,6 . Despite advances in treatment, FNAIT remains a leading cause of intracranial hemorrhage in full-term infants 4,7-10 , often leading to life-long disability.
- HPA heritable Human Platelet-specific Alloantigen
- HPAs 1-30 located on five different glycoproteins, currently recognized by the Platelet Nomenclature Committee of the International Society of Blood Transfusion (ISBT) and the ISTH 11 .
- the HPA-1a also known as Pl A1
- Pl A1 Pl A1
- a transgenic mouse whose genome comprises a nucleic acid encoding a variant platelet membrane glycoprotein IIIa (GPIIIa) having at least 95% identity to SEQ ID NO: 25, wherein the variant GPIIIa comprises mutations T30A, S32P, Q33L, N29D, and M470Q in SEQ ID NO: 25.
- the mouse expresses a variant GPIIIa comprising the sequence set forth in SEQ ID NO:26.
- the variant GPIIIa further comprises mutation V22M relative to SEQ ID NO: 25.
- the variant GPIIIa can bind to an anti-HPA-1a antibody.
- GPIIIa platelet membrane glycoprotein IIIa
- the candidate molecule is selected from the group consisting of an antibody, an Fv, an F(ab), aF(ab’), F(ab’)2, and a single chain form of any of the foregoing.
- an in vivo method of identifying a molecule that is able to prevent an anti-HPA-1a alloimmune response in a female mouse comprising: administering to a test mouse a candidate molecule, wherein the test mouse is pregnant with pups heterozygous for wild-type platelet membrane glycoprotein IIIa (GPIIIa) and a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25, and wherein the test mouse is negative for anti-HPA-1a antibodies; and measuring anti-HPA-1a antibody titer in the test mouse; wherein the candidate molecule is able to prevent an anti-HPA- 1a all
- the anti- HPA-1a antibody titer in the test mouse is undetectable at six weeks postpartum.
- the candidate molecule is selected from the group consisting of an antibody, an Fv, an F(ab), a F(ab’), F(ab’)2, and a single chain form of any of the foregoing.
- an in vivo method of identifying a molecule that is able to inhibit an anti-HPA-1a alloantibody from binding to fetal or neonatal platelets comprising: administering to a test mouse a candidate molecule, wherein the test mouse pregnant with pups heterozygous for wild-type platelet membrane glycoprotein IIIa (GPIIIa) and a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25, and wherein the test mouse was immunized prior to pregnancy with (i) platelets from a transgenic mouse of described herein or (ii) a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25; and measuring fetal or neonatal platelet count; wherein the candidate molecule is able to inhibit an anti-HPA-1a alloantibody
- the candidate molecule is selected from the group consisting of an antibody, an Fv, an F(ab), a F(ab’), F(ab’)2, and a single chain form of any of the foregoing.
- an in vivo method of identifying a molecule that is able to inhibit an anti-HPA-1a alloantibody from crossing the placenta of a pregnant mouse comprising: administering to a test mouse a candidate molecule, wherein the test mouse pregnant with pups heterozygous for wild-type platelet membrane glycoprotein IIIa (GPIIIa) and a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25, and wherein the test mouse was immunized prior to pregnancy with (i) platelets from a transgenic mouse described herein or (ii) a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25; and measuring fetal or neonatal anti-HPA- 1a antibody titer; wherein the candidate molecule is able to inhibit an anti-
- the candidate molecule is selected from the group consisting of an antibody, an Fv, an F(ab), a F(ab’), F(ab’) 2 , and a single chain form of any of the foregoing.
- GPIIIa platelet membrane glycoprotein IIIa
- an in vitro method of identifying a molecule that is able to compete with an anti-HPA-1a antibody for binding to a variant GPIIIa described herein comprising: contacting the variant GPIIIa with the anti-HPA-1a antibody to form a GPIIIa-antibody complex, wherein the variant GPIIIa is immobilized on a substrate and wherein the anti-HPA-1a antibody comprises a label; contacting the GPIIIa-antibody complex with a candidate molecule in solution; and determining whether the candidate molecule competes for anti-HPA-1a antibody binding to the variant GPIIIa by detecting the amount of label on the substrate or in the solution; wherein the candidate molecule is able to compete with the anti- HPA-1a antibody for binding to the variant GPIIIa if the amount of label detected on the substrate is reduced after contacting the GPIIIa-antibody complex with the candidate molecule compared with the amount of label detected on the substrate before contacting
- the anti-HPA-1a antibody is monoclonal antibody 26.4.
- the label is selected from the group consisting of a fluorophore, a radioisotope, a chemiluminescent probe, and a bioluminescent probe.
- the substrate is selected from the group consisting of a bead, a resin, a particle, a membrane, and a gel.
- the candidate molecule is selected from the group consisting of an antibody, an Fv, an F(ab), a F(ab’), F(ab’) 2 , and a single chain form of any of the foregoing.
- a method for making a transgenic mouse described herein comprising: injecting into the cytoplasm of a fertilized murine oocyte i) a Cas9 nuclease or a nucleotide encoding a Cas9 nuclease; ii) a gRNA targeting murine ITGB3 exon 3; iii) a gRNA targeting murine ITGB3 exon 10; iv) a single stranded homology directed repair (HDR) template oligonucleotide encoding T30A, S32P, Q33L, and N39D mutations in GPIIIa relative to SEQ ID NO:25; and ii) a single stranded HDR template oligonucleotide encoding a M470Q mutation in GPIIIa relative to SEQ ID NO:25; implanting two-cell stage embryos generated from the injected oocytes into oviducts of
- the gRNA targeting ITGB3 exon 10 comprises SEQ ID NO:7.
- the single stranded HDR template oligonucleotide encoding a M470Q mutation additionally encodes a diagnostic restriction site.
- the single stranded HDR template oligonucleotide encoding a M470Q mutation additionally encodes one or more silent mutations to ITGB3 exon 10 to silence repetitive digestion by Cas9 of ITGB3 at exon 10.
- the single stranded HDR template oligonucleotide encoding a M470Q mutation comprises SEQ ID NO:8.
- the gRNA targeting ITGB3 exon 3 comprises SEQ ID NO:1.
- the single stranded HDR template oligonucleotide encoding T30A, S32P, Q33L, and N39D mutations additionally encodes a diagnostic restriction site.
- the single stranded HDR template oligonucleotide encoding T30A, S32P, Q33L, and N39D mutations additionally encodes one or more silent mutations to ITGB3 exon 3 to silence repetitive digestion by Cas9 of ITGB3 at exon 3.
- the single stranded HDR template oligonucleotide encoding T30A, S32P, Q33L, and N39D mutations comprises SEQ ID NO:4.
- a transgenic mouse whose genome comprises a nucleic acid encoding a variant platelet membrane glycoprotein IIIa (GPIIIa) having at least 95% identity to SEQ ID NO: 27, wherein the variant GPIIIa comprises mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO: 25.
- the mouse expresses a variant GPIIIa comprising the sequence set forth in SEQ ID NO:27.
- the variant GPIIIa can bind to an anti-HPA-1a antibody.
- the mouse is positive for anti-HPA-1a antibodies.
- the mouse was immunized prior to pregnancy with (i) platelets from a transgenic mouse described herein or (ii) a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25.
- FIGS. 1A-1B shows the three-dimensional structure of the human GPIIIa PSI and EGF1 domains. Note that the PSI domain lies between the hybrid and EGF1 domains of GPIIIa, and that polymorphic amino acid 33, which controls expression of the HPA-1a (Pl A1 ) epitope, is directly opposite the linearly distant, but conformationally close, EGF1 domain.
- FIGS.2A-2F show CRISPR-mediated generation of the APLD humanized transgenic mouse.
- FIG.2A Three-dimensional structure of the GPIIIa PSI domain, showing the location of the residues that were mutated in the murine protein to humanize the 22-40 amino acid loop.
- FIG. 2B Schematic illustration of the ITGB3 locus, showing the location of the gRNA binding site (red bar), the protospacer adjacent motif (PAM) sequence (magenta bar), and the Cas9 cleavage site (red arrow heads).
- a 200 bp APLD Homology Directed Repair (HDR) template was designed to introduce the four desired amino acid substitutions (mutated nucleotides labeled in red) and a diagnostic BamH1 restriction site (silent mutation nucleotides labeled in blue) flanked by 80 nucleotide homology arms.
- the HDR template also introduces nucleotides (green) that encode silent mutations to prevent re-cleavage by Cas9.
- FIG.2C The 20 bp gRNA shown in panel B, designed to target the Cas9 nuclease to the ITGB3 gene, was cloned into the BbsI site of the CRISPR vector px459, which also encodes both Cas9 and a puromycin-resistance gene. Pronuclei of C57BL/6N fertilized eggs were microinjected with the px459 plasmid along with the HDR template to generate the humanized APLD mouse.
- FIG. 2D PCR strategy designed to report the incorporation of the HDR template within a 717 bp region surrounding the targeted site of the murine ITGB3 gene. The introduced BamH1 is marked by a blue box.
- FIG. 2E Genotyping of two representative pups: Genomic DNA from the pups’ tail was PCR amplified and digested with BamH1 to identify correctly targeted APLD alleles. The PCR product of Pup #1 cut with BamH1, demonstrating successful incorporation of the HDR oligo. The arrows indicate the expected BamH1 digestion products.
- FIG. 2F The ITGB3 locus surrounding the genomic editing site was PCR-amplified from genomic DNA of Pup #1 and subjected to DNA sequence analysis, confirming precise homozygous integration of the human sequence into both alleles of murine ITGB3.
- FIGS.3A-3B show the APLD humanized murine PSI domain supports the binding of many, but not all, human anti-HPA-1a alloantisera.
- FIG. 3A Flow cytometry analysis of the binding of the HPA-1a-selective murine mAb, SZ21 to human and mouse platelets. Note that SZ21 binds to human HPA-1a-, but not HPA-1b, -positive human platelets, demonstrating its allo-selectivity, and to APLD, but not wild-type, murine platelets.
- PSIB1 The PSI domain-specific mAb, PSIB1, was used as a positive control for expression of GPIIb-IIIa, and as shown, binds all PSI domains, regardless of species or HPA allotype.
- FIG. 3B Antigen-capture ELISA analysis of anti-HPA-1a maternal alloantisera binding to human and murine forms of GPIIb-IIIa. Five different human FNAIT alloantisera were incubated with human or murine platelet of the indicated phenotype.
- Platelet/antibody complexes were then detergent lysed and added to microtiter wells that had been coated with either anti-mouse CD41 to capture immune complexes from mouse platelets, or mAb AP2 to capture immune complexes from human platelets.
- human alloantisera 2, 3, and 4 react similarly with human GPIIb-IIIa and APLD murine GPIIb-IIIa, while alloantisera 1 and 5 do not react with murine APLD GPIIb-IIIa, suggesting that the preponderance of the HPA-1a-specific alloantibodies present in these polyclonal sera have more complex epitope requirements.
- FIGS. 4A-4B show structural requirements for binding of Type II anti-HPA-1a antibodies.
- FIG. 4A Flow cytometry analysis of the reactivity of HPA-1a-specific monoclonal antibodies with human and mouse platelets. Platelets from the indicated species, and having the indicated phenotypes, were reacted with mAbs SZ21, 26.4 and B2G1. Note that the Type II mAb 26.4 requires that murine GPIIIa be humanized from Met to Gln at residue 470 of the EGF1 domain, which is spatially close to the PSI domain, as depicted in FIG. 4B.
- FIGS.5A-5C show multiple amino acids within I-EGF1 can contribute to the binding of type II anti-HPA-1a antibodies.
- FIG. 5A Comparison of human versus murine PSI and I- EGF1 domain sequences, with differences highlighted in red. Note especially the APLD sequences in the PSI domain and the Q470M, H446P, G463D, and P464Q differences within EGF1.
- FIG.5B Structural model of the variable region of antibody B2G1 bound with the ⁇ 3 PSI and I-EGF1 domains.
- the antibody is shown as a tan surface with the CDR loops indicated, while the side chains of integrin ⁇ 3 residues at the antigen-antibody interface are shown as sticks and dots.
- interface interacting residues include not only polymorphic amino acid 33, but also P 32 in the PSI domain and H 446 and Q 470 of I-EGF1. Also note that G 463 and P 464 are nowhere near the interface.
- 5C top HEK293 cells transiently transfected with plasmids expressing human GPIIb and a murine GPIIIa isoform that had been mutated to express the indicated humanized amino acid substitution were incubated with the indicated antibodies and subjected to flow cytometric analysis.
- the PSI domain-specific mAb, PSIB1 was used as a control for transfection efficiency. Note that mAb 26.4 requires Q 470 for its binding, while B2G1 requires both Q 470 and H 446 , as predicted in the docking model in FIG. 5B.
- FIGS. 6A-6D show CRISPR-mediated generation of the APLDQ humanized transgenic mouse.
- FIG.6A Three-dimensional structure of the GPIIIa PSI domain, showing the location of the residues M470 in EGF1 domains that was mutated to Q in the APLD murine GPIIIa protein.
- FIG. 6B Schematic illustration of the ITGB3 locus, showing the location of the gRNA binding site (red bar), the protospacer adjacent motif (PAM) sequence (magenta bar) and the Cas9 cleavage site (red arrow heads).
- a 167 bp Homology Directed Repair (HDR) template was designed to introduce the M to Q amino acid substitutions (mutated nucleotides labeled in red) flanked by 82 and 77 nucleotides homology arms.
- the HDR template also introduces silent mutation (nucleotides in green) to prevent re-cleavage by Cas9.
- FIG.6C Cytoplasmic of APLD C57BL/6N fertilized eggs were microinjected with Cas-9 protein, gRNAs along with the HDR template to generate the humanized APLDQ mouse.
- FIG.6D The ITGB3 locus surrounding the genomic editing site was PCR-amplified from genomic DNA of Pup and subjected to DNA sequence analysis, confirming precise heterozygous integration of the HDR sequence into one allele of murine ITGB3.
- FIG. 7 shows antigen-capture ELISA analysis of anti-HPA-1a maternal alloantisera binding to human and murine forms of GPIIb-IIIa.
- FIG.8 shows inhibition of PAC-1 binding to human ⁇ IIb ⁇ 3 by Type II, but not Type I, anti-HPA-1a alloantibodies.
- HEK293FT cells were transfected with wild-type human ⁇ IIb ⁇ 3 plus EGFP. Cells were pre-incubated with either the Type I mAbs SZ21, the Type II mAbs B2G1 and 26.4, or purified IgG fractions from a previously-characterized Type I PTP antisera (PTP-1), or previously characterized Type II FNAIT antisera (FNAIT-5 and FNAIT-9).
- PTP-1 Type I PTP antisera
- FNAIT-5 and FNAIT-9 previously characterized Type II FNAIT antisera
- FIG.9 shows pre-immunized wild-type females bred with APLD +/+ males give birth to severely thrombocytopenic pups.
- Breeding control #1 is a WT non-immunized Balb/c female crossed with an APLD C57BL/6 male.
- Breeding control #2 is an immunized Balb/c female crossed with a WT C57BL/6 male.
- FIGS. 10A-10D show that although the female was alloimmunized only once, fetal/neonatal thrombocytopenia persists for at least five subsequent pregnancies. Maternal anti- APLD ⁇ 3 integrin antibodies cause thrombocytopenia and bleeding in the pups.
- FIG.11 shows that, similar to the APLD model shown in FIG.9, pre-immunized wild- type females bred with APLDQ males give birth to severely thrombocytopenic pups.
- Breeding control #1 is a WT non-immunized Balb/c female crossed with an APLD C57BL/6 male.
- Breeding control #2 is an immunized Balb/c female crossed with a WT C57BL/6 male.
- FIGS. 12A-12D shows that thrombocytopenia and bleeding in the pups persists in up to 4 pregnancies in the breeding outlined in FIG.11. Maternal anti-APLD ⁇ 3 integrin antibodies cause thrombocytopenia and bleeding in the pups.
- FIG. 13 shows that 4 ⁇ g/ml mAb 26.4 efficiently inhibits the binding of murine polyclonal anti-APLDQ antibodies to mouse APLDQ platelets in vitro. All concentrations tested between 2 ⁇ g/ml and 16 ⁇ g/ml effectively inhibited binding.
- FIG. 14 shows the IVIG and mAb 26.4 treatment protocols. Treatment with human IVIG at 1g/kg, introduced IV at days 10 and 17 post-mating elevates platelet counts of pups born to APLDQ alloimmunized females.
- FIG. 15 shows that both IVIG and PG-LALA 26.4 effectively elevate the platelet count in pups of APLDQ alloimmunized female mice.
- FNAIT and PTP are bleeding disorders caused by alloantibodies to platelet-specific antigens.
- HPA-1a also known as Pl A1
- Pl A1 the human platelet alloantigen that most commonly provokes PTP and FNAIT, being responsible for ⁇ 80% of the cases in which an alloantibody can be detected.
- GP platelet membrane glycoprotein
- HPA-1b the HPA-1b
- MHC major histocompatibility complex
- Polymorphic amino acid 33 is located within a heavily disulfide-bonded knot-like structure known as the plexin, semaphorin, integrin (PSI) domain, which itself lies between the hybrid and integrin epidermal growth factor 1 (EGF, I-EGF1) domains of GPIIIa 18 (see FIGS. 1A-1B).
- PSI integrin epidermal growth factor 1
- transgenic mice that expressed murine GPIIIa isoforms harboring select humanized residues within the PSI and EGF1 domain. Also described is binding of a series of monoclonal and polyclonal HPA-1a-specific antibodies to the GPIIIa isoforms harboring select humanized residues. The binding shows complex heterogeneity of the polyclonal alloimmune response to this clinically important human platelet alloantigen system.
- transgenic mouse comprising humanizing mutations in GPIIIa. Because of the mutations in GPIIIa, the mouse expresses variant GPIIIa that binds monoclonal and polyclonal antibodies from anti-HPA-1a antisera. Also provided herein are cells and tissues derived from the transgenic mouse. The wild-type mouse GPIIIa sequence is included herein as SEQ ID NO:25.
- the transgenic mouse GPIIIa sequence comprises at least T30A, S32P, Q33L, N29D, and M470Q mutations in GPIIIa (SEQ ID NO:25), resulting in a variant GPIIIa capable of binding an anti-HPA-1a antibody, and, in some embodiments, monoclonal and polyclonal anti-HPA-1a antibodies.
- the variant GPIIIa sequence comprises at least an M470Q mutation and a mutation of amino acid residues 22-40 of SEQ ID NO:25, wherein amino acid residues 22-40 are replaced with the sequence MCAWCSDEALPLGSPRCD (SEQ ID NO:28) which corresponds to the loop region in the PSI domain and adjacent to the EGF1 and EGF2 domains of human GPIIIa.
- the variant GPIIIa is capable of binding the monoclonal antibody 26.4.
- the transgenic mouse expresses a variant GPIIIa comprising the amino acid sequence of SEQ ID NO:26.
- the transgenic mouse expresses a variant GPIIIa comprising the amino acid sequence of SEQ ID NO:27.
- Murine GPIIIa (SEQ ID NO:25) ESNICTTRGVNSCQQCLAVSPVCAWCSDETLSQGSPRCNLKENLLKDNCAPESIEFPVSE AQILEARPLSSKGSGSSAQITQVSPQRIALRLRPDDSKIFSLQVRQVEDYPVDIYYLMDLS FSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMYISPPQAIKNPCYNMK NACLPMFGYKHVLTLTDQVSRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWR NDASHLLVFTTDAKTHIALDGRLAGIVLPNDGHCHIGTDNHYSASTTMDYPSLGLMTEK LSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSDDSSNVLQLIVDAYGKIRSKVELEV RDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEQSF
- SEQ ID NO: 26 is a variant of SEQ ID NO: 25.
- the variant GPIIIa can have, for example, an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO:25 and that comprises T30A, S32P, Q33L, N29D, and M470Q mutations relative to SEQ ID NO:25.
- the variant GPIIIa comprises T30A, S32P, Q33L, N29D, and M470Q mutations relative to SEQ ID NO:25 and 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, up to 15, up to 20, up to 25, or up to 30 additional amino acid substitutions relative to SEQ ID NO:25.
- the amino acid substitutions are conservative substitutions.
- conservative substitution denotes that one or more amino acids are replaced by another, biologically similar residue. Examples include substitution of amino acid residues with similar characteristics, e.g., small amino acids, acidic amino acids, polar amino acids, basic amino acids, hydrophobic amino acids, and aromatic amino acids.
- nucleic acids or polypeptides refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
- the percent identity can be measured using sequence comparison software or algorithms, or by visual inspection. Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences. [0044] One such non-limiting example of a sequence alignment algorithm is described in Karlin et al., Proc. Natl.
- BLAST-2 Altschul et al., Methods in Enzymology, 266:460-480 (1996)), ALIGN, ALIGN-2 (Genentech, South San Francisco, California) or Megalign (DNASTAR) are additional publicly available software programs that can be used to align sequences.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (e.g., using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 90 and a length weight of 1, 2, 3, 4, 5, or 6).
- the GAP program in the GCG software package which incorporates the algorithm of Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)), can be used to determine the percent identity between two amino acid sequences (e.g., using either a BLOSUM 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5).
- the percent identity between nucleotide or amino acid sequences is determined using the algorithm of Myers and Miller (CABIOS 4:11-17 (1989)).
- the percent identity can be determined using the ALIGN program (version 2.0) and using a PAM120 with residue table, a gap length penalty of 12 and a gap penalty of 4.
- One skilled in the art can determine appropriate parameters for maximal alignment by particular alignment software. In certain embodiments, the default parameters of the alignment software are used.
- Other resources for calculating identity include methods described in Computational Molecular Biology (Lesk ed., 1988); Biocomputing: Informatics and Genome Projects (Smith ed., 1993); Computer Analysis of Sequence Data, Part 1 (Griffin and Griffin eds., 1994); Sequence Analysis in Molecular Biology (G. von Heinje, 1987); Sequence Analysis Primer (Gribskov et al.
- transgenic animal refers to a non-human animal, such as a mammal, generally a rodent such as a rat or mouse, in which one or more (preferably all) of the cells of the animal includes a transgene as described herein.
- rodent such as a rat or mouse
- transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, and the like.
- transgenic animal refers to exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and thus remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. Knock-out animals are included in the definition of transgenic animals. [0046] Methods for generating transgenic animals, particularly animals such as mice, via embryo manipulation and electroporation or microinjection of pluripotent stem cells or oocytes, are known in the art and are described, for example, in U.S. Pat. Nos. 4,736,866 and 4,870,009, U.S. Pat. No. 4,873,191, U.S. Ser. No.
- a transgenic mouse as described herein is made by injecting a vector made as described herein into the pronuclei or cytoplasm of a fertilized mouse oocyte and used for generation of a transgenic mouse with T30A, S32P, Q33L, N39D, and M470Q mutations, relative to SEQ ID NO:25, in GPIIIa in all cells, using standard transgenic techniques, e.g., as described in “Transgenic Mouse Methods and Protocols (Methods in Molecular Biology),” Hofker and van Deursen, Editors (Humana Press, Totowa, N.J., 2002); U.S. Pat. Nos.4,736,866 and 4,870,009, U.S. Pat.
- the transgenic mouse as described herein is generated using CRISPR/Cas9 mediated homology directed repair (HDR).
- HDR CRISPR/Cas9 mediated homology directed repair
- a vector encoding both i) the Cas9 nuclease and ii) guide RNA (gRNA) targeting the region of interest and preceding a protospacer adjacent motif (PAM) site, and a single stranded oligodeoxynucleotide (ssODN) homology directed repair template are injected into the pronuclei or cytoplasm of fertilized murine oocytes.
- gRNA guide RNA
- PAM protospacer adjacent motif
- ssODN single stranded oligodeoxynucleotide
- isolated gRNA, ssODN HDR template, and Cas9 nuclease are injected into the pronuclei or cytoplasm of fertilized murine oocytes.
- the vector comprises a reporter gene or selectable markers.
- the gRNA targets murine ITGB3 exon 3 and the ssODN HDR template encodes the GPIIIa T30A, S32P, Q33L, and N39D mutations.
- the gRNA that targets murine ITGB3 exon 3 has the sequence 5'- TTCTCCTTCAGGTTACATCG-3' (SEQ ID NO:1).
- the ssODN HDR template encoding GPIIIa T30A, S32P, Q33L, and N39D mutations has the sequence 5'- GCCAGGGGGAGGTGACTTACCAGGCAGGAGGCACAGCCGCCCTAGCTCTGATGTTG ACCTTTCCCTCGGGCTCTTCTCTTCATAGGCCTTGCCTCTGGGATCCCCACGCTGTGA CCTGAAGGAGAACCTGCTGAAGGACAATTGTGCTCCAGAGTCTATTGAGTTCCCAGT CAGTGAGGCCCAGATCCTGGAGGCTAGGC-3' (SEQ ID NO:4).
- the ssODN HDR template encodes silent mutations introducing a diagnostic restriction site.
- the ssODN HDR template encodes silent mutations to the target gene of interest to silence repetitive digestion of the resulting mutated gene by Cas9.
- the murine ITGB3 gene sequence is available as NCBI Gene ID:16416 and GenBank NC_000077.6.
- the genomic, nucleotide mutations that correspond to the A30, P32, L33, D39, and Q470 mutations in ITGB3 are outlined in FIG.2B and FIG.6B.
- the gRNA targets ITGB3 exon 10 and the ssODN HDR template encodes the GPIIIa M470Q mutation.
- the gRNA that targets murine ITGB3 exon 10 has the sequence 5'-CTCCTCAGAGCACTCACACA-3' (SEQ ID NO:7).
- the ssODN HDR template encoding the GPIIIa M470Q mutation has the sequence 5'- AGCCTTCCAGCCCACGCTGCAACAATGGGAACGGGACTTTTGAGTGTGGGGTGTGCC GCTGTGACCAGGGCTGGCTGGGGTCCCAATGCGAGTGCTCTGAGGAGGATTACCGA CCCTCTCAGCAGGAAGAGTGCAGCCCCAAGGAGGGCCAGCCCATCTGCAGCCA-3' (SEQ ID NO:8).
- the ssODN HDR template encodes silent mutations introducing a diagnostic restriction site. In some embodiments, the ssODN HDR template encodes silent mutations to the target gene of interest to silence repetitive digestion of the resulting mutated gene by Cas9. [0053]
- a transgenic founder animal can be identified based upon the presence of T30A, S32P, Q33L, N29D, and M470Q mutations in GPIIIa. The presence of the mutations may be detected directly, for example, by PCR amplification or sequencing of the region of interest of the GPIIIa gene. A transgenic founder animal can then be used to breed additional animals carrying the transgene.
- transgenic animal carrying the T30A, S32P, Q33L, N29D, and M470Q mutations in GPIIIa can further be bred with other transgenic animals carrying other transgenes.
- the transgenic animals described herein, as well as cells and tissues derived therefrom, are useful in the identification and study of factors that can bind to variant GPIIIa, for example, monoclonal or polyclonal anti-HPA-1a antibodies or fragments thereof.
- the transgenic animal described herein may be used to characterize test factors useful in the treatment or prevention of RPT, PTP, or FNAIT, for example, by monitoring platelet count, platelet concentration, bleeding, or pharmacokinetics of the test factors.
- the invention provides in vitro and in vivo screening methods.
- One embodiment is an in vitro method of identifying a molecule that is able to specifically bind to a variant glycoprotein IIIa (GPIIIa).
- GPIIIa variant glycoprotein IIIa
- a candidate molecule is contacted with platelets from a transgenic mouse whose genome comprises a nucleic acid encoding a variant GPIIIa, wherein the variant GPIIIa comprises mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25.
- the candidate molecule binds to platelets from the transgenic mouse, but does not bind to platelets from a wild-type mouse or a mouse not comprising the variant GPIIIa, then the candidate molecule can be considered to bind specifically to the variant GPIIIa.
- Platelet binding can be measured qualitatively or quantitatively by known methods, including flow cytometry, immunohistochemistry, radioimmunoassay, ELISA, fluorescence resonance energy transfer (FRET), biolayer interferometry, and surface plasmon resonance.
- Another in vitro method can identify a molecule that is able to compete with an anti- HPA-1a antibody for binding to a variant GPIIIa of the invention.
- the method comprises (a) contacting the variant GPIIIa with the anti-HPA-1a antibody to form a GPIIIa-antibody complex, wherein the variant GPIIIa is immobilized on a substrate and wherein the anti-HPA-1a antibody comprises a label; (b) contacting the GPIIIa-antibody complex with a candidate molecule in solution; and (c) determining whether the candidate molecule competes for anti-HPA-1a antibody binding to the variant GPIIIa by detecting the amount of label on the substrate or in the solution.
- the candidate molecule competes with the antibody by binding to the variant GPIIIa and preventing binding of the antibody.
- a positive result in this assay indicates that the binding site of the candidate molecule to GPIIIa overlaps with or comprises the epitope on GPIIIa to which the antibody binds.
- the variant GPIIIa comprises the amino acid sequence set forth in SEQ ID NO: 26.
- a “label” is a detectable compound that can be conjugated directly or indirectly to a molecule, so as to generate a labeled molecule.
- the label can be detectable on its own (e.g., radioisotope labels or fluorescent labels), or can be indirectly detected, for example, by catalyzing chemical alteration of a substrate compound or composition that is detectable (e.g., an enzymatic label) or by other means of indirect detection (e.g., biotinylation).
- the label is selected from the group consisting of a fluorophore, a radioisotope, a chemiluminescent probe, and a bioluminescent probe.
- the HPA-1a antibody is a monoclonal antibody selected from the group consisting of PSIB1, SZ21, and 26.4.
- the anti-HPA-1a antibody is 26.4.
- the variant GPIIIa can be immobilized on any porous or non-porous substrate known in the art.
- immobilization substrates include beads, resins, particles, membranes, and gels.
- Substrates can be comprised of a variety of materials, including agarose, alginate, glass, and magnetic materials. Immobilization can be achieved using any known method, such as adsorption, affinity tag binding, or covalent bonding.
- in vivo methods is a method of identifying a molecule that is able to prevent an anti-HPA-1a alloimmune response in a female mouse.
- the method comprises administering to a test mouse a candidate molecule, wherein the test mouse is pregnant with pups heterozygous for wild-type platelet membrane glycoprotein IIIa (GPIIIa) and a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25, and wherein the test mouse is negative for anti-HPA-1a antibodies; and measuring anti-HPA-1a antibody titer in the test mouse.
- GPIIIa wild-type platelet membrane glycoprotein IIIa
- the candidate molecule is able to prevent an anti-HPA-1a alloimmune response if the anti-HPA-1a antibody titer in the test mouse is undetectable at delivery, at one week, two weeks, three weeks, four weeks, five weeks, six weeks, seven weeks, eight weeks, nine weeks, and/or ten weeks postpartum.
- the invention further provides an in vivo method of identifying a molecule that is able to inhibit an anti-HPA-1a alloantibody from crossing the placenta of a pregnant mouse.
- the method comprises administering to a test mouse a candidate molecule, wherein the test mouse pregnant with pups heterozygous for wild-type platelet membrane glycoprotein IIIa (GPIIIa) and a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25, and wherein the test mouse was immunized prior to pregnancy with (i) platelets from a transgenic mouse described herein or (ii) a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25; and measuring fetal or neonatal anti-HPA-1a antibody titer.
- GPIIIa wild-type platelet membrane glycoprotein IIIa
- the candidate molecule is able to inhibit an anti- HPA-1a alloantibody from crossing the placenta of the pregnant mouse if the fetal or neonatal antibody titer in pups of the test mouse is lower than the fetal or neonatal antibody titer in pups of a control mouse.
- the method comprises administering to a test mouse a candidate molecule, wherein the test mouse pregnant with pups heterozygous for wild-type platelet membrane glycoprotein IIIa (GPIIIa) and a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25, and wherein the test mouse was immunized prior to pregnancy with (i) platelets from a transgenic mouse described herein or (ii) a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25; and measuring fetal or neonatal platelet count.
- GPIIIa wild-type platelet membrane glycoprotein IIIa
- the candidate molecule is able to inhibit an anti-HPA-1a alloantibody from binding to fetal or neonatal platelets if the fetal or neonatal platelet count in pups of the test mouse is higher than the fetal or neonatal platelet count in pups of a control mouse.
- a “control mouse” is one that comprises the same conditions and is assessed in the same manner and in the same timeframe as the test mouse to which it is being compared, except that the control mouse has not been treated with the candidate molecule. For example, where the test mouse was immunized with platelets from a transgenic mouse of the invention or with a variant GPIIIa of the invention prior to pregnancy, the control mouse was pre-immunized under the same conditions.
- the control mouse is pregnant with heterozygous pups as well.
- certain parameters are measured and/or outcomes are compared between a test mouse and a control mouse, the measurement or assessment is made using the same techniques/assays, under the same conditions.
- a wild-type female mouse is bred with a transgenic male mouse of the invention.
- a “candidate molecule” can be any chemical compound. Macromolecules, such as peptides, polypeptides, protein complexes, glycoproteins, antibodies, oligonucleotides, and nucleic acids, and small molecules, such as amino acids, nucleotides, organic compounds, inorganic compounds and organometallic compounds, are examples of candidate compounds.
- the candidate molecule can be naturally occurring, synthetic, or can include both natural and synthetic components.
- Antibodies for use or screening in methods of the invention can include human antibodies, humanized antibodies, chimeric antibodies, monoclonal antibodies, polyclonal antibodies, recombinant antibodies, bispecific antibodies, multispecific antibodies, and antigen- binding fragments thereof.
- Antigen-binding fragments include Fv, F(ab), F(ab’), and F(ab’)2. Single-chain forms of each of the foregoing antibodies and antigen-binding fragments are also included.
- the candidate molecule can be a member of a library, e.g., an inorganic or organic chemical library, a peptide library, an oligonucleotide library, an antibody library, or mixed-molecule library.
- the methods include screening small molecules, e.g., natural products or members of a combinatorial chemistry library.
- the variant GPIIIa of the invention can be used in an epitope binning assay.
- Epitope binning is a competitive immunoassay that can be used to characterize and sort a library of monoclonal antibodies against a target antigen, for example, a protein comprising the amino acid sequence set forth in SEQ ID NO: 26.
- Antibodies against a similar target are tested against all other antibodies in the library in a pairwise fashion to determine whether antibodies block one another’s binding to the epitope of an antigen.
- a competitive blocking profile for each antibody is created against all of the other antibodies in the library.
- Candidate molecules can be administered by methods known in the art, for example, by any of the oral, parenteral, inhalation, or topical routes. Parenteral administration includes, for example, intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, and vaginal administration.
- Oral dosage forms include, for example, solid, liquid, and suspension formulations. Oral gavage is a preferred form of oral administration.
- Nasal aerosol or inhalation dosage forms can be prepared, for example, as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
- the candidate molecule can be administered in a composition comprising a buffer (e.g. acetate, phosphate or citrate buffer), optionally a surfactant (e.g. polysorbate), optionally a stabilizer agent (e.g. human albumin), etc.
- a buffer e.g. acetate, phosphate or citrate buffer
- a surfactant e.g. polysorbate
- a stabilizer agent e.g. human albumin
- the carrier or diluent can be dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables.
- One of skill in the art can readily determine the appropriate route and dosage form, depending upon the structure and nature of the candidate molecule. Dosage of the candidate molecule can be determined empirically by the skilled artisan.
- the candidate molecule can be administered one time or multiple times at time points before pregnancy, during pregnancy, and postpartum.
- the candidate molecule can be administered at one or more times between 1 and 14 days prior to mating, between days 1 and 24 post-mating, and/or between 1 and 28 days postpartum.
- the candidate molecule is administered at day 10 and day 17 post-mating.
- immunization comprises administration of platelets from a transgenic mouse expressing a variant GPIIIa comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25.
- immunization comprises administration of a variant GPIIIa, for example, comprising mutations T30A, S32P, Q33L, N29D, and M470Q relative to SEQ ID NO:25.
- Administration is via known methods, preferably by injection.
- Immunization can be performed, for example, at one or more times between 1 and 14 days prior to mating, during the gestational period of the mouse or following birth of the pup.
- pre-immunization is performed at one or more times between 1 and 14 days prior to mating.
- maternal, fetal, and/or neonatal anti-HPA-1a antibody titers are measured.
- Antibody titers can be measured in samples from an adult mouse, a neonatal mouse, or a fetal mouse. Antibody titers can be measured by known methods, including chemiluminescent microparticle immunoassay (CMIA), enzyme immunoassay (EIA), radioimmunoassay (RIA), fluorescence activated cell sorting (FACS), lateral flow assay, enzyme linked immunosorbent assay (ELISA), and the like.
- CLIA chemiluminescent microparticle immunoassay
- EIA enzyme immunoassay
- RIA radioimmunoassay
- FACS fluorescence activated cell sorting
- ELISA enzyme linked immunosorbent assay
- antibody titer can be measured by coating the appropriate antigen, for example, HPA-1a, comprising a label onto a surface, such as beads, a microwell plate or microparticles, reacting the antigen with a sample to be analyzed, and then measuring the intensity of the label.
- antibody titers are measured using a single-antigen bead assay. In one embodiment, antibody titers are expressed as mean fluorescence intensity (MFI) values.
- MFI mean fluorescence intensity
- Antibody titers can be assessed at one or more time points, depending on the screening assay. For example, antibody titers can be measured in a female mouse between 1 and 14 days prior to mating, between days 1 and 24 post-mating, and/or between 1 and 28 days postpartum.
- Antibody titers in a neonatal pup can be measured, for example, immediately after delivery, at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 hours after delivery, and/or at 1, 2, 3, 4, 5, and/or 6 days after delivery, and/or at 1, 2, 3, and/or 4 days after delivery.
- Antibody titers in fetal pups can be measured, for example, at gestation day 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, and/or 22.
- antibody titers are measured in adult, neonatal, or fetal mice at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 14, 16, 18, 20, 24, 30, 36, 42 and/or 48 hours, and/or at 1, 2, 3, 4, 5, and/or 6 days, and/or at 1, 2, 3, or 4 weeks after administration of a candidate molecule to the mother.
- fetal or neonatal platelet counts are measured in blood collected from dissected fetuses or from neonates. Platelet counts can be calculated manually using a hemocytometer, or can be measured by automated methods using, for example, optical light scatter/fluorescence analysis, flow cytometry, or impendence analysis.
- Platelet counts can be determined at one or more time points, depending on the screening assay. For example, platelet counts in a neonatal pup can be measured immediately after delivery, at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 hours after delivery, and/or at 1, 2, 3, 4, 5, and/or 6 days after delivery, and/or at 1, 2, 3, and/or 4 days after delivery. Platelet counts in fetal pups can be measured, for example, at gestation day 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, and/or 22.
- platelet counts are measured in fetal or neonatal pups at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 14, 16, 18, 20, 24, 30, 36, 42 and/or 48 hours, and/or at 1, 2, 3, 4, 5, and/or 6 days, and/or at 1, 2, 3, or 4 weeks after administration of a candidate molecule to the mother.
- Bleeding is evaluated in fetal or neonatal pups in some aspects of the invention. “Bleeding” as used herein means an accumulation of blood in the body cavity, extremities, or cranium of the fetal or neonatal pup. In one embodiment, bleeding is intracranial bleeding. Bleeding can be assessed visually in dissected fetuses or in neonates.
- the terms “approximately” or “about” in reference to a number are generally taken to include numbers that fall within a range of 5% in either direction (greater than or less than) the number unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- Numeric ranges are inclusive of the numbers defining the range, and any individual value provided herein can serve as an endpoint for a range that includes other individual values provided herein. For example, a set of values such as 1, 2, 3, 8, 9, and 10 is also a disclosure of a range of numbers from 1-10, from 1-8, from 3-9, and so forth. Likewise, a disclosed range is a disclosure of each individual value encompassed by the range.
- Example 1 The embodiment described here demonstrates the generation of a murine model of FNAIT using CRISPR/Cas9-mediated homology directed repair. Specifically, this embodiment demonstrates generation of a transgenic mouse comprising T30A, S32P, Q33L, N29D, and M470Q mutations in GPIIIa, relative to SEQ ID NO:25.
- Antibodies Three antibodies with specificity for the Leu33 allelic isoform of human GPIIIa were used in this study: the murine monoclonal antibody (mAb) SZ21 20 , the human mAb 26.4 21 , derived from an immortalized B cell from an HPA-1a alloimmunized woman who had an infant affected by FNAIT, and B2G1 22 – a humanized IgG derived from an scFv fragment isolated by phage display from an HPA-1a alloimmunized woman.
- Human maternal anti-HPA- 1a antisera were provided by Drs.
- a murine mAb, PSIB1 which binds both the human and mouse ⁇ 3 integrin PSI domain, and whose binding is unaffected by the Leu33Pro polymorphism 23 , was kindly provided by Dr. Heyu Ni (University of Toronto).
- mAb AP2 which recognized a complex-dependent epitope on GPIIb-IIIa, but does not interfere with HPA- 1a antibody binding 24 , was provided by Dr. Robert Montgomery (Blood Research Institute, BloodCenter of Wisconsin).
- mice expressing the APLD humanized form of murine GPIIIa - gRNAs were designed using the CRISPR Design Tool (crispr.mit.edu) to minimize off-target effects and selected to precede a 5′-NGG protospacer-adjacent motif (PAM).
- CRISPR Design Tool crispr.mit.edu
- TTCTCCTTCAGGTTACATCG SEQ ID NO:1
- a pair of oligos 5’- CACCGTTCTCCTTCAGGTTACATCG-3’ (SEQ ID NO:2) and 5’- AAACCGATGTAACCTGAAGGAGAAC-3’ (SEQ ID NO:3)) were annealed and cloned into the BbsI site of the Cas9 expression plasmid px459 (Addgene, Cambridge, MA).
- a single- stranded oligodeoxynucleotide 200 nucleotides in length, having the sequence 5'- GCCAGGGGGAGGTGACTTACCAGGCAGGAGGCACAGCCGCCCTAGCTCTG- ATGTTGACCTTTCCCTCGGGCTCTTCTCTTCATAGGCCTTGCCTCTGGGATCCCCACG CTGTGACCTGAAGGAGAACCTGCTGAAGGACAATTGTGCTCCAGAGTCTATTGAGTT CCCAGTCAGTGAGGCCCAGATCCTGGAGGCTAGGC-3' (SEQ ID NO:4) was synthesized by Integrated DNA Technologies (IDT, Coralville, IA).
- This oligo corresponds to the antisense strand of the murine ⁇ 3 gene, and contains five nucleotide substitutions that result in the introduction of four human amino acid substitutions into the PSI domain of the murine ⁇ 3 integrin subunit.
- the ssODN also contains four silent mutations, two of which introduce a diagnostic BamH1 restriction site into the plasmid, and two of which mutates the sequence to avoid repetitive digestion of the humanized murine ⁇ 3 gene by Cas9. [0090] C57BL/6N female mice were superovulated and mated with C57BL/6N males, and fertilized eggs were collected from the oviduct.
- the px459 plasmid (10 ng/ ⁇ l) and ssODN (5 ng/ ⁇ l) were injected into the pronuclei of fertilized oocytes. Injected zygotes were cultured in potassium simplex optimization medium (KSOM) with amino acids at 37°C in 5% CO 2 and 95% humidified air overnight. Two-cell stage embryos were then transferred into the oviducts of pseudo-pregnant female mice. Genomic DNA isolated from the tail of the pups was genotyped by PCR and subsequent sequence analysis.
- KSOM potassium simplex optimization medium
- the region surrounding the targeted locus was amplified using GPIIIa fw1: 5′- AACCATGGAAGGACCATGAC -3′ (SEQ ID NO:5) and GPIIIa rev1: 5′- CACCCCAGTCCTATCCTG-TG -3′ (SEQ ID NO:6).
- PCR reactions were carried out using Herculase II Fusion polymerase (Agilent, Waldbronn, Germany). PCR products were purified using QiaQuick Spin Column, digested with BamHI (New England Biolabs Inc., Ipswich, MA) analyzed on 2% agarose gels, and sequenced to confirm that the DNA double strand break had been faithfully repaired.
- mice expressing the APLDQ humanized form of murine GPIIIa The CRISPR/Cas9 microinjection cocktail, including gRNA (CTCCTCAGAGCACTCACACA, (SEQ ID NO:7)), ssODN 5'- AGCCTTCCAGCCCACGCTGCAACAATGGGAACGGGACTTTTGAGTGTGGGGTGTGCC GCTGTGACCAGGGCTGGCTGGGGTCCCAATGCGAGTGCTCTGAGGAGGATTACCGA CCCTCTCAGCAGGAAGAGTGCAGCCCCAAGGAGGGCCAGCCCATCTGCAGCCA-3' (SEQ ID NO:8) and Cas-9 protein were injected into the cytoplasm of fertilized APLD GPIIIa oocytes (FIGS.6A-6D).
- gRNA CRISPR/Cas9 microinjection cocktail, including gRNA (CTCCTCAGAGCACTCACACA, (SEQ ID NO:7)
- mice born from the microinjection were screened for the presence of the desired point mutation by PCR and subsequent sequencing analysis.
- the region surrounding the targeted locus was amplified using GPIIIa fw2: 5’- GAGAAGGAGCAGTCTTTCACTATCAAGCC-3’ (SEQ ID NO:9) and GPIIIa rev2: 5’- GCAGGAGAAGTCATCGCACTCAC-3’ (SEQ ID NO:10).
- GPIIIa fw2 5’- GAGAAGGAGCAGTCTTTCACTATCAAGCC-3’
- GPIIIa rev2 5’- GCAGGAGAAGTCATCGCACTCAC-3’
- Nucleotide substitutions were introduced into this plasmid using a Quick-Change site-directed mutagenesis kit (Stratagene, La Jolla, CA) to convert T 30 ⁇ A, S 32 ⁇ P, Q 33 ⁇ L, and N 39 ⁇ D, resulting in a plasmid encoding murine GPIIIa containing a completely humanized PSI domain, termed APLD murine GPIIIa.
- additional mutations were introduced in the codons encoding M4 70 and P 446 within the murine EGF1 domain to humanize them to Q 470 and H 446 , respectively, with the resulting constructs referred to as APLDQ, APLDH, and APLDQH.
- G 463 P 464 ⁇ DQ, H 446 ⁇ P, and Q 470 ⁇ M mutations were introduced into the human ITGB3 expression vector, pcDNA3-human ITGB3 to generate plasmids encoding human GPIIIa with D 463 Q 464 , P 446 , or M 470 within the human EGF1 domain.
- Primers used to introduce these mutations are listed in Table 1. All constructs and mutations were confirmed by nucleotide sequencing. [0093] Table 1: Oligonucleotide primers used for site-directed mutagenesis Altered sequences are in bold.
- HEK 293FT cells were transfected with a plasmid encoding human ⁇ IIb together with a plasmid encoding wild-type or mutant forms of murine or human GPIIIa.
- HEK 293FT cells were grown in 6-well plates in DMEM containing 10% FBS without antibiotics one day before transfection to obtain 80-90% confluency at the time of transfection.
- Cells were transfected with 1 ⁇ g of each plasmid and 5 ⁇ L of Lipofectamine 2000 (Invitrogen) in 250 ⁇ L of Opti-MEM I Reduced Serum Medium.
- Flow cytometry Flow cytometry analysis of antibody binding to transiently- transfected HEK293 cells was performed 48 hours post-transfection using a FACSCanto II or an Accuri C6 flow cytometer (BD Biosciences). Non-transfected cells were used as negative control. Antibody binding was detected using FITC-labeled goat (Fab′) 2 anti–human IgG, FITC- labeled goat (Fab′)2 anti–mouse IgG, as appropriate. Data were analyzed using FlowJo software (Tree Star Inc., Ashland, OR).
- the cells were stained separately with the murine mAb, AP3, to detect total ⁇ 3 surface expression to be able to normalize the binding and competition data.
- EGFP-positive cells were analyzed by flow cytometry after staining with Alexa Fluor 647-conjugated goat anti-mouse IgM (for PAC-1) or Alexa Fluor 647-conjugated goat anti-mouse IgG (for AP3).
- the mean fluorescence intensity (MFI) of PAC-1 binding was normalized to ⁇ 3 expression and presented as a percentage of control in the absence of anti-HPA-1a alloantibodies.
- Lysates were added to microtiter wells that had been coated with anti-mouse CD41 (eBioscience, San Diego, CA) to capture immune complexes from mouse platelets, or mAb AP2 to capture immune complexes from human platelets. Bound immune complexes were detected using alkaline phosphatase-conjugated anti-human IgG (Jackson ImmunoResearch Laboratories, West Grove, PA). [0098] Molecular modeling and docking - The model of the variable region of B2G1 Fab was generated using the Rosetta Antibody Protocol 25-29 .
- FIG. 2A is required to reconstitute binding of the Type I, HPA-1a-selective mAb, SZ21, and at least several human polyclonal anti-HPA-1a alloantisera 37 .
- a CRISPR strategy was devised (FIG.2B) to introduce a repair template into exon 3 of the murine ITGB3 locus that would encode these four amino acid substitutions. From 60 zygotes microinjected with a plasmid construct (FIG. 2C) encoding the gRNA shown in FIG.
- FIG.4A similar to human alloantiseras 1 and 5 in FIG.3B, mAb 26.4 was unable to bind murine platelets expressing APLD GPIIIa.
- Close examination of the interface between the PSI and EGF1 domain revealed that a loop extending out from the EGF1 domain of human GPIIIa brings amino acid Q 470 into close proximity with polymorphic residue Leu 33 .
- This residue is a methionine in murine GPIIIa (Ser 469 is conserved in both species).
- FIG. 5A highlights the amino acid differences between the murine versus human PSI and EGF1 domains of GPIIIa. As shown, in addition to the Q470M difference that is spatially close to polymorphic residue 33, there are six additional amino acid differences in EGF1 between the two species.
- HPA-1a antibodies can be classified as Type I or Type II based upon their dependence on noncontiguous linear sequences present in the PSI and EGF1 domains. This concept was supported by the work of Stafford and colleagues 44 , who found that ⁇ 20% of 121 maternal anti- HPA-1a alloantibodies reacted with recombinant fragments of GPIIIa only when the fragment contained both the PSI and EGF1 domains.
- HPA-1-specific antibodies Given the polyclonal nature of HPA-1-specific antibodies, and the likelihood that any maternal antiserum contains antibodies that come at polymorphic amino acid 33 from different angles and bind with different topographical distributions and with different affinities due to the involvement of additional residues, we suspect that a mixture of HPA-1-specific mAbs, rather than any single one, may be required to block the binding of polyclonal maternal antibodies and prevent clearance of fetal platelets from circulation.
- APLDQ humanized form of murine GPIIIa is immunogenic in mice.
- mAb 26.4 efficiently inhibits the binding of murine polyclonal anti-APLDQ antibodies to mouse APLDQ platelets (FIG.13).
- IVIG Intravenous immunoglobulin
- a highly purified globulin preparation obtained from the pooled plasma of between 1000 and 15,000 healthy donors per batch.
- IVIG targets the cellular immune compartment at multiple levels, including innate and adaptive immune cells.
- IVIG interacts with dendritic cells, macrophages, and granulocytes, mainly via activating and inhibitory Fc ⁇ Rs.
- the first maternal infusion of IVIG for the treatment of FNAIT was reported in 1988 (Bussel JB, et al. New Engl J Med.1988;319(21):1374-8), after which IVIG rapidly gained ground as a standard antenatal treatment strategy for FNAIT.
- IVIG intravenous immunoglobulin G
- mAb 26.4 Intravenous immunoglobulin G
- Curtis BR McFarland JG. Human platelet antigens - 2013. Vox Sang.2014;106(2):93- 102. 12. Davoren A, Curtis BR, Aster RH, McFarland JG. Human platelet antigen-specific alloantibodies implicated in 1162 cases of neonatal alloimmune thrombocytopenia. Transfusion. 2004;44(8):1220-1225. 13. Newman PJ, Derbes RS, Aster RH. The human platelet alloantigens, PlA1 and PlA2, are associated with a leucine33/proline33 amino acid polymorphism in membrane glycoprotein IIIa, and are distinguishable by DNA typing. JClinInvest.1989;83:1778-1781.
- Weitzner BD Gray JJ. Accurate Structure Prediction of CDR H3 Loops Enabled by a Novel Structure-Based C-Terminal Constraint. J Immunol.2017;198(1):505-515. 28. Weitzner BD, Jeliazkov JR, Lyskov S, et al. Modeling and docking of antibody structures with Rosetta. Nat Protoc.2017;12(2):401-416. 29. Lyskov S, Chou FC, Conchuir SO, et al. Serverification of molecular modeling applications: the Rosetta Online Server that Includes People (ROSIE). PLoS One. 2013;8(5):e63906. 30.
- Maternal human platelet antigen-1a antibody level correlates with the platelet count in the newborns: a retrospective study. Transfusion.2007;47(1):55-58. 47. Santoso S, Wihadmadyatami H, Bakchoul T, et al. Antiendothelial alphavbeta3 Antibodies Are a Major Cause of Intracranial Bleeding in Fetal/Neonatal Alloimmune Thrombocytopenia. Arterioscler Thromb Vasc Biol.2016;36(8):1517-1524. 48. Zhou D, Thinn AMM, Zhao Y, Wang Z, Zhu J. Structure of an extended beta3 integrin. Blood.2018;132(9):962-972. 49.
- Duquesnoy RJ The eplet load concept in clinical transplantation. Pediatr Transplant. 2016;20(7):884-885. 50. Duquesnoy RJ. Structural epitope matching for HLA-alloimmunized thrombocytopenic patients: a new strategy to provide more effective platelet transfusion support? Transfusion.2008;48(2):221-227. 51. Brooks EG, MacPherson BR, Fung MK. Validation of HLAMatchmaker algorithm in identifying acceptable HLA mismatches for thrombocytopenic patients refractory to platelet transfusions. Transfusion.2008;48(10):2159-2166. 52.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Environmental Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Health & Medical Sciences (AREA)
- Zoology (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
Claims
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/US2019/059869 WO2021091539A1 (en) | 2019-11-05 | 2019-11-05 | A murine model of fetal/neonatal alloimmune thrombocytopenia |
Publications (1)
Publication Number | Publication Date |
---|---|
EP4054324A1 true EP4054324A1 (en) | 2022-09-14 |
Family
ID=69159981
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP19835940.8A Pending EP4054324A1 (en) | 2019-11-05 | 2019-11-05 | A murine model of fetal/neonatal alloimmune thrombocytopenia |
Country Status (6)
Country | Link |
---|---|
EP (1) | EP4054324A1 (en) |
JP (1) | JP2023500896A (en) |
CN (1) | CN114630579A (en) |
AU (1) | AU2019473345A1 (en) |
CA (1) | CA3162639A1 (en) |
WO (1) | WO2021091539A1 (en) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA3235140A1 (en) * | 2021-11-08 | 2023-05-11 | Douglas L. Sheridan | Assays for quantification of anti-hpa-1a antibodies |
Family Cites Families (24)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US661108A (en) | 1899-12-04 | 1900-11-06 | Albert Schmitz | Manufacture of compound tubes. |
US4873191A (en) | 1981-06-12 | 1989-10-10 | Ohio University | Genetic transformation of zygotes |
US4870009A (en) | 1982-11-22 | 1989-09-26 | The Salk Institute For Biological Studies | Method of obtaining gene product through the generation of transgenic animals |
US4736866A (en) | 1984-06-22 | 1988-04-12 | President And Fellows Of Harvard College | Transgenic non-human mammals |
US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
AU6505690A (en) | 1989-09-26 | 1991-04-28 | Richard R Behringer | Erythroid-specific gene expression system |
DE4000939A1 (en) | 1990-01-15 | 1991-07-18 | Brem Gottfried Prof Dr Dr | METHOD FOR OBTAINING ANTIBODIES |
ATE211177T1 (en) | 1991-01-11 | 2002-01-15 | American Nat Red Cross | EXPRESSION OF ACTIVE HUMAN PROTEIN C IN MAMMARY GLAND TISSUE OF TRANSGENIC ANIMALS |
US6331658B1 (en) | 1993-04-20 | 2001-12-18 | Integris Baptist Medical Center, Inc. | Genetically engineered mammals for use as organ donors |
US5639940A (en) | 1994-03-03 | 1997-06-17 | Pharmaceutical Proteins Ltd. | Production of fibrinogen in transgenic animals |
US6204431B1 (en) | 1994-03-09 | 2001-03-20 | Abbott Laboratories | Transgenic non-human mammals expressing heterologous glycosyltransferase DNA sequences produce oligosaccharides and glycoproteins in their milk |
US5959171A (en) | 1994-08-17 | 1999-09-28 | Pharming B.V. | Method for the production of biologically active polypeptides in a mammal's |
US5880327A (en) | 1994-09-21 | 1999-03-09 | American National Red Cross | Transgenic mammals expressing human coagulation factor VIII |
CA2211993A1 (en) * | 1995-01-31 | 1996-08-08 | The Rockefeller University | Identification of dec, (dentritic and epithelial cells, 205 kda), a receptor with c-type lectin domains, nucleic acids encoding dec, and uses thereof |
US6339183B1 (en) | 1995-06-05 | 2002-01-15 | New York University | Transgenic mammals expressing heterologous DNA in urothelium and isolation of biologically active molecules from urine |
US6166288A (en) | 1995-09-27 | 2000-12-26 | Nextran Inc. | Method of producing transgenic animals for xenotransplantation expressing both an enzyme masking or reducing the level of the gal epitope and a complement inhibitor |
WO1997012513A1 (en) | 1995-10-02 | 1997-04-10 | Duke University | Dopamine transporter knockout mice |
US6066778A (en) * | 1996-11-06 | 2000-05-23 | The Regents Of The University Of Michigan | Transgenic mice expressing APC resistant factor V |
ATE455552T1 (en) | 1997-02-14 | 2010-02-15 | American Nat Red Cross | EXPRESSION OF ACTIVE HUMAN FACTOR IX IN THE MAMMARY GLAND TISSUE OF TRANSGENIC ANIMALS |
DE69935903T2 (en) | 1998-01-08 | 2008-01-10 | Daiichi Pharmaceutical Co., Ltd. | GENUINE ANIMALS |
AU4951300A (en) | 1999-05-31 | 2000-12-18 | Chugai Research Institute For Molecular Medicine, Inc. | Lkb1 gene knockout animals |
JP2019523009A (en) * | 2016-07-29 | 2019-08-22 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | Mice having mutations leading to expression of C-terminal truncated fibrillin-1 |
CN108794631A (en) * | 2018-06-12 | 2018-11-13 | 广州血液中心 | A kind of preparation method of the anti-mouse CD36 monoclonal antibodies of mouse |
CN110384074A (en) * | 2019-07-15 | 2019-10-29 | 广州医科大学 | A kind of mouse model and its construction method of Kir7.1 gene inactivation |
-
2019
- 2019-11-05 EP EP19835940.8A patent/EP4054324A1/en active Pending
- 2019-11-05 WO PCT/US2019/059869 patent/WO2021091539A1/en unknown
- 2019-11-05 JP JP2022526031A patent/JP2023500896A/en active Pending
- 2019-11-05 AU AU2019473345A patent/AU2019473345A1/en active Pending
- 2019-11-05 CN CN201980101996.6A patent/CN114630579A/en active Pending
- 2019-11-05 CA CA3162639A patent/CA3162639A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
AU2019473345A1 (en) | 2022-05-05 |
CA3162639A1 (en) | 2021-05-14 |
CN114630579A (en) | 2022-06-14 |
JP2023500896A (en) | 2023-01-11 |
WO2021091539A1 (en) | 2021-05-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9686971B2 (en) | Methods for testing anti-thrombotic agents | |
JP5315489B2 (en) | Method for producing human IgG antibody with enhanced effector function | |
Vitiello et al. | The role of β2-microglobulin in peptide binding by class I molecules | |
Sant'Angelo et al. | The specificity and orientation of a TCR to its peptide–MHC class II ligands | |
Zhi et al. | High-resolution mapping of the polyclonal immune response to the human platelet alloantigen HPA-1a (PlA1) | |
Zhang et al. | CRISPR/Cas9-mediated conversion of human platelet alloantigen allotypes | |
US10725041B2 (en) | Method to bioengineer designer platelets using gene editing and stem cell methodologies | |
JP2019068850A (en) | Histidine engineered light chain antibodies and genetically modified non-human animals for generating the same | |
JP2017505127A (en) | High-throughput mouse model for antibody affinity optimization | |
CN103429746A (en) | ADAM6 mice | |
EP2061812A1 (en) | Method for producing antibodies | |
Parry et al. | Mouse embryogenesis requires the tissue factor extracellular domain but not the cytoplasmic domain | |
van der Schoot et al. | Noninvasive fetal blood group typing | |
EP4054324A1 (en) | A murine model of fetal/neonatal alloimmune thrombocytopenia | |
Watkins et al. | HPA-1a phenotype–genotype discrepancy reveals a naturally occurring Arg93Gln substitution in the platelet β3 integrin that disrupts the HPA-1a epitope | |
US11266129B2 (en) | Murine model of fetal/neonatal alloimmune thrombocytopenia | |
US20060134751A1 (en) | Identification of novel MS4A gene family members expressed by hematopoietic cells | |
Xu et al. | Expressional analysis of immunoglobulin D in cattle (Bos taurus), a large domesticated ungulate | |
CN111386039A (en) | Non-human animals expressing humanized C1q complexes | |
Chapel‐Fernandes et al. | Dombrock genotyping in a native Congolese cohort reveals two novel alleles | |
Morton et al. | Cloning and characterization of equine CD89 and identification of the CD89 gene in chimpanzees and rhesus macaques | |
US20090317413A1 (en) | Detection of human platelet antigen (hpa) antibodies | |
US20200332259A1 (en) | Method to bioengineer designer red blood cells using gene editing and stem cell methodologies | |
Stafford et al. | Three novel β3 domain-deletion peptides for the sensitive and specific detection of HPA-4 and six low frequency β3-HPA antibodies | |
Knutsen et al. | Evidence of functional Cd94 polymorphism in a free-living house mouse population |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20220421 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
DAV | Request for validation of the european patent (deleted) | ||
DAX | Request for extension of the european patent (deleted) | ||
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40080070 Country of ref document: HK |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
17Q | First examination report despatched |
Effective date: 20230626 |