EP3743159A2 - Methods of treating cancers with antagonistic anti-pd-1 antibodies - Google Patents

Methods of treating cancers with antagonistic anti-pd-1 antibodies

Info

Publication number
EP3743159A2
EP3743159A2 EP19707451.1A EP19707451A EP3743159A2 EP 3743159 A2 EP3743159 A2 EP 3743159A2 EP 19707451 A EP19707451 A EP 19707451A EP 3743159 A2 EP3743159 A2 EP 3743159A2
Authority
EP
European Patent Office
Prior art keywords
cancer
weeks
once
antibody
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP19707451.1A
Other languages
German (de)
French (fr)
Inventor
Edward F. Attiyeh
Kyounghwa BAE
James G. Greger
Hong Xie
Christina Lourdes MAYER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Janssen Biotech Inc
Original Assignee
Janssen Biotech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Janssen Biotech Inc filed Critical Janssen Biotech Inc
Publication of EP3743159A2 publication Critical patent/EP3743159A2/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to methods of treating cancers with antagonistic anti-PD-l antibodies, formulations of the antagonistic anti-PD-l antibodies and drug products of the anti- PD-l antibodies.
  • the immune system is tightly controlled by a network of costimulatory and co-inhibitory ligands and receptors. These molecules provide secondary signals for T cell activation and provide a balanced network of positive and negative signals to maximize immune responses against infection and tumors, while limiting immunity to self (Wang et al, (Epub Mar. 7, 2011) J Exp Med 208(3):577-92; Lepenies et al, (2008) Endocr Metab Immune Disord Drug Targets 8:279-288). Immune checkpoint therapy, targeting co-inhibitory pathways in T cells to promote antitumor immune responses, has led to advances in clinical care of cancer patients.
  • PD-l is a negative immune checkpoint molecule that suppresses CD4 + and CD8 + T cell functions in the tumor microenvironment (TME).
  • TEM tumor microenvironment
  • PD-l engagement with its ligands (PD-L1 and PD-L2) drives T cell anergy and exhaustion in tumors by inhibiting multiple pathways downstream of the T cell receptor signaling, resulting in decreased T cell survival, growth and proliferation, compromised effector function, and altered metabolism.
  • PD-l pathway blockade can reverse T cell exhaustion and stimulate anti tumor immunity.
  • the invention provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 2 a HCDR3 of SEQ ID NO: 3
  • LCDR1 light chain complementarity determining region 1
  • the invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising
  • cetrelimab between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • cetrelimab about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
  • the invention also provides a drug product comprising
  • cetrelimab between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • cetrelimab about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
  • the invention also provides a drug product comprising between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • cetrelimab about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
  • FIG. 1 shows the mean serum concentration (pg/ml) of JNJ-63723283 (cetrelimab) over time in subjects dosed 80 mg, 240 mg, 460 mg, 480 mg or 800 mg once in two weeks (q2w) or once in four weeks (q4w) as indicated.
  • the number of patients (n) dosed is shown in parenthesis.
  • FIG. 2 shows the percentage (%) of PD-l receptor occupancy of JNJ-63723283
  • cetrelimab on CD3 + circulating T cells over time (as indicated by administered doses 1-39) in subjects dosed 240 mg cetrelimab q2w. Pre: before dosing; EOI+2H: End of infusion plus 2 hours. EOI+1H: end of infusion plus 1 hour. EOT: end of treatment.
  • FIG. 3 shows the percentage (%) of PD-l receptor occupancy of JNJ-63723283
  • cetrelimab on CD3 + circulating T cells over time (as indicated by administered doses 1-14) in subjects dosed 480 mg cetrelimab q4w. Pre: before dosing; EOI+2H: End of infusion plus 2 hours. EOI+1H: end of infusion plus 1 hour. EOT: end of treatment.
  • FIG. 4 shows the time course of T cell activation in patient receiving 240 mg once every two weeks (Q2W) (solid line) or 480 mg once every four weeks (Q4W) (dashed line) JNJ- 63723283 (cetrelimab). Ratio of 1 indicates maximum T cell activation.
  • transitional terms“comprising,”“consisting essentially of,” and“consisting of’ are intended to connote their generally accepted meanings in the patent vernacular; that is, (i) “comprising,” which is synonymous with“including,”“containing,” or“characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps; (ii) “consisting of’ excludes any element, step, or ingredient not specified in the claim; and (iii) “consisting essentially of’ limits the scope of a claim to the specified materials or steps“and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention.
  • Embodiments described in terms of the phrase“comprising” (or its equivalents) also provide as embodiments those independently described in terms of“consisting of’ and“consisting essentially of.”
  • Antagonist refers to an anti-PDl antibody which upon binding to PD-1 suppresses at least one biological activity mediated by PD-1 ligand PD-L1 or PD-L2.
  • the anti-PD-1 antibody is an antagonist when the at least one biological activity mediated by PD-L1 or PD-L2 is suppressed by at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%,
  • PD-1 refers to human programmed cell death protein 1, PD-l.
  • PD-l is also known as CD279 or PDCD1.
  • the amino acid sequence of the mature human PD-l (without signal sequence) is shown in SEQ ID NO: 11. The extracellular domain spans residues 1-150, the transmembrane domain spans residues 151-171 and the cytoplasmic domain spans residues 172-
  • Antibodies is meant in a broad sense and includes immunoglobulin molecules belonging to any class, IgA, IgD, IgE, IgG and IgM, or sub-class IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4 and including either kappa (K) and lambda (l) light chain.
  • Antibodies include monoclonal antibodies, full length antibodies, antigen binding fragments, bispecific or multispecific antibodies, dimeric, tetrameric or multimeric antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding fragment of the required specificity.
  • “Full length antibodies” are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CH1, hinge, CH2 and CH3).
  • Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
  • the VH and the VL may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR).
  • CDR complementarity determining regions
  • Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • Antibodies include antibodies generated using various technologies, including antibodies generated from immunized mice or rat or identified from phage or mammalian display libraries as described herein.
  • CDR complementarity determining regions
  • LCDR2 and“LCDR3” as used herein includes CDRs defined by any of the methods described supra, Kabat, Chothia, IMGT or AbM, unless otherwise explicitly stated in the specification.
  • Antigen binding fragment refers to a portion of an immunoglobulin molecule that retains the antigen binding properties of the parental full length antibody.
  • Exemplary antigen binding fragments are heavy chain complementarity determining regions (HCDR) 1, 2 and/or 3, light chain complementarity determining regions (LCDR) 1, 2 and/or 3, the VH, the VL, the VH and the VL, Fab, F(ab')2, Fd and Fv fragments as well as domain antibodies (dAb) consisting of either one VH domain or one VL domain.
  • the VH and the VL domains may be linked together via a synthetic linker to form various types of single chain antibody designs in which the VH/VL domains pair intramolecularly, or intermolecularly in those cases when the VH and VL domains are expressed by separate chains, to form a monovalent antigen binding site, such as single chain Fv (scFv) or diabody; described for example in Int. Pat. Publ. No. W01998/44001, Int. Pat. Publ. No. WO1988/01649; Int. Pat. Publ. No. WO1994/13804; Int. Pat. Publ. No. W01992/01047.
  • scFv single chain Fv
  • Humanized antibody refers to an antibody in which CDR sequences are derived from non-human species and the frameworks are derived from human immunoglobulin sequences. Humanized antibody may include substitutions in the framework so that the framework may not be an exact copy of expressed human immunoglobulin or human immunoglobulin germline gene sequences. Antibodies in which at least one CDR is derived from non-human species and at least one framework is derived from human immunoglobulin sequences are humanized antibodies. Humanized antibody may include substitutions in the frameworks so that the frameworks may not be exact copies of expressed human immunoglobulin or human immunoglobulin germline gene sequences.
  • Human antibody refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibody are derived from human germline immunoglobulin sequences. If the antibody contains a constant region or a portion of the constant region, the constant region is also derived from human germline immunoglobulin sequences.
  • Human antibody comprises heavy or light chain variable regions that are“derived from” human germline immunoglobulin sequences if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes.
  • Such exemplary systems are human immunoglobulin gene libraries displayed on phage or mammalian cells, and transgenic non-human animals such as mice, rats or chicken carrying human immunoglobulin loci.
  • “Human antibody” typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to differences between the systems used to obtain the antibody and human immunoglobulin loci, introduction of naturally occurring somatic mutations, intentional introduction of substitutions into the framework or the CDRs.
  • “Human antibody” is typically about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
  • “human antibody” may contain consensus framework sequences derived from human framework sequence analyses, for example as described in (Knappik el al. (2000) JMol Biol 296: 57-86), or synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in (Shi et al. (2010) J Mol Biol 397: 385-96), and in Int. Patent Publ. No.
  • “Monoclonal antibody” refers to an antibody population with single amino acid composition in each antibody chain except for possible well known alterations such as removal of C-terminal lysine from the antibody heavy chain or alterations due to post-translational modification(s) of amino acids, such as methionine oxidation or asparagine or glutamine deamidation.
  • Monoclonal antibodies typically specifically bind one antigenic epitope, except that bispecific or multispecific monoclonal antibodies specifically bind two or more distinct antigenic epitopes.
  • Monoclonal antibodies may have heterogeneous glycosylation within the antibody population.
  • Monoclonal antibody may be monospecific or multispecific, or monovalent, bivalent or multivalent. A bispecific antibody is included in the term monoclonal antibody.
  • Isolated refers to a homogenous population of molecules (such as synthetic polynucleotides or a protein such as an antibody) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step.
  • molecules such as synthetic polynucleotides or a protein such as an antibody
  • isolated antibody refers to an antibody that is substantially free of other cellular material and/or chemicals and encompasses antibodies that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.
  • A“cancer cell” or a“tumor cell” refers to a cancerous, pre-cancerous or transformed cell, either in vivo, ex vivo, or in tissue culture, that has spontaneous or induced phenotypic changes. These changes do not necessarily involve the uptake of new genetic material. Although transformation may arise from infection with a transforming virus and incorporation of new genomic nucleic acid, uptake of exogenous nucleic acid or it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene.
  • Transformation/cancer is exemplified by morphological changes, immortalization of cells, aberrant growth control, foci formation, proliferation, malignancy, modulation of tumor specific marker levels, invasiveness, tumor growth in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo (Freshney, Culture of Animal Cells: A Manual of Basic Technique (3rd ed. 1994)).
  • Cancer refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division and growth results in the formation of malignant tumors that invade neighboring tissues and may also metastasize to distant parts of the body through the lymphatic system or bloodstream. A“cancer” or“cancer tissue” can include a tumor.
  • “About” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. Unless explicitly stated otherwise within the Examples or elsewhere in the Specification in the context of a particular assay, result or embodiment,“about” means within one standard deviation per the practice in the art, or a range of up to 5%, whichever is larger.
  • Subject includes any human or nonhuman animal.
  • Nonhuman animal includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows, chickens, amphibians, reptiles, etc.
  • the terms“subject” and“patient” can be used interchangeably herein.
  • Treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as growth and/or spreading of tumor cells.
  • Beneficial or desired clinical results include alleviation of symptoms, shrinkage of tumor size, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
  • Treatment can also mean prolonging survival as compared to expected survival if a subject was not receiving treatment.
  • Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
  • “Therapeutically effective amount” refers to an amount effective, at doses and for periods of time necessary, to achieve a desired therapeutic result.
  • a therapeutically effective amount may vary depending on factors such as the disease state, age, sex, and weight of the individual, and the ability of a therapeutic or a combination of therapeutics to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic or combination of therapeutics that include, for example, improved well-being of the patient.
  • Anti-PD-1 antibody refers to an antibody that specifically binds PD-l.
  • “Specifically binds”,“specific binding” or“binds” refer to antibody binding to an antigen (e.g. PD-l) or an epitope within the antigen with greater affinity than for other antigens.
  • the antibody binds to the antigen or the epitope within the antigen with an equilibrium dissociation constant (K D ) of about lxlO "8 M or less, for example about lxlO "9 M or less, about lxlO "10 M or less, about lxlO "1 1 M or less, or about lxlO '12 M or less, typically with a K D that is at least one hundred-fold less than its K D for binding to a non-specific antigen (e.g., BSA, casein).
  • K D equilibrium dissociation constant
  • the K D may be measured using standard procedures.
  • Antibodies that specifically bind to the antigen or the epitope within the antigen may, however, have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset).
  • homologs such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset).
  • Dosage refers to the information of the amount of the therapeutic to be taken by the subject and the frequency of the number of times the therapeutic is to be taken by the subject.
  • Dose refers to the amount or quantity of the therapeutic to be taken each time.
  • Relapsed refers to the return of a disease or the signs and symptoms of a disease after a period of improvement after prior treatment with a therapeutic.
  • Refractory refers to a disease that does not respond to a treatment.
  • a refractory disease can be resistant to a treatment before or at the beginning of the treatment, or a refractory disease can become resistant during a treatment.
  • Drug substance or“DS” refers to any substance or mixture of substances intended to be used in the manufacture of a drug (medicinal) product and that, when used in the production of a drug, becomes an active ingredient of the drug product. Such substances are intended to furnish pharmacological activity or other direct effect in the diagnosis, cure, mitigation, treatment, or prevention of disease or to affect the structure or function of the body.
  • Drug product or“DP” refers to a finished dosage form, for example, a tablet, capsule or solution that contains an active pharmaceutical ingredient (e.g. drug substance), generally, but not necessarily, in association with inactive ingredients.
  • active pharmaceutical ingredient e.g. drug substance
  • Wild-type BRAF refers to the serine/threonine protein kinase B-raf having an amino acid sequence shown in UniProt accession number P15056.
  • “Mutant” refers to a polypeptide or a polynucleotide that differs from a reference polypeptide or a reference polynucleotide by one or more modifications, for example one or more substitutions, insertions or deletions.
  • the reference BRAF polypeptide is the wild- type BRAF. Mutations are indicated using well-known numbering system, e.g. V600E refers to a substitution of glutamic acid for valine at position 600.
  • Immuno condition encompasses, e.g., pathological inflammation, an inflammatory disorder, and an autoimmune disorder or disease.
  • Immuno condition also refers to infections, persistent infections, and proliferative conditions, such as cancer, tumors, and angiogenesis, including infections, tumors, and cancers that resist eradication by the immune system.
  • the invention provides a method of treating a cancer, comprising providing an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks to a subject diagnosed with the cancer, and administering the antagonistic anti-PD-l antibody to the subject diagnosed with the cancer.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR3 of SEQ ID NO: 6
  • the invention also provides a method of treating an immune condition, comprising providing an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks to a subject diagnosed with the immune condition, and administering the antagonistic anti-PD-l antibody to the subject diagnosed with the cancer.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • the immune condition is a cancer.
  • the immune condition is a viral infection, a persistent viral infection, inflammation, an inflammatory disorder or an autoimmune disorder or disease.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at a dosage of about 80 mg, about 160 mg, about 240 mg, about 320 mg, about 400 mg, about 480 mg, about 560 mg, about 720 mg, about 800 mg, about 880 mg or about 960 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating an immune condition, comprising administering to a subject diagnosed with the immune condition an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 2 a HCDR3 of SEQ ID NO: 3
  • LCDR1 light chain complementarity determining region 1
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every two weeks. In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every three weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every four weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every five weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every six weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every two weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every three weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every four weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every five weeks.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every six weeks.
  • Diagnosis and staging of cancers is conducted by an oncologist using established diagnostic criteria.
  • the cancer is a solid tumor. In some embodiments, the cancer is an advanced solid tumor. “Advanced solid tumor” refers to metastatic, unresectable, Stage III or Stage IV solid tumor.
  • the cancer is selected from the group consisting of a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, a bladder cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-
  • the cancer is selected from the group consisting of a thymus cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a melanoma, a bladder cancer, a renal cancer, a gastric cancer, an esophageal cancer or a colorectal cancer (CRC).
  • NSCLC non-small cell lung cancer
  • SCLC small cell lung cancer
  • CRC colorectal cancer
  • the cancer is the lung cancer.
  • the cancer is the NSCLC
  • the cancer is the melanoma.
  • the cancer is the head and neck cancer.
  • the cancer is the bladder cancer.
  • the cancer is the gastrointestinal cancer.
  • the cancer is the gastric cancer.
  • the cancer is the gastro-esophageal junction cancer.
  • the cancer is the esophageal cancer.
  • the cancer is the liver cancer.
  • the cancer is the CRC.
  • the cancer is the colon cancer.
  • the cancer is the gallbladder cancer.
  • the cancer is the biliary tract cancer.
  • the cancer is the ovarian cancer.
  • the cancer is the fallopian tube cancer.
  • the cancer is the cervical cancer.
  • the cancer is the peritoneal cancer.
  • the cancer is the endometrial cancer.
  • the cancer is the SCLC.
  • the cancer is the breast cancer.
  • the cancer is the pancreatic cancer.
  • the cancer is the renal cell carcinoma.
  • the cancer is the Merkel cell carcinoma.
  • the cancer is the PMBCL.
  • the cancer is the Hodgkin’s lymphoma. In some embodiments, the cancer is the non-Hodgkin’s lymphoma.
  • the cancer is the DLBLC.
  • the cancer is the multiple myeloma.
  • the cancer is the glioblastoma.
  • the cancer is the urothelial cancer.
  • the cancer is the salivary cancer.
  • the cancer is the mesothelioma.
  • the cancer is the anal cancer.
  • the cancer is the prostate cancer.
  • the prostate cancer is an adenocarcinoma.
  • the prostate cancer is a metastatic prostate cancer.
  • the prostate cancer has metastasized to rectum, lymph node or bone, or any combination thereof.
  • the prostate cancer is relapsed or refractory prostate cancer.
  • the prostate cancer is a castration resistant prostate cancer.
  • the prostate cancer is sensitive to androgen deprivation therapy.
  • the prostate cancer is insensitive to androgen deprivation therapy.
  • the cancer is the CSCC.
  • the cancer is the basal cell carcinoma.
  • the cancer is the thymus cancer.
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks, wherein the subject is PD-l axis naive.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 2 a HCDR3 of SEQ ID NO: 3
  • LCDR1 light chain complementarity determining region 1
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg, wherein the subject is PD-l axis naive.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks, wherein the subject is PD-l axis naive and has received at least one prior therapeutic for the treatment of the cancer.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR3 of
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg, wherein the subject has received one, two, three or more prior therapeutics to treat the cancer.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg, wherein the subject is PD-l axis naive and has received one, two, three or more prior therapeutics to treat the cancer.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • PD-l axis naive refers to a subject who has not been treated with PD-l, PD-L1 or PD- L2 antagonists.
  • exemplary PD-l, PD-L1 or PD-L2 antagonists are nivolumab (OPDIVO ® ), pembrolizumab (KEYTRUDA ® ), cemiplimab (Libtayo ® ), sintilimab, tislelizumab, tripolibamab durvalumab (IMFINZI ® ), atezolizumab (TECENTRIQ ® ), avelumab (BAVENCIO ® ) or envafolimab, or any other PD-l, PD-L1 or PD-L2 antagonist. Additional such antagonists are known and include those listed for example at Citeline Pharmalntelligence website.
  • the cancer is PD-L1 positive.
  • the cancer is PD-L1 high. In some embodiments, PD-L1 expression in the cancer is undetermined.
  • PD-L1 positive refers to a tumor in which at least about 1% of the cells in a sample obtained from the tumor (such as a paraffin embedded formalin fixed tumor tissue sample) comprising of tumor cells and tumor-infiltrating inflammatory cells stain positive for PD-L1 surface expression.
  • PD-L1 high refers to a tumor in which at least 50% of the tumor cells or tumor- infiltrating inflammatory cells in a sample obtained from the tumor (such as a paraffin embedded formalin fixed tumor tissue sample) stain positive for PD-L1 surface expression.
  • a sample obtained from the tumor such as a paraffin embedded formalin fixed tumor tissue sample
  • kits from for example from Ventana, DAKO or PharmDx may be used to assess PD-L1 positive or PD-L1 high status.
  • PD-L1 expression on tumor cell membrane is evaluated using anti-PD-Ll antibodies such as 28-8, 22C3, SP142, SP263 and 73-10, and a Tumor Proportion Score (TPS) indicative of percentage of PD-L1 positive tumor cells is calculated.
  • TPS Tumor Proportion Score
  • PD-L1 expression in the cancer is undetermined refers to a tumor in which PD-L1 surface expression has not been assessed.
  • the cancer expresses a mutant BRAF.
  • the mutant BRAF comprises a V600E mutation.
  • the cancer expresses a wild-type BRAF.
  • the mutant BRAF comprises one or more mutations selected from the group consisting of: V600E, V600L, R4621, 1463 S, G464E, G464R, G464V, G466A, G469A, N581 S, E586K, F595L, L597Q, L597R, L597S, L597V, A598V, T599E, V600R, K601E, S602D and A728V, and any combination thereof (see e.g. Int. Pat. Publ. No.
  • Mitogen-activated protein kinase (MAPK) or RAS/RAF/MEK/ERK signaling is responsible for several cell signaling pathways involved in control of proliferation
  • Activating mutations of the serine-threonine kinase BRAF gene is the most frequent genetic alteration in melanomas; the BRAF mutation is observed in about 50% of skin melanoma and in about 10-20% of mucosal melanoma cases (MacKiewicz and
  • BRAF inhibitors such as vemurafenib, dabrafenib and encorafenib
  • MEK inhibitor such as cobimetinib, trametinib or binimetinib may be combined to the treatment regimen.
  • MEK inhibitors have also been tested as monotherapy in BRAF mutant subjects.
  • BRAF status may be assessed for example from tumor biopsy samples using known methods such as sequencing.
  • the subject has received or is ineligible to receive at least one prior therapeutic to treat the cancer.
  • the subject has received one, two, three or more prior therapeutics to treat the cancer.
  • Therapeutics to treat various cancers include surgery, radiation therapy, chemotherapy, hormone therapy, immunotherapy, targeted therapy or any combination thereof.
  • Therapeutics to treat lung cancer include methotrexate, paclitaxel (ABRAXANE ® ), afatinib (GILOTRIF ® ), everolimus (AFINITOR ® ), alectinib (ALECENSA ® ), pemetrexed disodium (ALIMTA ® ), bevacizumab (AVASTIN ® ), carboplatin, ceritinib (ZYKADIA ® ), crizotinib (XALKORI ® ), ramucirumab (CYRAMZA ® ), docetaxel, everolimus (AFINITOR ® ), gefitinib (IRESSA ® ), gemcitabine hydrochloride (GMEZAR ® ), pembrolizumab (KEYTRUDA ® ), mechlorethamine hydrochloride (MUSTARGEN ® ), vinore
  • ABRAXANE ® paclitaxel
  • GLOTRIF ® afatin
  • BRAF/MEK inhibitor or interferon alpha An exemplary anti-CTLA4 antibody is ipilimumab (YERVOY ® ).
  • Exemplary BRAF/MEK inhibitors are vemurafenib (ZELBORAF ® ), dabrafenib, encorafenib, cobimetinib (COTELLIC ® ), trametinib (MEKINIST ® ), and binimetinib.
  • Therapeutics to treat melanoma include Aldesleukin, cobimetinib (COTELLIC ® ), dabrafenib (TAFINLAR ® ), dacarbazine (DTIC-Dome ® ), talimogene laherparepvec (IMLYGIC ® ), ipilimumab (YERVOY ® ), pembrolizumab (KEYTRUDA ® ), trametinib (MEKINIST ® ), nivolumab (OPDIVO ® ), Peginterferon Alfa-2b (PEG-INTRON ® , SYLATRON ® ), recombinant interferon Alfa-2b and vemurafenib (ZELBORAF ® ).
  • Therapeutics to treat a bladder cancer include surgery, chemotherapy (such as cisplatin, gemcitabine, carboplatin, methotrexate, vinblastine, doxorubicin or any combination thereof), immunotherapy (such as weakened bacterium bacillus Calmette-Guerin (BCG), interferon, atezolizumab (TECENTRIQ ® ), nivolumab (OPDIVO ® ), durvalumab (IMFINZI ® ), avelumab (BAVENCIO ® ), or pembrolizumab (KEYTRUDA ® ) or radiation therapy.
  • chemotherapy such as cisplatin, gemcitabine, carboplatin, methotrexate, vinblastine, doxorubicin or any combination thereof
  • immunotherapy such as weakened bacterium bacillus Calmette-Guerin (BCG), interferon, atezolizumab (TECENTRIQ ® ), nivolumab (OPD
  • Therapeutics to treat a renal cancer include everolimus (AFINITOR ® ), aldesleukin, bevacizumab (AVASTIN ® ), axitinib (INLYTA ® ), cabozantinib-S-Malate (CABOMETYX ® ), aldesleukin (PROLEUKIN ® ), lenvatinib mesylate (LENVIMA ® ), sorafenib tosylate (NEXAVAR ® ), nivolumab (OPDIVO ® ), pazopanib hydrochloride, sorafenib tosylate, sunitinib (SUTENT ® ), temsirolimus (TORISEL ® ) and pazopanib hydrochloride (VOTRIENT ® ).
  • Therapeutics to treat a gastric cancer include surgery or chemotherapy (such as 5- fluorouracil or capecitabine, irinotecan, docetaxel or paclitaxel, or any combination thereof).
  • Therapeutics to treat an esophageal cancer include surgery, endoscopic therapy, radiation therapy, chemotherapy or targeted immunotherapy.
  • Therapeutics to treat a colorectal cancer include 5-fluorouracil and leucovorin, capecitabine (XELODA ® ), irinotecan (CAMPTOSAR ® ), cetuximab (ERBITUX ® ), panitumumab (VECTIBIX ® ), pegorafenib (STIVARGA ® ), a chemotherapy regimen of trifluridine and tiptracil (LONSURF ® ), FOLFOX: chemotherapy regimen of leucovorin, 5-fluorouracil and oxaliplatin (ELOXATIN ® ), FOLFIRI: chemotherapy regimen of leucovorin, 5-fluorouracil, and irinotecan (CAMPTOSAR ® ), CapeOX: chemotherapy regimen of capecitabine (XELODA®) and oxaliplatin (ELOXATIN ® ), FOLFOXIRI: chemotherapy regimen of leucovorin, 5-fluorour
  • Therapeutics to treat thymus cancer include surgery, radiation therapy, a chemotherapy (such as carboplatin, cisplatin, cyclophosphamide, doxorubicin, etoposide, ifosfamide, octreotide, paclitaxel or pemetrexed, or any combination thereof) or a hormone therapy (such as
  • Radiation therapy includes external beam radiation, intensity modulated radiation therapy (IMRT), focused radiation, and any form of radiosurgery including Gamma Knife, Cyberlaiife, Linac, and interstitial radiation (for example implanted radioactive seeds, GliaSite balloon), and/or with surgery.
  • IMRT intensity modulated radiation therapy
  • focused radiation and any form of radiosurgery including Gamma Knife, Cyberlaiife, Linac, and interstitial radiation (for example implanted radioactive seeds, GliaSite balloon), and/or with surgery.
  • Stereotactic radiosurgery involves the precise delivery of radiation to a tumorous tissue, while avoiding the surrounding non-tumorous, normal tissue.
  • the dosage of radiation applied using stereotactic radiosurgery may vary typically from 1 Gy to about 30 Gy, and may encompass intermediate ranges including, for example, from 1 to 5, 10, 15, 20, 25, up to 30 Gy in dosage. Because of noninvasive fixation devices, stereotactic radiation need not be delivered in a single treatment. The treatment plan may be reliably duplicated day-to-day, thereby allowing multiple fractionated dosages of radiation to be delivered.
  • stereotactic radiosurgery When used to treat a tumor over time, the radiosurgery is referred to as“fractionated stereotactic radiosurgery” or FSR.
  • stereotactic radiosurgery refers to a one-session treatment. Fractionated stereotactic radiosurgery may result in a high therapeutic ratio, i.e., a high rate of killing of tumor cells and a low effect on normal tissue.
  • the tumor and the normal tissue respond differently to high single dosages of radiation vs. multiple smaller dosages of radiation.
  • Single large dosages of radiation may kill more normal tissue than several smaller dosages of radiation may. Accordingly, multiple smaller dosages of radiation can kill more tumor cells while sparing normal tissue.
  • the dosage of radiation applied using fractionated stereotactic radiation may vary from range from 1 Gy to about 50 Gy, and may encompass intermediate ranges including, for example, from 1 to 5, 10, 15, 20, 25, 30,40, up to 50 Gy in hypofractionated dosages.
  • Intensity- modulated radiation therapy may also be used.
  • IMRT is an advanced mode of high-precision three-dimensional conformal radiation therapy (3DCRT), which uses computer-controlled linear accelerators to deliver precise radiation dosages to a malignant tumor or specific areas within the tumor, the profile of each radiation beam is shaped to fit the profile of the target from a beam's eye view (BEV) using a multileaf collimator (MLC), thereby producing a number of beams.
  • 3DCRT three-dimensional conformal radiation therapy
  • IMRT allows the radiation dosage to conform more precisely to the three-dimensional (3-D) shape of the tumor by modulating the intensity of the radiation beam in multiple small volumes. Accordingly, IMRT allows higher radiation dosages to be focused to regions within the tumor while minimizing the dosage to surrounding normal critical structures. IMRT improves the ability to conform the treatment volume to concave tumor shapes, for example, when the tumor is wrapped around a vulnerable structure, such as the spinal cord or a major organ or blood vessel.
  • Suitable radiation sources for use as a cell conditioner include both solids and liquids.
  • the one, two, three or more prior therapeutics to treat the cancer are an anti-CTLA4 antibody, ipilimumab (YERVOY ® ), BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
  • BRAF/MEK inhibitor refers to a molecule, such as a small molecule, that inhibits at least one biological activity mediated by BRAF and/or MEK.
  • the inhibition may be at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than in the absence of the inhibitor (e.g., negative control), or when the inhibition is statistically significant when compared to a control.
  • Typical biological activities mediated by BRAF and/or MEK are protein phosphorylation, cell proliferation, cell survival and apoptosis, which can be measured using standard methods.
  • Exemplary BRAF inhibitors are vemurafenib (ZELBORAF ® ), pazopanib, dabrafenib and encorafenib.
  • Exemplary MEK inhibitors are cobimetinib (COTELLIC ® ), trametinib (MEKINIST ® ), and binimetinib.
  • the subject is resistant, refractory or resistant and refractory to the one, two, three or more prior therapeutics to treat the cancer, or any combination thereof.
  • the subject is resistant, refractory or resistant and refractory to an anti-CTLA4 antibody, ipilimumab, BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
  • Symptoms that may be associated with relapse or resistance are, for example, a decline or plateau of the well-being of the patient or re-establishment or worsening of various symptoms associated with solid tumors, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
  • “Pharmaceutically acceptable excipients” refer to solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, such as salts, buffers, antioxidants, saccharides, aqueous or non- aqueous carriers, preservatives, wetting agents, surfactants or emulsifying agents, or
  • Exemplary buffers that may be used are acetic acid, citric acid, formic acid, succinic acid, phosphoric acid, carbonic acid, malic acid, aspartic acid, histidine, boric acid, Tris buffers, HEPPSO and HEPES.
  • antioxidants that may be used are ascorbic acid, methionine, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite, lecithin, citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol and tartaric acid.
  • amino acids that may be used are histidine, isoleucine, methionine, glycine, arginine, lysine, L-leucine, tri-leucine, alanine, glutamic acid, L-threonine, and 2-phenylamine.
  • Exemplary surfactants that may be used are polysorbates (e.g., polysorbate-20 or polysorbate-80); polyoxamers (e.g., poloxamer 188); Triton; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g., lauroamidopropyl); myristamidopropyl-, palmidopropyl-, or isost
  • preservatives that may be used are phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride, alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydro acetate and thimerosal, or mixtures thereof.
  • Exemplary saccharides that may be used are monosaccharides, disaccharides, trisaccharides, polysaccharides, sugar alcohols, reducing sugars, nonreducing sugars such as glucose, sucrose, trehalose, lactose, fructose, maltose, dextran, glycerin, dextran, erythritol, glycerol, arabitol, sylitol, sorbitol, mannitol, mellibiose, melezitose, raffinose, mannotriose, stachyose, maltose, lactulose, maltulose, glucitol, maltitol, lactitol or iso-maltulose.
  • Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • nontoxic inorganic acids such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like
  • nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
  • Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
  • An exemplary salt is sodium chloride.
  • the amounts of pharmaceutically acceptable carrier(s) in the pharmaceutical compositions may be determined experimentally based on the activities of the carrier(s) and the desired characteristics of the formulation, such as stability and/or minimal oxidation.
  • the pharmaceutical composition comprises histidine.
  • the pharmaceutical composition comprises histidine at a concentration of from about 1 mM to about 50 mM.
  • the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 50 mM.
  • the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 30 mM.
  • the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 20 mM. In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 15 mM.
  • the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 10 mM.
  • the pharmaceutical composition comprises histidine at a concentration of about 1 mM, about 2 mM, about 3 mM, about 4 mM, about 5 mM, about 6 mM, about 7 mM, about 8 mM, about 9 mM, about 10 mM, about 11 mM, about 12 mM, about 13 mM, about 14 mM, about 15 mM, about 16 mM, about 17 mM, about 18 mM, about 19 mM, about 20 mM, about 21 mM, about 22 mM, about 23 mM, about 24 mM, about 25 mM, about 26 mM, about 27 mM, about 28 mM, about 29 mM, about 30 mM, about 31 mM, about 32 mM, about 33 mM, about 34 mM, about 35 mM, about 36 mM, about 37 mM, about 38 mM, about 39 mM, about 40 mM, about 31
  • the pharmaceutical composition comprises histidine at a concentration of about 10 mM.
  • the pharmaceutical composition comprises sucrose.
  • the pharmaceutical composition comprises sucrose at a concentration of from about 1% (w/v) to about 20% (w/v).
  • the pharmaceutical composition comprises sucrose at a concentration of from about 2% (w/v) to about 18% (w/v).
  • the pharmaceutical composition comprises sucrose at a concentration of from about 4% (w/v) to about 16% (w/v).
  • the pharmaceutical composition comprises sucrose at a concentration of from about 6% (w/v) to about 14% (w/v).
  • the pharmaceutical composition comprises sucrose at a concentration of from about 6% (w/v) to about 12% (w/v).
  • the pharmaceutical composition comprises sucrose at a concentration of from about 6% (w/v) to about 10% (w/v).
  • the pharmaceutical composition comprises sucrose at a concentration of about 1% (w/v), about 2% (w/v), about 3% (w/v), about 4% (w/v), about 5% (w/v), about 6% (w/v), about 7% (w/v), about 8% (w/v), about 9% (w/v), about 10% (w/v), about 11% (w/v), about 12% (w/v), about 13% (w/v), about 14% (w/v), about 15% (w/v), about 16% (w/v), about 17% (w/v), about 18% (w/v), about 19% (w/v) or about 20% (w/v), In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of about 8% (w/v).
  • the pharmaceutical composition comprises polysorbate-20.
  • the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of from about 0.01% (w/v) to about 0.1% (w/v).
  • the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of from about 0.01% (w/v) to about 0.08% (w/v).
  • the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of from about 0.02% (w/v) to about 0.06% (w/v).
  • the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of about 0.01% (w/v), about 0.02% (w/v), about 0.03% (w/v), about 0.04% (w/v), about 0.05% (w/v), about 0.06% (w/v), about 0.07% (w/v), about 0.08% (w/v), about 0.09% (w/v) or about 0.1% (w/v).
  • PS- 20 polysorbate-20
  • the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of about 0.04% (w/v).
  • the pharmaceutical composition comprises EDTA.
  • the pharmaceutical composition comprises EDTA at a concentration of from about 1 pg/ml to about 50 pg/ml.
  • the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 50 pg/ml.
  • the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 30 pg/ml.
  • the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 20 pg/ml.
  • the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 15 pg/ml.
  • the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 10 pg/ml.
  • the pharmaceutical composition comprises EDTA at a concentration of about 1 pg/ml, about 2 pg/ml, about 3 pg/ml, about 4 pg/ml, about 5 pg/ml, about 6 pg/ml, about 7 pg/ml, about 8 pg/ml, about 9 pg/ml, about 10 pg/ml, about 11 pg/ml, about 12 pg/ml, about 13 pg/ml, about 14 pg/ml, about 15 pg/ml, about 16 pg/ml, about 17 pg/ml, about 18 pg/ml, about 19 pg/ml, about 20 pg/ml, about 21 pg/ml, about 22 pg/ml, about 23 pg/ml, about 24 pg/ml, about 25 pg/ml, about 26 pg/ml, about 27 p
  • the pharmaceutical composition comprises EDTA at a concentration of about 20 pg/ml.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, histidine, sucrose, polysorbate-20 and EDTA.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided for administration as a lyophilized formulation comprising between about 90 mg and about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients. In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
  • the lyophilized formulation once reconstituted, comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the pharmaceutical composition is a liquid.
  • the pharmaceutical composition is a frozen liquid.
  • the pharmaceutical composition is a lyophilized powder.
  • the pharmaceutical composition is provided in a volume of between about 1 ml to about 20 ml.
  • the pharmaceutical composition is provided in a volume of about 1 ml, about 2 ml, about 3 ml, about 4 ml, about 5 ml, about 6 ml, about 7 ml, about 8 ml, about 9 ml, about 10 ml, about 11 ml, about 12 ml, about 13 ml, about 14 ml, about 15 ml, about 16 ml, about 17 ml, about 18 ml, about 19 ml or about 20 ml.
  • the pharmaceutical composition is provided or reconstituted in a volume of about 3 ml.
  • the pharmaceutical composition is provided or reconstituted in a volume of about 3.3 ml.
  • the pharmaceutical composition is provided or reconstituted in a volume of about 8 ml.
  • the pharmaceutical composition is provided or reconstituted in a volume of about 8.6 ml.
  • the pharmaceutical composition is provided or reconstituted in a volume of about 8.8 ml.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5 in a volume of about 3.3 ml.
  • the antagonistic anti-PD-l antibody is cetrelimab.
  • Cetrelimab is an IgG4/K antibody characterized by following amino acid sequences: the HCDR1 of SEQ ID NO: 1, the HCDR2 of SEQ ID NO: 2, the HCDR3 of SEQ ID NO: 3, the LCDR1 of SEQ ID NO: 4, the LCDR2 of SEQ ID NO: 5, the LCDR6 of SEQ ID NO: 6, the VH of SEQ ID NO: 7, the VL of SEQ ID NO: 8, the HC of SEQ ID NO: 9 and the LC of SEQ ID NO: 10.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients that upon reconstitution into about 3.3 ml comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the antagonistic anti-PD-l antibody is cetrelimab.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients that upon reconstitution into about 8.6 ml comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the antagonistic anti-PD-l antibody is cetrelimab.
  • Lyophilization refers to a process by which the material to be dried is first frozen and then the ice or frozen solvent is removed by sublimation in a vacuum environment.
  • An excipient may be included in pre-lyophilized formulations to enhance stability of the lyophilized product upon storage.
  • “Reconstitute”,“reconstituted” or“reconstitution” refers to dissolving the lyophilized formulation in a diluent so that the protein in the lyophilized formulation is dispersed in the reconstituted formulation.
  • the reconstituted formulation is suitable for administration, e.g. parenteral administration), and may optionally be suitable for subcutaneous administration.
  • the diluent is sterile water for injection (sWFI).
  • “Pharmaceutical composition”,“pharmaceutical formulation“or“formulation” refers to a combination of an active ingredient (e.g. the anti-PD-l antibody) and one or more excipients in either liquid or solid (e.g. lyophilized) form.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by an intravenous infusion. In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is diluted into a volume of between about 100 ml and 1000 ml prior to administration.
  • duration of the intravenous infusion is between about 20 minutes and about 80 minutes.
  • duration of the intravenous infusion is about 20, about 30, about 40, about 50, about 60, about 70 or about 80 minutes.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by one or more subcutaneous injections.
  • the invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks, wherein the subject is PD-l axis naive, has received and/or is ineligible for at least one prior therapeutic for the treatment of the cancer, or any combination thereof.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • the method achieves an overall response rate (ORR) of at least 15% in a group of subjects diagnosed with the cancer.
  • ORR is defined as a percentage of subjects achieving partial response (PR) or complete response (CR).
  • the ORR of at least about 15% is achieved after a median duration of treatment of about 1 1 ⁇ 2 months or more.
  • the ORR of at least about 15% is achieved after a median duration of treatment of about 1 months or more, about 2 months or more, about 3 months or more, about 4 months or more, about 5 months or more, about 6 months or more, about 7 months or more, about 8 months or more, about 9 months or more, about 10 months or more, about 11 months or more, or about 12 months or more.
  • the method achieves an ORR of at least about 19% in the group of subjects diagnosed with the cancer.
  • the cancer is the NSCLC.
  • the method achieves an ORR of at least about 30% in a group of subjects diagnosed with PD-L1 high NSCLC or an ORR of at least about 25% in a group of subjects whose PD-L1 expression in the cancer is undetermined.
  • the method achieves an ORR of at least about 35% in the group of subjects diagnosed with PD-L1 high NSCLC.
  • the cancer is the melanoma.
  • the method achieves or an ORR of at least about 25% in a group of subjects diagnosed with melanoma.
  • the melanoma is a non-uveal melanoma.
  • the method achieves an ORR of at least about 30% in a group of subjects diagnosed with the non-uveal melanoma.
  • the method achieves an ORR of at least about 35% in a group of subjects diagnosed with MSI-H CRC.
  • the method achieves an ORR of at least about 35% in a group of subjects diagnosed with dMMR CRC.
  • the invention also provides a method of treating a colorectal cancer (CRC), comprising administering to a subject diagnosed with the CRC an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the CRC.
  • CRC colorectal cancer
  • the invention also provides a method of treating a mismatch repair-deficient (dMMR) colorectal cancer (CRC) or high-level microsatellite instability (MSI-H) CRC, comprising administering to a subject diagnosed with the dMMR CRC or MSI-H CRC an antagonistic anti- PDl antibody or an antigen binding fragment thereof comprising a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the dMMR CRC or the MSI-H CRC.
  • dMMR mismatch repair-deficient
  • CRC colorectal cancer
  • MSI-H high-level microsatellite instability
  • dMMR DNA mismatch repair
  • MSI microsatellite instability
  • Tumors with the dMMR/MSI result typically from germline mutation in one of the MMR genes or somatic inactivation of the same pathway.
  • dMMR/MSI tumors include hereditary non-polyposis colorectal cancer (HNPCC), also called Lynch syndrome and sporadic MSI-H CRC.
  • HNPCC hereditary non-polyposis colorectal cancer
  • Lynch syndrome is caused by germline mutations in MMR genes MLH1, MSH2, MSH6 or PMS2, or epigenetic inactivation of MSH2. Sporadic MSI-H CRCs are frequently caused by methylation of MLH1 promoter.
  • MSI-H tumors has no alterations in the MMR genes themselves, but instead overexpress various miRNAs that may silence the MMR genes.
  • miRNA-2l found overexpressed in MSI-H CRC targets MSH2 and MSH6 mRNA.
  • MSI-H CRC can be detected using polymerase chain reaction (PCR) of tumor tissue samples detecting stability of microsatellite markers. CRC is classified as MSI-H if instability is shown in 30% or more of microsatellite markers with at least 5 markers evaluated.
  • PCR polymerase chain reaction
  • the National Cancer Institute has recommended a panel of 5 microsatellites for MSI screening: BAT25 and BAT26 (mononucleotide repeats), D2S123, D5S346, and D17S250 (dinucleotide repeats).
  • dMMR can be detected using immunohistochemistry of tumor tissues.
  • CRC is classified as dMMR if loss of at least one MMR genes MLH1, MSH2, MSH6 or PMS2 is detected in the tumor tissue.
  • the CRC is a stage II CRC or a stage III CRC.
  • CRC staging is known, using for example the American Joint Committee on Cancer (AJCC) TNM system and diagnosis by an oncologist.
  • AJCC American Joint Committee on Cancer
  • the subject diagnosed with CRC is refractory to treatment with fluoropyrimidine, oxaliplatin or irinotecan, or any combination thereof.
  • the subject diagnosed with CRC has a relapsed tumor after treatment with fluoropyrimidine, oxaliplatin or irinotecan, or any combination thereof.
  • Symptoms that may be associated with relapse or refractory disease are, for example, a decline or plateau of the well-being of the patient or re-establishment or worsening of various symptoms associated with tumors, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 or SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the thymus cancer.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) of SEQ ID NO: 8 for a time sufficient to treat the thymus cancer.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 for a time sufficient to treat the thymus cancer.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 80 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 80 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 160 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 160 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 320 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 320 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 400 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 400 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 560 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 560 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 720 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 720 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 800 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 800 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 880 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 880 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 960 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 960 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
  • the thymus cancer is a thymoma.
  • the thymoma is a type A thymoma.
  • the thymoma is a type AB thymoma.
  • the thymoma is a type Bl thymoma. In some embodiments, the thymoma is a type B2 thymoma.
  • the thymoma is a type B3 thymoma.
  • the thymus cancer is a thymic carcinoma.
  • the thymic carcinoma is a low grade thymic carcinoma.
  • the thymic carcinoma is high grade thymic carcinoma.
  • the thymus cancer is a metastatic thymic cancer.
  • the thymus cancer has metastasized to lung, lymph node, heart or bone.
  • the subject has been treated with surgery, radiation therapy, a chemotherapy or a hormone therapy.
  • the subject has been treated with carboplatin, cisplatin, cyclophosphamide, doxorubicin, etoposide, ifosfamide, octreotide, paclitaxel or pemetrexed, or any combination thereof.
  • Thymus cancer may be staged for example according to the American Society of Clinical Oncology (ASCO) staging system.
  • ASCO American Society of Clinical Oncology
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof comprises a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) or SEQ ID NO: 8.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgGl, an IgG2, and IgG3 or an IgG4 isotype.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgG4 isotype.
  • the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgG4 isotype and comprises proline at position 228, residue numbering according to the EU Index.
  • the antagonistic anti-PD-l antibody is a nG4m(a) allotype.
  • the antagonistic anti-PD-l antibody or an antigen binding fragment thereof has at least one substitution in an Fc region to modulate antibody effector functions or antibody half-life.
  • the antagonistic anti-PD-l antibody comprises a heavy chain of SEQ ID NO: 9 and a light chain of SEQ ID NO: 10.
  • the invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody comprising the HC of SEQ ID NO: 9 and the LC of SEQ ID NO: 10, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate 20 and about 20 pg/ml and EDTA at pH 6.5.
  • the invention also provides a pharmaceutical composition
  • a pharmaceutical composition comprising
  • cetrelimab between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • cetrelimab about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
  • the lyophilized formulation once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the invention also provides a drug product comprising
  • cetrelimab between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
  • the lyophilized formulation once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the lyophilized formulation is reconstituted into sterile water for injection (sWFI).
  • sWFI sterile water for injection
  • the invention also provides a drug product comprising about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5 in a volume of about 3.3 ml.
  • the invention also provides a drug product comprising a lyophilized formulation comprising about 90 mg cetrelimab that upon reconstitution into about 3.3 ml comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the invention also provides a drug product comprising a lyophilized formulation comprising about 240 mg cetrelimab that upon reconstitution into about 8.6 ml comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the invention also provides a drug product comprising
  • cetrelimab between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • cetrelimab about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients; a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
  • the lyophilized formulation once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • the drug product is provided for the treatment of a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma
  • the drug product is provided for the treatment of a NSCLC, a melanoma, a bladder cancer, a renal cell carcinoma, a SLCL, a CRC, a gastric cancer, a prostate cancer, or an esophageal cancer.
  • the drug product is provided for the treatment of PD-L1 high NSCLC.
  • the drug product is provided for the treatment of a MSI-H CRC or a dMMR CRC.
  • the drug product is provided for the treatment of a non-uveal melanoma.
  • the drug product is administered
  • the drug product the drug product is administered by an intravenous administration of by a subcutaneous administration, or a combination thereof.
  • Antagonistic anti-PD-l antibodies or antigen-binding fragments thereof used in the methods of the invention may be generated using various technologies.
  • the hybridoma method of Kohler and Milstein may be used to generate monoclonal antibodies.
  • a mouse or other host animal such as a hamster, rat or monkey, is immunized with human and/or cyno PD-l antigens, such as the extracellular domain of PD-l, followed by fusion of spleen cells from immunized animals with myeloma cells using standard methods to form hybridoma cells.
  • Colonies arising from single immortalized hybridoma cells may be screened for production of antibodies with desired properties, such as specificity of binding, cross-reactivity or lack thereof, affinity for the antigen, and functionality such as antagonistic activity.
  • Exemplary humanization techniques including selection of human acceptor frameworks include CDR grafting (U.S. Patent No. 5,225,539), SDR grafting (U.S. Patent No. 6,818,749), Resurfacing (Padlan, (1991) Mol Immunol 28:489-499), Specificity Determining Residues Resurfacing (U.S. Patent Publ. No. 2010/0261620), human framework adaptation (U.S. Patent No. 8,748,356) or superhumanization (U.S. Patent No. 7,709, 226).
  • CDRs or a subset of CDR residues of parental antibodies are transferred onto human frameworks that may be selected based on their overall homology to the parental frameworks, based on similarity in CDR length, or canonical structure identity, or a combination thereof.
  • Humanized antibodies may be further optimized to improve their selectivity or affinity to a desired antigen by incorporating altered framework support residues to preserve binding affinity (backmutations) by techniques such as those described in Int. Patent Publ. Nos. W01090/007861 and W01992/22653, or by introducing variation at any of the CDRs for example to improve affinity of the antibody.
  • Transgenic animals such as mice or rat carrying human immunoglobulin (Ig) loci in their genome may be used to generate antibodies against PD-l, and are described in for example U.S. Patent No. 6,150,584, Int. Patent Publ. No. W01999/45962, Int. Patent Publ. Nos.
  • the endogenous immunoglobulin loci in such animal may be disrupted or deleted, and at least one complete or partial human immunoglobulin locus may be inserted into the genome of the animal using homologous or non-homologous recombination, using transchromosomes, or using minigenes. Companies such as Regeneron (http://_www_regeneron_com), Harbour Antibodies
  • Antibodies may be selected from a phage display library, where the phage is engineered to express human immunoglobulins or portions thereof such as Fabs, single chain antibodies (scFv), or unpaired or paired antibody variable regions.
  • the antibodies of the invention may be isolated for example from phage display library expressing antibody heavy and light chain variable regions as fusion proteins with bacteriophage pIX coat protein as described in Shi et al, (2010) J Mol Biol 397:385-96, and Int. Patent Publ. No. WO09/085462).
  • the libraries may be screened for phage binding to human and/or cyno PD-l and the obtained positive clones may be further characterized, the Fabs isolated from the clone lysates, and expressed as full length IgGs.
  • antibody JNJ-63723283 comprises frameworks derived from human germline genes IGHV1-69 and IGKV3-11.
  • JNJ- 63723283 HCDRs may be grafted to other IGHV1 germline gene subgroup frameworks and the LCDRs may be grafted to other IGKV3 germline gene subgroup frameworks and the resulting antibodies are tested for desired functionality.
  • the human germline gene sequences are well known and can be retrieved for example from ImMunoGeneTics Information System®.
  • immunogenic antigens and monoclonal antibody production may be performed using any suitable technique, such as recombinant protein production.
  • the immunogenic antigens may be administered to an animal in the form of purified protein, or protein mixtures including whole cells or cell or tissue extracts, or the antigen may be formed de novo in the animal’s body from nucleic acids encoding said antigen or a portion thereof.
  • Antibodies may be produced for example in CHO cells cultured using known methods.
  • the antibody may be isolated and/or purified from culture medium by removing solids by centrifugation or filtering as a first step in the purification process.
  • the antibody may be further purified by standard methods including chromatography (e.g., ion exchange, affinity, size exclusion, and hydroxyapatite chromatography), gel filtration, centrifugation, or differential solubility, ethanol precipitation or by any other available technique for the purification of antibodies.
  • Protease inhibitors such as phenyl methyl sulfonyl fluoride (PMSF), leupeptin, pepstatin or aprotinin can be added at any or all stages to reduce or eliminate degradation of the antibody during the purification process.
  • PMSF phenyl methyl sulfonyl fluoride
  • leupeptin leupeptin
  • pepstatin pepstatin
  • aprotinin can be added at any or all stages to reduce or eliminate degradation of the antibody during the purification process.
  • purification technique will vary depending on the character of the polypeptide or protein to be purified, the character of the cells from which the polypeptide or protein is expressed, and the composition of the medium in which the cells were grown.
  • An antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for use in treating a subject having a cancer, wherein the antagonistic anti-PD-1 antibody is administered at a dose of between about 240 mg and about 480 mg.
  • a) administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a pharmaceutical composition comprising about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • e provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients; or
  • f provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
  • NSCLC non-small cell lung cancer
  • VH heavy chain variable region
  • VL light chain variable region
  • a pharmaceutical composition comprising a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • cetrelimab about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg of
  • cetrelimab and one or more pharmaceutically acceptable excipients are cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg cetrelimab and one or more
  • the pharmaceutical composition of embodiment 37 wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • cetrelimab about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg cetrelimab and one or more
  • the drug product of embodiment 39 wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
  • a drug product comprising
  • cetrelimab about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
  • a lyophilized formulation comprising between about 90 mg and about 240 mg cetrelimab and one or more pharmaceutically acceptable excipients;
  • a lyophilized formulation comprising about 90 mg cetrelimab and one or more
  • a lyophilized formulation comprising about 240 mg cetrelimab and one or more
  • the drug product of embodiment 41 wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.)
  • the drug product of embodiment 41, wherein the cancer is a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a
  • NSCLC non-small cell lung cancer
  • gastrointestinal cancer a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer
  • the NSCLC is PD-L 1 high NSCLC
  • the CRC is a MSI-H CRC or a dMMR CRC;
  • the melanoma is a non-uveal melanoma; or any combination thereof. 45) The drug product of embodiment 41, wherein the drug product is administered
  • intravenous administration of by a subcutaneous administration, or a combination thereof is a subcutaneous administration, or a combination thereof.
  • a method of treating a cancer comprising administering to a subject diagnosed with the cancer an antagonistic anti-PD 1 antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDRT) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every 2, 3, 4, 5 or 6 weeks.
  • HDRT heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every 2, 3, 4, 5 or 6 weeks.
  • invention 47 comprising providing an antagonistic anti-PD 1 antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDRT) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg and about 1000 mg once every 2, 3, 4, 5 or 6 weeks to a subject diagnosed with the cancer, and administering the antagonistic anti-PD- 1 antibody or the antigen binding fragment thereof to the subject diagnosed with the cancer.
  • HDRT heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR2 of SEQ ID NO: 5
  • LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg
  • duration of the intravenous infusion is about 20, about 30, about 40, about 50, about 60, about 70 or about 80 minutes.
  • any one of embodiments 47-57 wherein the cancer is selected from the group consisting of a thymus cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a melanoma, a bladder cancer, a renal cancer, a gastric cancer, an esophageal cancer and a colorectal cancer (CRC).
  • NSCLC non-small cell lung cancer
  • SCLC small cell lung cancer
  • a melanoma a bladder cancer
  • a renal cancer a gastric cancer
  • an esophageal cancer an esophageal cancer
  • CRC colorectal cancer
  • thymus cancer is a thymoma, a thymic carcinoma or a metastatic thymic cancer, or any combination thereof.
  • thymoma is a type A thymoma, a type AB thymoma, a type Bl thymoma, a type B2 thymoma or a type B3 thymoma.
  • thymic carcinoma is a low grade thymic carcinoma or a high grade thymic carcinoma.
  • ORR response rate
  • a pharmaceutical composition comprising about 10 mg/ml of an antagonistic anti-PD-l antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10, about 10 mM Histidine, about 8.0% (w/v) Sucrose, about 0.04% Polysorbate-20 and about 20 pg/ml and EDTA at pH 6.5.
  • a method of treating a thymus cancer comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the thymus cancer.
  • HCDR1 heavy chain complementarity determining region 1
  • LCDR1 light chain complementarity determining region 1
  • LCDR2 of SEQ ID NO: 5 a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the thymus cancer.
  • thymoma is a type A thymoma, a type AB thymoma, a type Bl thymoma, a type B2 thymoma or a type B3 thymoma.
  • thymic carcinoma is a low grade thymic carcinoma or a high grade thymic carcinoma.
  • Example 1 A First-in-Human, Open-label, Phase 1/2 Study to Evaluate the Safety, Pharmacokinetics, Pharmacodynamics, and Clinical Activity of JNJ-63723283 (cetrelimab), an Anti-PD-1 Monoclonal Antibody, in Subjects with Advanced Cancers (NCT02908906)
  • Part 1 This is a first-in-human (FIH), Phase 1/2, open-label, multicenter study to establish RP2D(s) for JNJ-63723283 in Part 1 and to evaluate the safety and efficacy of the RP2D(s) in Part 2.
  • Part 1 will consist of dosage escalation cohorts and pharmacokinetic/pharmacodynamic cohorts.
  • 1 or more RP2D(s) determined in Part 1 will be evaluated in selected solid tumor types including NSCLC, melanoma, bladder cancer, renal cancer, small-cell lung cancer (SCLC), gastric/esophageal cancer, MSI-H or dMMR CRC, and thymoma (including thymic carcinoma).
  • the overall safety of JNJ-63723283 will be assessed by the Safety Evaluation Team (SET). Subjects will continue to receive JNJ-63723283 until disease progression, unacceptable toxicity, withdrawal of consent, or end of study.
  • Safety profile of JNJ-63723283 (safety parameters include but are not limited to the
  • AEs adverse events
  • irAEs immune-related AEs
  • ECGs electrocardiograms
  • Serum JNJ-63723283 pharmacokinetic parameters including but not limited to maximum observed serum concentration (Cmax), area under the concentration-time curve between 2 defined sampling points, tl and t2 (AUCtl-t2), half-life (T 1/2), total systemic clearance of drug after IV administration (CL), volume of distribution at steady-state (Vss), and accumulation ratio (R)
  • Subjects must be >18 years of age and have an Eastern Cooperative Oncology Group (ECOG) performance status score of 0 or 1. All subjects will have a histologically or cytologically confirmed solid tumor, except lymphoma, that is metastatic or unresectable, and had previously received or were ineligible for standard treatment options. In addition, subjects will not have received prior treatment with an anti-PD-l or anti-PD-Ll antibody (i.e., anti-PD-l and anti-PD-Ll naive). In Part 2, subjects will have one of the following selected tumor types: PD- Ll-high NSCLC, bladder, gastric/esophageal, melanoma, renal, SCLC, MSI-H or dMMR CRC. Dosage and administration
  • the study drug will initially be administered via IV infusion once every 2 weeks. Dosage escalation will begin at the starting dosage of 80 mg and may continue at dosages 160 mg, 240 mg, 320 mg, 400 mg, 480 mg, 560 mg, 640 mg, 720 mg and 800 mg.
  • the administration schedule and infusion duration may be changed based on emerging safety, pharmacokinetic, and pharmacodynamic/biomarker data, and as confirmed by the SET.
  • alternative dosages and schedules may be explored (e.g., administration once every 3 weeks or every 4 weeks).
  • One or more RP2D(s) for JNJ-63723283 may be evaluated in Part 2.
  • Efficacy evaluations will include the following: computed tomography (CT) scans and/or magnetic resonance imaging (MRI), physical examination, and other procedures as necessary.
  • CT computed tomography
  • MRI magnetic resonance imaging
  • Part 1 The purpose of Part 1 is to identify the RP2D(s) in subjects with advanced solid tumors. Dosage escalation will be supported by a modified Continual Reassessment Method (mCRM) based on a statistical model, Bayesian Logistic Regression Model (BLRM), with Escalation with Overdosage Control (EWOC) principle. The total number of subjects treated will depend on the number of dosage levels explored and the number of subjects enrolled at each dosage level.
  • mCRM Continual Reassessment Method
  • BLRM Bayesian Logistic Regression Model
  • EWOC Escalation with Overdosage Control
  • Serum samples will be collected and analyzed in Part 1 and Part 2 for JNJ-63723283 concentrations, and estimation of basic pharmacokinetic parameters from this concentration -time data will be performed. Pharmacokinetics will be assessed relative to available clinical safety, pharmacodynamic, and efficacy data, as well as to any efficacious concentration thresholds observed in nonclinical or competitor studies. Pharmacokinetic or pharmacokinetic/ pharmacodynamic analysis and modeling will be used to aid selection of a RP2D regimen for use in Part 2. Immunogenicity (i.e., ADA) will be evaluated for impact on pharmacokinetics and safety. The serum glycoform profile of JNJ-63723283 will also be characterized.
  • JNJ-63723283 will induce phenotypic changes consistent with activation of T cells in peripheral blood and tumor tissues. Pharmacodynamic evaluations will be based on assessment of activation and proliferation markers as well as cytokine profiles of T cells in peripheral blood. Peripheral blood samples will also be used to quantify the response of the immune cells in ex vivo stimulation assays. As PD-l polymorphisms could impact the effect of anti-PD-l antibodies, PD-l polymorphisms may be evaluated for possible correlation with clinical activity. JNJ-63723283 is anticipated to demonstrate binding to PD-l on circulating immune cells following administration to human subjects. PD-l receptor occupancy by JNJ- 63723283 on circulating CD3+ T cells will be measured using flow cytometry. Characteristics including dosage-dependence, peak occupancy, plateau occupancy, and duration of occupancy at plateau will be assessed, as feasible.
  • PD-L 1 the ligand for PD-l, correlates with enhanced clinical activity in multiple tumor types including NSCLC cancer.
  • tumor tissue for PD-L1 testing will be required for all tumor types. This is necessary to correlate the clinical response with PD-L1 expression on the tumor tissue.
  • MSI-H and dMMR CRC Compared with other tumors, MSI-H and dMMR CRC has a higher frequency of DNA mutations and higher level of immune infiltrates, and thus is more susceptible to PD-l blockade therapies.
  • prescreening for MSI-H or dMMR is required.
  • the recommended FIH starting dosage regimen of JNJ-63723283 is 80 mg administered as an IV infusion every 2 weeks. Additional dosing intervals such as every 3 weeks, 4 weeks, or 6 weeks may be explored in Part 1 in addition to dosing every 2 weeks for further
  • the maximum administered dosage is planned to be 800 mg but may be lower or higher based on emerging data.
  • Administered intravenously initially over a 60 ( ⁇ 10) minute infusion. In the absence of infusion-related reactions, subsequent infusions may be administered intravenously over 30 (-5/+10) minutes. Longer infusion times may occur if the infusion needs to be paused or slowed due to a safety concern. Also, it is not recommended to administer >100 mL of diluted drug product faster than 30 (-5/+10) minutes, or >250 mL of diluted drug product faster than 60 ( ⁇ 10) minutes.
  • At least 1 measurable lesion that can be accurately assessed at baseline by CT (or magnetic resonance imaging [MRI] where CT is contraindicated) and is suitable for repeated assessment as per RECIST vl . l
  • lymphoma has any type of advanced or refractory solid tumor malignancy, except lymphoma, that is metastatic or unresectable and previously received or was ineligible for standard treatment options including appropriate molecularly targeted therapies (e.g., subjects with epidermal growth factor receptor [EGFR] mutant NSCLC or with NSCLC with anaplastic lymphoma tyrosine kinase [ALK] rearrangement).
  • appropriate molecularly targeted therapies e.g., subjects with epidermal growth factor receptor [EGFR] mutant NSCLC or with NSCLC with anaplastic lymphoma tyrosine kinase [ALK] rearrangement.
  • NSCLC o PD-Ll-high tumor sample >50% tumor cells stained positive for PD-L1 by a PD- L 1 immunohistochemistry (IHC) test performed by a local laboratory or by the central laboratory designated by the sponsor
  • TSH thyroid stimulating hormone
  • Each subject or their legally acceptable representative must sign an informed consent form (ICF) indicating that he or she understands the purpose of and procedures required for the study and are willing to participate in the study. Consent is to be obtained prior to the initiation of any study -related tests or procedures that are not part of standard of care for the subject’s disease.
  • ICF informed consent form
  • Subjects enrolled into Part 2 must have tumor tissue available for correlative studies. Fresh tumor biopsy is preferred. Archival tissue must meet the following criteria: archival sections within 4 months of sectioning that have been stored at 2° to 8° C in the dark or archival tumor blocks within 5 years of collection. Subjects without tissues meeting the aforementioned archived tissue criteria must undergo a fresh biopsy.
  • Subjects with vitiligo or resolved childhood asthma/atopy would be an exception to this rule. Subjects that require intermittent use of bronchodilators or local steroid injections would not be excluded from the study. Subjects with hypothyroidism stable on hormone replacement will not be excluded from the study. Subjects with a history of transient autoimmune manifestations of an acute infectious disease that resolved upon treatment of the infectious agent (e.g., acute Lyme arthritis) will not be excluded from the study.
  • hepatitis B surface antigen HBsAg
  • hepatitis B core antibody hepatitis B core antibody
  • anti-HCV hepatitis C antibody
  • HIV human immunodeficiency virus
  • concomitant medications or treatments including nutritional support, correction of metabolic disorders, optimal symptom control, and pain management
  • Subjects may continue the use of bisphosphonates or denosumab for bone disease.
  • Concurrent use of hormones for non cancer related conditions e.g., insulin for diabetes and hormone replacement therapy
  • Concomitant medications e.g., acetaminophen/paracetamol or diphenhydramine deemed necessary by the investigator to provide adequate prophylaxis and management of IRR are allowed.
  • antispasmodics antipyretics, antihistamines, analgesics, antibiotics and other antimicrobials, histamine receptor [H2] antagonists or proton pump inhibitors, and other medications intended to treat symptoms or signs of disease) as clinically indicated, according to institutional standards and as deemed necessary by the investigator.
  • NCCN/EORTC Organization for Research and Treatment of Cancer
  • PD-L1 testing will be required for NSCLC subjects in Part 2 and may be performed by a local laboratory or by the central laboratory designated by the sponsor.
  • prescreening MSI or dMMR testing will also be required by a local laboratory or by the central laboratory designated by the sponsor.
  • Local test results will be centrally confirmed by the sponsor’s designee laboratory. In cases of discordance between local and central results, the central results will be used for analysis.
  • Tumor tissue from the most recent tumor biopsy should be a formalin-fixed paraffin embedded (FFPE) tissue block that has been collected within the past 5 years (preferred) or a minimum of 15 unstained slides that have been processed no more than 4 months prior to study participation and have been stored at 2° C to 8° C in the dark. An additional 5 slides will be collected from CRC patients to support MSI-H analysis. If a site does not have sufficient material, a fresh tumor biopsy will be required for subjects in Part 2. Whole blood will be collected from CRC patients to support tumor tissue MSI and dMMR testing. This blood collection may be stopped due to developments in assay platforms utilized for MSI/dMMR testing.
  • FFPE formalin-fixed paraffin embedded
  • the JNJ-63723283 DPI study material supplied for this study is a sterile, frozen liquid in an 8R glass vial with serum stopper and aluminum seal with flip-off cap.
  • Each vial of JNJ-63723283 clinical study material is filled with 3.3 mL of a 10 mg/mL solution of JNJ-63723283 (including 10% overfill in 10 mM histidine, 8.0% (w/v) sucrose, 0.04% (w/v) polysorbate 20, 20 pg/ml EDTA, pH 6.5, e.g. 30 mg/vial deliverable amount).
  • the JNJ-63723283 DP2 study material supplied for this study is a sterile, lyophilized formulation in an 8R glass vial with serum stopper and aluminum seal with flip-off cap.
  • Each vial of JNJ-63723283 clinical study material contains 90 mg per vial that after reconstitution is a 30 mg/mL solution of JNJ-63723283 in 10 mM histidine, 8.0% (w/v) sucrose, 0.04% Polysorbate 20 (w/v/), 20 pg/ml. EDTA, pH 6.5.
  • JNJ-63723283 may also be supplied as a sterile, lyophilized formulation in an 30 mL glass vial with serum stopper and aluminum seal with flip-off cap.
  • Each vial of JNJ- 63723283 clinical study material contains 240 mg per vial that after reconstitution is a 30 mg/mL solution of JNJ-63723283 in 10 mM histidine, 8.0% (w/v) sucrose, 0.04% Polysorbate 20 (w/v), 20 pg/ml. EDTA, pH 6.5.
  • — 240 mg Q2W Grade 3 pleural effusion in a patient with NSCLC that required pleurodesis on study day 26 that was considered by the investigator to be possibly related to study drug because of the temporal relationship to study drug administration.
  • 800 mg Q2W Grade 5 dyspnea in a patient with thymoma secondary to myasthenia gravis 14 days after receiving a single dosage of study drug.
  • irAEs Immune-related AEs
  • Serum concentration of JNJ-63723283 in dosaged subjects were consistent with linear and dosage-proportional PK.
  • Table 5 shows the preliminary PK parameters of JNJ-63723283 in patients dosaged 80 mg, 240 mg and 480 mg of JNJ-63723283 after the first dosage.
  • FIG. 1 shows the mean serum concentration -time profiles of JNJ-63723283. Saturation of PD-l receptors on circulating CD3 + T cells was demonstrated after the first dosage and maintained throughout the dosing interval at all dosage levels (ranging from 80 mg to 480 mg) and all frequencies (ranging from Q2W to Q4W). The percentage (%) saturation of PD-l receptors on circulating CD3 + T cells is shown in FIG. 2. The percentage (%) saturation of PD-l receptors on circulating CD3 + T cells is shown in FIG. 3.
  • FIG. 4 shows the T cell activation in response to SEB prior to and 2 hours after dosage 1 (Dl-Pre, Dl-2hr), at follow-up after dosage 1 (Dl-FU), prior to dosage 2 (D2-Pre), prior to dosage 3 (D3-Pre) and at end of treatment (EOT) in patients who received 240 mg Q2W or 480 mg Q4Q of the antibody.
  • JNJ-63723283 pharmacodynamic modulation was characterized by evaluating IL-2 expression, as a measure of T cell activation, in pre-and post-treated ex vivo SEB
  • JNJ-63723283 displayed a safety profile that was comparable to other anti-PD-l antibodies.
  • the RP2D of 240 mg Q2W is being evaluated in phase 2; the RP2D may be administered at an alternative regimen of 480 mg Q4W to enable flexibility in various clinical settings.
  • JNJ-63723283 exhibited linear and dose-proportional PK within the dose range evaluated. • JNJ-63723283 demonstrated saturable PD-l RO and enhanced T cell activity in ex-vivo SEB stimulation assays at all dose levels and throughout all dosing frequencies tested.
  • Table 7 shows the mutation status, number and type of prior therapies for melanoma patients in Part 2.
  • Table 8 shows the PD-L1 status, number and type of prior therapies for NSCLC patients in Part 2.
  • Table 9 shows the MSI (Microsatellite Instability) status (Central testing result) in CRC.
  • TE SAEs Serious TEAEs were observed in nearly 50% of subjects.
  • the most common TE SAEs were dyspnoea (5.1%), pleural effusion (3.5%), intestinal obstruction (3.5%), general physical health deterioration (3.0%), and pyrexia (3.0%).
  • IRRs Immune-related AEs
  • IRRs Infusion Related Reactions
  • Table 10 shows the summary of the reported adverse events in part 1/2.
  • Table 11 shows the adverse events occurring in >10% subjects.
  • JNJ-63723283 displayed a safety profile in immune-sensitive advanced cancers that was comparable to other anti-PD-1 antibodies.
  • JNJ-63723283 demonstrated saturable PD-1 RO and enhanced T cell activity in ex-vivo SEB stimulation assays at all dose levels and throughout all dosing frequencies tested.
  • the RP2D of 240 mg Q2W is being evaluated in phase 2; the RP2D may be administered at an alternative regimen of 480 mg Q4W to enable flexibility in various clinical settings.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention relates to methods of treating cancers with antagonistic anti-PD-1 antibodies, formulations of the antagonistic anti-PD-1 antibodies and drug products of the anti- PD-1 antibodies.

Description

METHODS OF TREATING CANCERS WITH ANTAGONISTIC ANTI-PD-1
ANTIBODIES
FIELD OF THE INVENTION
The present invention relates to methods of treating cancers with antagonistic anti-PD-l antibodies, formulations of the antagonistic anti-PD-l antibodies and drug products of the anti- PD-l antibodies.
SEQUENCE LISTING
This application contains a Sequence Listing submitted via EFS-Web, the entire content of which is incorporated herein by reference. The ASCII text file, created on 18 January 2019, is named JBI5 l52WOPCTl_ST25.txt and is 12 kilobytes in size.
BACKGROUND OF THE INVENTION
The immune system is tightly controlled by a network of costimulatory and co-inhibitory ligands and receptors. These molecules provide secondary signals for T cell activation and provide a balanced network of positive and negative signals to maximize immune responses against infection and tumors, while limiting immunity to self (Wang et al, (Epub Mar. 7, 2011) J Exp Med 208(3):577-92; Lepenies et al, (2008) Endocr Metab Immune Disord Drug Targets 8:279-288). Immune checkpoint therapy, targeting co-inhibitory pathways in T cells to promote antitumor immune responses, has led to advances in clinical care of cancer patients.
PD-l is a negative immune checkpoint molecule that suppresses CD4+ and CD8+T cell functions in the tumor microenvironment (TME). PD-l engagement with its ligands (PD-L1 and PD-L2) drives T cell anergy and exhaustion in tumors by inhibiting multiple pathways downstream of the T cell receptor signaling, resulting in decreased T cell survival, growth and proliferation, compromised effector function, and altered metabolism. Preclinical studies have demonstrated that the PD-l pathway blockade can reverse T cell exhaustion and stimulate anti tumor immunity.
While anti-PD-l/PD-Ll antibodies are demonstrating encouraging clinical responses in patients with multiple solid tumors, the response rates are still fairly low, about 15% - 20% in pretreated patients (Swaika et al, (2015) Mol Immunol doi: l0. l0l6/j.molimm.20l5.02.009).
Therefore, there is a need for new therapeutics that inhibit the immunosuppressive activity of checkpoint inhibitors such as PD-l to be used for cancer immunotherapy. SUMMAY OF THE INVENTION
The invention provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
The invention also provides a pharmaceutical composition comprising
between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
pharmaceutically acceptable excipients; or
a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
pharmaceutically acceptable excipients.
The invention also provides a drug product comprising
between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
pharmaceutically acceptable excipients; or
a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
pharmaceutically acceptable excipients.
The invention also provides a drug product comprising between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
pharmaceutically acceptable excipients; or
a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
pharmaceutically acceptable excipients,
for the treatment of a cancer.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 shows the mean serum concentration (pg/ml) of JNJ-63723283 (cetrelimab) over time in subjects dosed 80 mg, 240 mg, 460 mg, 480 mg or 800 mg once in two weeks (q2w) or once in four weeks (q4w) as indicated. The number of patients (n) dosed is shown in parenthesis.
FIG. 2 shows the percentage (%) of PD-l receptor occupancy of JNJ-63723283
(cetrelimab) on CD3+ circulating T cells over time (as indicated by administered doses 1-39) in subjects dosed 240 mg cetrelimab q2w. Pre: before dosing; EOI+2H: End of infusion plus 2 hours. EOI+1H: end of infusion plus 1 hour. EOT: end of treatment.
FIG. 3 shows the percentage (%) of PD-l receptor occupancy of JNJ-63723283
(cetrelimab) on CD3+ circulating T cells over time (as indicated by administered doses 1-14) in subjects dosed 480 mg cetrelimab q4w. Pre: before dosing; EOI+2H: End of infusion plus 2 hours. EOI+1H: end of infusion plus 1 hour. EOT: end of treatment.
FIG. 4 shows the time course of T cell activation in patient receiving 240 mg once every two weeks (Q2W) (solid line) or 480 mg once every four weeks (Q4W) (dashed line) JNJ- 63723283 (cetrelimab). Ratio of 1 indicates maximum T cell activation. D = dose; EOT = end of treatment (time points vary per patient); FU = follow-up; Pre = pre-infusion; Q2W = once every 2 weeks; Q4W = once every 4 weeks; SEB = staphylococcal enterotoxin B.
DETAILED DESCRIPTION OF THE INVENTION All publications, including but not limited to patents and patent applications, cited in this specification are herein incorporated by reference as though fully set forth.
It is to be understood that the terminology used herein is for the purpose of describing embodiments only and is not intended to be limiting. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains.
Although any methods and materials similar or equivalent to those described herein may be used in the practice for testing of the present invention, exemplary materials and methods are described herein. In describing and claiming the present invention, the following terminology will be used.
As used in this specification and the appended claims, the singular forms“a,”“an,” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to“a cell” includes a combination of two or more cells, and the like.
The transitional terms“comprising,”“consisting essentially of,” and“consisting of’ are intended to connote their generally accepted meanings in the patent vernacular; that is, (i) “comprising,” which is synonymous with“including,”“containing,” or“characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps; (ii) “consisting of’ excludes any element, step, or ingredient not specified in the claim; and (iii) “consisting essentially of’ limits the scope of a claim to the specified materials or steps“and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention. Embodiments described in terms of the phrase“comprising” (or its equivalents) also provide as embodiments those independently described in terms of“consisting of’ and“consisting essentially of.”
"Antagonist" or“antagonistic” refers to an anti-PDl antibody which upon binding to PD-1 suppresses at least one biological activity mediated by PD-1 ligand PD-L1 or PD-L2. The anti-PD-1 antibody is an antagonist when the at least one biological activity mediated by PD-L1 or PD-L2 is suppressed by at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%,
75%, 80%, 85%, 90%, 95%, or 100% greater than in the absence of the antagonist (e.g., negative control), or when the suppression is statistically significant when compared to the suppression in the absence of the antagonist. A typical biological activity that is mediated by PD-L 1 or PD-L2 binding to PD-1 is inhibition of antigen-specific CD4+ and/or CD8+ T cells. Therefore, antagonistic antibody relieves PD-L1 mediated suppression resulting in enhancement of immune responses. “PD-1” refers to human programmed cell death protein 1, PD-l. PD-l is also known as CD279 or PDCD1. The amino acid sequence of the mature human PD-l (without signal sequence) is shown in SEQ ID NO: 11. The extracellular domain spans residues 1-150, the transmembrane domain spans residues 151-171 and the cytoplasmic domain spans residues 172-
268 of SEQ ID NO: 11.
SEQ ID NO: 11
PGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA
AFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLR
AELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARG
TIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMG
TSSPARRGSADGPRSAQPLRPEDGHCSWPL
“Antibodies” is meant in a broad sense and includes immunoglobulin molecules belonging to any class, IgA, IgD, IgE, IgG and IgM, or sub-class IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4 and including either kappa (K) and lambda (l) light chain. Antibodies include monoclonal antibodies, full length antibodies, antigen binding fragments, bispecific or multispecific antibodies, dimeric, tetrameric or multimeric antibodies, single chain antibodies, domain antibodies and any other modified configuration of the immunoglobulin molecule that comprises an antigen binding fragment of the required specificity. “Full length antibodies” are comprised of two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (comprised of domains CH1, hinge, CH2 and CH3). Each light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The VH and the VL may be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with framework regions (FR). Each VH and VL is composed of three CDRs and four FR segments, arranged from amino-terminus to carboxy- terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. Antibodies include antibodies generated using various technologies, including antibodies generated from immunized mice or rat or identified from phage or mammalian display libraries as described herein.
“Complementarity determining regions (CDR)” are antibody regions that bind an antigen. There are three CDRs in the VH (HCDR1, HCDR2, HCDR3) and three CDRs in the VL (LCDR1, LCDR2, LCDR3). CDRs may be defined using various delineations such as Rabat (Wu et al. (1970) J Exp Med 132: 211-50) (Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991), Chothia (Chothia et al. (1987) J Mol Biol 196: 901-17), IMGT (Lefranc et al. (2003) Dev Comp Immunol 27: 55-77) and AbM (Martin and Thornton (1996) J Bmol Biol 263: 800-15). The correspondence between the various delineations and variable region numbering are described (see e.g. Lefranc et al. (2003) Dev Comp Immunol 27: 55-77; Honegger and Pluckthun, (2001) J Mol Biol 309:657-70; International ImMunoGeneTics (IMGT) database; Web resources, http://www_imgt_org). Available programs such as abYsis by UCL Business PLC may be used to delineate the CDRs. The term“CDR”,“HCDRl”,“HCDR2”,“HCDR3”,“LCDR1”,
“LCDR2” and“LCDR3” as used herein includes CDRs defined by any of the methods described supra, Kabat, Chothia, IMGT or AbM, unless otherwise explicitly stated in the specification.
“Antigen binding fragment” refers to a portion of an immunoglobulin molecule that retains the antigen binding properties of the parental full length antibody. Exemplary antigen binding fragments are heavy chain complementarity determining regions (HCDR) 1, 2 and/or 3, light chain complementarity determining regions (LCDR) 1, 2 and/or 3, the VH, the VL, the VH and the VL, Fab, F(ab')2, Fd and Fv fragments as well as domain antibodies (dAb) consisting of either one VH domain or one VL domain. The VH and the VL domains may be linked together via a synthetic linker to form various types of single chain antibody designs in which the VH/VL domains pair intramolecularly, or intermolecularly in those cases when the VH and VL domains are expressed by separate chains, to form a monovalent antigen binding site, such as single chain Fv (scFv) or diabody; described for example in Int. Pat. Publ. No. W01998/44001, Int. Pat. Publ. No. WO1988/01649; Int. Pat. Publ. No. WO1994/13804; Int. Pat. Publ. No. W01992/01047.
“Humanized antibody” refers to an antibody in which CDR sequences are derived from non-human species and the frameworks are derived from human immunoglobulin sequences. Humanized antibody may include substitutions in the framework so that the framework may not be an exact copy of expressed human immunoglobulin or human immunoglobulin germline gene sequences. Antibodies in which at least one CDR is derived from non-human species and at least one framework is derived from human immunoglobulin sequences are humanized antibodies. Humanized antibody may include substitutions in the frameworks so that the frameworks may not be exact copies of expressed human immunoglobulin or human immunoglobulin germline gene sequences.
“Human antibody” refers to an antibody that is optimized to have minimal immune response when administered to a human subject. Variable regions of human antibody are derived from human germline immunoglobulin sequences. If the antibody contains a constant region or a portion of the constant region, the constant region is also derived from human germline immunoglobulin sequences.
Human antibody comprises heavy or light chain variable regions that are“derived from” human germline immunoglobulin sequences if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes. Such exemplary systems are human immunoglobulin gene libraries displayed on phage or mammalian cells, and transgenic non-human animals such as mice, rats or chicken carrying human immunoglobulin loci. “Human antibody” typically contains amino acid differences when compared to the immunoglobulins expressed in humans due to differences between the systems used to obtain the antibody and human immunoglobulin loci, introduction of naturally occurring somatic mutations, intentional introduction of substitutions into the framework or the CDRs. “Human antibody” is typically about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98% or 99% identical in amino acid sequence to an amino acid sequence encoded by human germline immunoglobulin sequences. In some cases,“human antibody” may contain consensus framework sequences derived from human framework sequence analyses, for example as described in (Knappik el al. (2000) JMol Biol 296: 57-86), or synthetic HCDR3 incorporated into human immunoglobulin gene libraries displayed on phage, for example as described in (Shi et al. (2010) J Mol Biol 397: 385-96), and in Int. Patent Publ. No.
W02009/085462. Antibodies in which CDRs are derived from a non-human species are not included in the definition of“human antibody”.
“Monoclonal antibody” refers to an antibody population with single amino acid composition in each antibody chain except for possible well known alterations such as removal of C-terminal lysine from the antibody heavy chain or alterations due to post-translational modification(s) of amino acids, such as methionine oxidation or asparagine or glutamine deamidation. Monoclonal antibodies typically specifically bind one antigenic epitope, except that bispecific or multispecific monoclonal antibodies specifically bind two or more distinct antigenic epitopes. Monoclonal antibodies may have heterogeneous glycosylation within the antibody population. Monoclonal antibody may be monospecific or multispecific, or monovalent, bivalent or multivalent. A bispecific antibody is included in the term monoclonal antibody.
“Isolated” refers to a homogenous population of molecules (such as synthetic polynucleotides or a protein such as an antibody) which have been substantially separated and/or purified away from other components of the system the molecules are produced in, such as a recombinant cell, as well as a protein that has been subjected to at least one purification or isolation step. “Isolated antibody” refers to an antibody that is substantially free of other cellular material and/or chemicals and encompasses antibodies that are isolated to a higher purity, such as to 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% purity.
A“cancer cell” or a“tumor cell” refers to a cancerous, pre-cancerous or transformed cell, either in vivo, ex vivo, or in tissue culture, that has spontaneous or induced phenotypic changes. These changes do not necessarily involve the uptake of new genetic material. Although transformation may arise from infection with a transforming virus and incorporation of new genomic nucleic acid, uptake of exogenous nucleic acid or it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene.
Transformation/cancer is exemplified by morphological changes, immortalization of cells, aberrant growth control, foci formation, proliferation, malignancy, modulation of tumor specific marker levels, invasiveness, tumor growth in suitable animal hosts such as nude mice, and the like, in vitro, in vivo, and ex vivo (Freshney, Culture of Animal Cells: A Manual of Basic Technique (3rd ed. 1994)).
“Cancer” refers to a broad group of various diseases characterized by the uncontrolled growth of abnormal cells in the body. Unregulated cell division and growth results in the formation of malignant tumors that invade neighboring tissues and may also metastasize to distant parts of the body through the lymphatic system or bloodstream. A“cancer” or“cancer tissue” can include a tumor.
“About” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. Unless explicitly stated otherwise within the Examples or elsewhere in the Specification in the context of a particular assay, result or embodiment,“about” means within one standard deviation per the practice in the art, or a range of up to 5%, whichever is larger.
“Subject” includes any human or nonhuman animal. “Nonhuman animal” includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows, chickens, amphibians, reptiles, etc. The terms“subject” and“patient” can be used interchangeably herein.
“Treat” or“treatment” refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as growth and/or spreading of tumor cells. Beneficial or desired clinical results include alleviation of symptoms, shrinkage of tumor size, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if a subject was not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
“Therapeutically effective amount” refers to an amount effective, at doses and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount may vary depending on factors such as the disease state, age, sex, and weight of the individual, and the ability of a therapeutic or a combination of therapeutics to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic or combination of therapeutics that include, for example, improved well-being of the patient.
“Anti-PD-1 antibody” refers to an antibody that specifically binds PD-l.
“Specifically binds”,“specific binding” or“binds” refer to antibody binding to an antigen (e.g. PD-l) or an epitope within the antigen with greater affinity than for other antigens. Typically, the antibody binds to the antigen or the epitope within the antigen with an equilibrium dissociation constant (KD) of about lxlO"8 M or less, for example about lxlO"9 M or less, about lxlO"10 M or less, about lxlO"1 1 M or less, or about lxlO'12 M or less, typically with a KD that is at least one hundred-fold less than its KD for binding to a non-specific antigen (e.g., BSA, casein). The KD may be measured using standard procedures. Antibodies that specifically bind to the antigen or the epitope within the antigen may, however, have cross-reactivity to other related antigens, for example to the same antigen from other species (homologs), such as human or monkey, for example Macaca fascicularis (cynomolgus, cyno), Pan troglodytes (chimpanzee, chimp) or Callithrix jacchus (common marmoset, marmoset).
“Dosage” refers to the information of the amount of the therapeutic to be taken by the subject and the frequency of the number of times the therapeutic is to be taken by the subject.
“Dose” refers to the amount or quantity of the therapeutic to be taken each time.
“Relapsed” refers to the return of a disease or the signs and symptoms of a disease after a period of improvement after prior treatment with a therapeutic.
“Refractory” refers to a disease that does not respond to a treatment. A refractory disease can be resistant to a treatment before or at the beginning of the treatment, or a refractory disease can become resistant during a treatment.
“Drug substance” or“DS” refers to any substance or mixture of substances intended to be used in the manufacture of a drug (medicinal) product and that, when used in the production of a drug, becomes an active ingredient of the drug product. Such substances are intended to furnish pharmacological activity or other direct effect in the diagnosis, cure, mitigation, treatment, or prevention of disease or to affect the structure or function of the body.
“Drug product” or“DP” refers to a finished dosage form, for example, a tablet, capsule or solution that contains an active pharmaceutical ingredient (e.g. drug substance), generally, but not necessarily, in association with inactive ingredients.
“Wild-type BRAF” refers to the serine/threonine protein kinase B-raf having an amino acid sequence shown in UniProt accession number P15056.
“Mutant” refers to a polypeptide or a polynucleotide that differs from a reference polypeptide or a reference polynucleotide by one or more modifications, for example one or more substitutions, insertions or deletions. For example, the reference BRAF polypeptide is the wild- type BRAF. Mutations are indicated using well-known numbering system, e.g. V600E refers to a substitution of glutamic acid for valine at position 600.
"Immune condition" or "immune disorder" encompasses, e.g., pathological inflammation, an inflammatory disorder, and an autoimmune disorder or disease. "Immune condition" also refers to infections, persistent infections, and proliferative conditions, such as cancer, tumors, and angiogenesis, including infections, tumors, and cancers that resist eradication by the immune system.
The invention provides a method of treating a cancer, comprising providing an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks to a subject diagnosed with the cancer, and administering the antagonistic anti-PD-l antibody to the subject diagnosed with the cancer.
The invention also provides a method of treating an immune condition, comprising providing an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks to a subject diagnosed with the immune condition, and administering the antagonistic anti-PD-l antibody to the subject diagnosed with the cancer.
In some embodiments, the immune condition is a cancer.
In some embodiments, the immune condition is a viral infection, a persistent viral infection, inflammation, an inflammatory disorder or an autoimmune disorder or disease.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at a dosage of about 80 mg, about 160 mg, about 240 mg, about 320 mg, about 400 mg, about 480 mg, about 560 mg, about 720 mg, about 800 mg, about 880 mg or about 960 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating an immune condition, comprising administering to a subject diagnosed with the immune condition an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every two weeks. In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every three weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every four weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every five weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every six weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every two weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every three weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every four weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every five weeks.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 480 mg once every six weeks.
Diagnosis and staging of cancers is conducted by an oncologist using established diagnostic criteria.
In some embodiments, the cancer is a solid tumor. In some embodiments, the cancer is an advanced solid tumor. “Advanced solid tumor” refers to metastatic, unresectable, Stage III or Stage IV solid tumor.
In some embodiments, the cancer is selected from the group consisting of a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, a bladder cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer, a prostate cancer, a basal cell carcinoma and an advanced cutaneous squamous cell carcinoma (CSCC), or any combination thereof.
In some embodiments, the cancer is selected from the group consisting of a thymus cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a melanoma, a bladder cancer, a renal cancer, a gastric cancer, an esophageal cancer or a colorectal cancer (CRC).
In some embodiments, the cancer is the lung cancer.
In some embodiments, the cancer is the NSCLC
In some embodiments, the cancer is the melanoma.
In some embodiments, the cancer is the head and neck cancer.
In some embodiments, the cancer is the bladder cancer.
In some embodiments, the cancer is the gastrointestinal cancer.
In some embodiments, the cancer is the gastric cancer.
In some embodiments, the cancer is the gastro-esophageal junction cancer.
In some embodiments, the cancer is the esophageal cancer.
In some embodiments, the cancer is the liver cancer.
In some embodiments, the cancer is the CRC.
In some embodiments, the cancer is the colon cancer.
In some embodiments, the cancer is the gallbladder cancer.
In some embodiments, the cancer is the biliary tract cancer.
In some embodiments, the cancer is the ovarian cancer.
In some embodiments, the cancer is the fallopian tube cancer.
In some embodiments, the cancer is the cervical cancer.
In some embodiments, the cancer is the peritoneal cancer.
In some embodiments, the cancer is the endometrial cancer.
In some embodiments, the cancer is the SCLC.
In some embodiments, the cancer is the breast cancer.
In some embodiments, the cancer is the pancreatic cancer.
In some embodiments, the cancer is the renal cell carcinoma.
In some embodiments, the cancer is the Merkel cell carcinoma.
In some embodiments, the cancer is the PMBCL.
In some embodiments, the cancer is the Hodgkin’s lymphoma. In some embodiments, the cancer is the non-Hodgkin’s lymphoma.
In some embodiments, the cancer is the DLBLC.
In some embodiments, the cancer is the multiple myeloma.
In some embodiments, the cancer is the glioblastoma.
In some embodiments, the cancer is the urothelial cancer.
In some embodiments, the cancer is the salivary cancer.
In some embodiments, the cancer is the mesothelioma.
In some embodiments, the cancer is the anal cancer.
In some embodiments, the cancer is the prostate cancer.
In some embodiments, the prostate cancer is an adenocarcinoma.
In some embodiments, the prostate cancer is a metastatic prostate cancer.
In some embodiments, the prostate cancer has metastasized to rectum, lymph node or bone, or any combination thereof.
In some embodiments, the prostate cancer is relapsed or refractory prostate cancer.
In some embodiments, the prostate cancer is a castration resistant prostate cancer.
In some embodiments, the prostate cancer is sensitive to androgen deprivation therapy.
In some embodiments, the prostate cancer is insensitive to androgen deprivation therapy.
In some embodiments, the cancer is the CSCC.
In some embodiments, the cancer is the basal cell carcinoma.
In some embodiments, the cancer is the thymus cancer.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks, wherein the subject is PD-l axis naive.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg, wherein the subject is PD-l axis naive.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks, wherein the subject is PD-l axis naive and has received at least one prior therapeutic for the treatment of the cancer.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg, wherein the subject has received one, two, three or more prior therapeutics to treat the cancer.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg, wherein the subject is PD-l axis naive and has received one, two, three or more prior therapeutics to treat the cancer.
“PD-l axis naive” refers to a subject who has not been treated with PD-l, PD-L1 or PD- L2 antagonists. Exemplary PD-l, PD-L1 or PD-L2 antagonists are nivolumab (OPDIVO®), pembrolizumab (KEYTRUDA®), cemiplimab (Libtayo®), sintilimab, tislelizumab, tripolibamab durvalumab (IMFINZI®), atezolizumab (TECENTRIQ®), avelumab (BAVENCIO®) or envafolimab, or any other PD-l, PD-L1 or PD-L2 antagonist. Additional such antagonists are known and include those listed for example at Citeline Pharmalntelligence website.
In some embodiments, the cancer is PD-L1 positive.
In some embodiments, the cancer is PD-L1 high. In some embodiments, PD-L1 expression in the cancer is undetermined.
"PD-L1 positive" refers to a tumor in which at least about 1% of the cells in a sample obtained from the tumor (such as a paraffin embedded formalin fixed tumor tissue sample) comprising of tumor cells and tumor-infiltrating inflammatory cells stain positive for PD-L1 surface expression.
"PD-L1 high" refers to a tumor in which at least 50% of the tumor cells or tumor- infiltrating inflammatory cells in a sample obtained from the tumor (such as a paraffin embedded formalin fixed tumor tissue sample) stain positive for PD-L1 surface expression. Commercial kits from for example from Ventana, DAKO or PharmDx may be used to assess PD-L1 positive or PD-L1 high status. In these assays, PD-L1 expression on tumor cell membrane is evaluated using anti-PD-Ll antibodies such as 28-8, 22C3, SP142, SP263 and 73-10, and a Tumor Proportion Score (TPS) indicative of percentage of PD-L1 positive tumor cells is calculated.
“PD-L1 expression in the cancer is undetermined” refers to a tumor in which PD-L1 surface expression has not been assessed.
In some embodiments, the cancer expresses a mutant BRAF.
In some embodiments, the mutant BRAF comprises a V600E mutation.
In some embodiments, the cancer expresses a wild-type BRAF.
In some embodiments, the mutant BRAF comprises one or more mutations selected from the group consisting of: V600E, V600L, R4621, 1463 S, G464E, G464R, G464V, G466A, G469A, N581 S, E586K, F595L, L597Q, L597R, L597S, L597V, A598V, T599E, V600R, K601E, S602D and A728V, and any combination thereof (see e.g. Int. Pat. Publ. No.
WO2018/213302).
Mitogen-activated protein kinase (MAPK) or RAS/RAF/MEK/ERK signaling is responsible for several cell signaling pathways involved in control of proliferation,
differentiation, and apoptosis. Activating mutations of the serine-threonine kinase BRAF gene is the most frequent genetic alteration in melanomas; the BRAF mutation is observed in about 50% of skin melanoma and in about 10-20% of mucosal melanoma cases (MacKiewicz and
Mackiewicz, Content Oncol 22:68-72, 2018). Treatment of patients harboring BRAF mutations with BRAF inhibitors (such as vemurafenib, dabrafenib and encorafenib) is associated with acquired resistance to treatment and hence MEK inhibitor such as cobimetinib, trametinib or binimetinib may be combined to the treatment regimen. MEK inhibitors have also been tested as monotherapy in BRAF mutant subjects.
BRAF status may be assessed for example from tumor biopsy samples using known methods such as sequencing. In some embodiments, the subject has received or is ineligible to receive at least one prior therapeutic to treat the cancer.
In some embodiments, the subject has received one, two, three or more prior therapeutics to treat the cancer.
Therapeutics to treat various cancers are known, and include surgery, radiation therapy, chemotherapy, hormone therapy, immunotherapy, targeted therapy or any combination thereof.
Therapeutics to treat lung cancer, such as a non-small cell lung cancer (NSCLC) or a small cell lung cancer (SCLC) include methotrexate, paclitaxel (ABRAXANE®), afatinib (GILOTRIF®), everolimus (AFINITOR®), alectinib (ALECENSA®), pemetrexed disodium (ALIMTA®), bevacizumab (AVASTIN®), carboplatin, ceritinib (ZYKADIA®), crizotinib (XALKORI®), ramucirumab (CYRAMZA®), docetaxel, everolimus (AFINITOR®), gefitinib (IRESSA®), gemcitabine hydrochloride (GMEZAR®), pembrolizumab (KEYTRUDA®), mechlorethamine hydrochloride (MUSTARGEN®), vinorelbine tartrate (NAVELBINE®), necitumumab (PORTRAZZA®), nivolumab (OPDIVO®), carboplatin, pemetrexed disodium, ramucirumab (CYRAMZA®), osimertinib (TAGRISSO®), an anti-CTLA4 antibody, a
BRAF/MEK inhibitor or interferon alpha. An exemplary anti-CTLA4 antibody is ipilimumab (YERVOY®). Exemplary BRAF/MEK inhibitors are vemurafenib (ZELBORAF®), dabrafenib, encorafenib, cobimetinib (COTELLIC®), trametinib (MEKINIST®), and binimetinib.
Therapeutics to treat melanoma include Aldesleukin, cobimetinib (COTELLIC®), dabrafenib (TAFINLAR®), dacarbazine (DTIC-Dome®), talimogene laherparepvec (IMLYGIC®), ipilimumab (YERVOY®), pembrolizumab (KEYTRUDA®), trametinib (MEKINIST®), nivolumab (OPDIVO®), Peginterferon Alfa-2b (PEG-INTRON®, SYLATRON®), recombinant interferon Alfa-2b and vemurafenib (ZELBORAF®).
Therapeutics to treat a bladder cancer include surgery, chemotherapy (such as cisplatin, gemcitabine, carboplatin, methotrexate, vinblastine, doxorubicin or any combination thereof), immunotherapy (such as weakened bacterium bacillus Calmette-Guerin (BCG), interferon, atezolizumab (TECENTRIQ®), nivolumab (OPDIVO®), durvalumab (IMFINZI®), avelumab (BAVENCIO®), or pembrolizumab (KEYTRUDA®) or radiation therapy. Therapeutics to treat a renal cancer include everolimus (AFINITOR®), aldesleukin, bevacizumab (AVASTIN®), axitinib (INLYTA®), cabozantinib-S-Malate (CABOMETYX®), aldesleukin (PROLEUKIN®), lenvatinib mesylate (LENVIMA®), sorafenib tosylate (NEXAVAR®), nivolumab (OPDIVO®), pazopanib hydrochloride, sorafenib tosylate, sunitinib (SUTENT®), temsirolimus (TORISEL®) and pazopanib hydrochloride (VOTRIENT®). Therapeutics to treat a gastric cancer include surgery or chemotherapy (such as 5- fluorouracil or capecitabine, irinotecan, docetaxel or paclitaxel, or any combination thereof). Therapeutics to treat an esophageal cancer include surgery, endoscopic therapy, radiation therapy, chemotherapy or targeted immunotherapy.
Therapeutics to treat a colorectal cancer (CRC) include 5-fluorouracil and leucovorin, capecitabine (XELODA®), irinotecan (CAMPTOSAR®), cetuximab (ERBITUX®), panitumumab (VECTIBIX®), pegorafenib (STIVARGA®), a chemotherapy regimen of trifluridine and tiptracil (LONSURF®), FOLFOX: chemotherapy regimen of leucovorin, 5-fluorouracil and oxaliplatin (ELOXATIN®), FOLFIRI: chemotherapy regimen of leucovorin, 5-fluorouracil, and irinotecan (CAMPTOSAR®), CapeOX: chemotherapy regimen of capecitabine (XELODA®) and oxaliplatin (ELOXATIN®), FOLFOXIRI: chemotherapy regimen of leucovorin, 5-fluorouracil, oxaliplatin (ELOXATIN®), and irinotecan (CAMPTOSAR®), or any of the above individual agents or chemotherapy regiments in combination with each other or in combination with a drug that targets VEGF such as bevacizumab (AVASTIN®), ziv-aflibercept (ZALTRAP®) or ramucirumab (CYRAMZA®).
Therapeutics to treat thymus cancer include surgery, radiation therapy, a chemotherapy (such as carboplatin, cisplatin, cyclophosphamide, doxorubicin, etoposide, ifosfamide, octreotide, paclitaxel or pemetrexed, or any combination thereof) or a hormone therapy (such as
corticosteroids).
Radiation therapy includes external beam radiation, intensity modulated radiation therapy (IMRT), focused radiation, and any form of radiosurgery including Gamma Knife, Cyberlaiife, Linac, and interstitial radiation (for example implanted radioactive seeds, GliaSite balloon), and/or with surgery.
Focused radiation methods that may be used include stereotactic radiosurgery, fractionated stereotactic radiosurgery, and intensity-modulated radiation therapy (IMRT). It is apparent that stereotactic radiosurgery involves the precise delivery of radiation to a tumorous tissue, while avoiding the surrounding non-tumorous, normal tissue. The dosage of radiation applied using stereotactic radiosurgery may vary typically from 1 Gy to about 30 Gy, and may encompass intermediate ranges including, for example, from 1 to 5, 10, 15, 20, 25, up to 30 Gy in dosage. Because of noninvasive fixation devices, stereotactic radiation need not be delivered in a single treatment. The treatment plan may be reliably duplicated day-to-day, thereby allowing multiple fractionated dosages of radiation to be delivered. When used to treat a tumor over time, the radiosurgery is referred to as“fractionated stereotactic radiosurgery” or FSR. In contrast, stereotactic radiosurgery refers to a one-session treatment. Fractionated stereotactic radiosurgery may result in a high therapeutic ratio, i.e., a high rate of killing of tumor cells and a low effect on normal tissue. The tumor and the normal tissue respond differently to high single dosages of radiation vs. multiple smaller dosages of radiation. Single large dosages of radiation may kill more normal tissue than several smaller dosages of radiation may. Accordingly, multiple smaller dosages of radiation can kill more tumor cells while sparing normal tissue. The dosage of radiation applied using fractionated stereotactic radiation may vary from range from 1 Gy to about 50 Gy, and may encompass intermediate ranges including, for example, from 1 to 5, 10, 15, 20, 25, 30,40, up to 50 Gy in hypofractionated dosages. Intensity- modulated radiation therapy (IMRT) may also be used. IMRT is an advanced mode of high-precision three-dimensional conformal radiation therapy (3DCRT), which uses computer-controlled linear accelerators to deliver precise radiation dosages to a malignant tumor or specific areas within the tumor, the profile of each radiation beam is shaped to fit the profile of the target from a beam's eye view (BEV) using a multileaf collimator (MLC), thereby producing a number of beams. IMRT allows the radiation dosage to conform more precisely to the three-dimensional (3-D) shape of the tumor by modulating the intensity of the radiation beam in multiple small volumes. Accordingly, IMRT allows higher radiation dosages to be focused to regions within the tumor while minimizing the dosage to surrounding normal critical structures. IMRT improves the ability to conform the treatment volume to concave tumor shapes, for example, when the tumor is wrapped around a vulnerable structure, such as the spinal cord or a major organ or blood vessel. Suitable radiation sources for use as a cell conditioner include both solids and liquids.
In some embodiments the one, two, three or more prior therapeutics to treat the cancer are an anti-CTLA4 antibody, ipilimumab (YERVOY®), BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
“BRAF/MEK inhibitor” refers to a molecule, such as a small molecule, that inhibits at least one biological activity mediated by BRAF and/or MEK. The inhibition may be at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than in the absence of the inhibitor (e.g., negative control), or when the inhibition is statistically significant when compared to a control. Typical biological activities mediated by BRAF and/or MEK are protein phosphorylation, cell proliferation, cell survival and apoptosis, which can be measured using standard methods.
Exemplary BRAF inhibitors are vemurafenib (ZELBORAF®), pazopanib, dabrafenib and encorafenib.
Exemplary MEK inhibitors are cobimetinib (COTELLIC®), trametinib (MEKINIST®), and binimetinib. In some embodiments, the subject is resistant, refractory or resistant and refractory to the one, two, three or more prior therapeutics to treat the cancer, or any combination thereof.
In some embodiments, the subject is resistant, refractory or resistant and refractory to an anti-CTLA4 antibody, ipilimumab, BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
Various qualitative and/or quantitative methods may be used to determine relapse or refractory nature of the disease. Symptoms that may be associated with relapse or resistance are, for example, a decline or plateau of the well-being of the patient or re-establishment or worsening of various symptoms associated with solid tumors, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
“Pharmaceutically acceptable excipients” refer to solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, such as salts, buffers, antioxidants, saccharides, aqueous or non- aqueous carriers, preservatives, wetting agents, surfactants or emulsifying agents, or
combinations thereof.
Exemplary buffers that may be used are acetic acid, citric acid, formic acid, succinic acid, phosphoric acid, carbonic acid, malic acid, aspartic acid, histidine, boric acid, Tris buffers, HEPPSO and HEPES.
Exemplary antioxidants that may be used are ascorbic acid, methionine, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite, lecithin, citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol and tartaric acid.
Exemplary amino acids that may be used are histidine, isoleucine, methionine, glycine, arginine, lysine, L-leucine, tri-leucine, alanine, glutamic acid, L-threonine, and 2-phenylamine.
Exemplary surfactants that may be used are polysorbates (e.g., polysorbate-20 or polysorbate-80); polyoxamers (e.g., poloxamer 188); Triton; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g., lauroamidopropyl); myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl oleyl-taurate; and the MONAQUA™ series (Mona Industries, Inc., Paterson, N.J.), polyethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol (e.g., PLURONICS™, PF68, etc).
Exemplary preservatives that may be used are phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride, alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydro acetate and thimerosal, or mixtures thereof.
Exemplary saccharides that may be used are monosaccharides, disaccharides, trisaccharides, polysaccharides, sugar alcohols, reducing sugars, nonreducing sugars such as glucose, sucrose, trehalose, lactose, fructose, maltose, dextran, glycerin, dextran, erythritol, glycerol, arabitol, sylitol, sorbitol, mannitol, mellibiose, melezitose, raffinose, mannotriose, stachyose, maltose, lactulose, maltulose, glucitol, maltitol, lactitol or iso-maltulose.
Exemplary salts that may be used are acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like. An exemplary salt is sodium chloride.
The amounts of pharmaceutically acceptable carrier(s) in the pharmaceutical compositions may be determined experimentally based on the activities of the carrier(s) and the desired characteristics of the formulation, such as stability and/or minimal oxidation.
In some embodiments, the pharmaceutical composition comprises histidine.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 1 mM to about 50 mM.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 50 mM.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 30 mM.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 20 mM. In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 15 mM.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of from about 5 mM to about 10 mM.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of about 1 mM, about 2 mM, about 3 mM, about 4 mM, about 5 mM, about 6 mM, about 7 mM, about 8 mM, about 9 mM, about 10 mM, about 11 mM, about 12 mM, about 13 mM, about 14 mM, about 15 mM, about 16 mM, about 17 mM, about 18 mM, about 19 mM, about 20 mM, about 21 mM, about 22 mM, about 23 mM, about 24 mM, about 25 mM, about 26 mM, about 27 mM, about 28 mM, about 29 mM, about 30 mM, about 31 mM, about 32 mM, about 33 mM, about 34 mM, about 35 mM, about 36 mM, about 37 mM, about 38 mM, about 39 mM, about 40 mM, about 41 mM, about 42 mM, about 43 mM, about 44 mM, about 45 mM, about 46 mM, about 47 mM, about 48 mM, about 49 mM or about 50 mM.
In some embodiments, the pharmaceutical composition comprises histidine at a concentration of about 10 mM.
In some embodiments, the pharmaceutical composition comprises sucrose.
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of from about 1% (w/v) to about 20% (w/v).
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of from about 2% (w/v) to about 18% (w/v).
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of from about 4% (w/v) to about 16% (w/v).
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of from about 6% (w/v) to about 14% (w/v).
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of from about 6% (w/v) to about 12% (w/v).
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of from about 6% (w/v) to about 10% (w/v).
In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of about 1% (w/v), about 2% (w/v), about 3% (w/v), about 4% (w/v), about 5% (w/v), about 6% (w/v), about 7% (w/v), about 8% (w/v), about 9% (w/v), about 10% (w/v), about 11% (w/v), about 12% (w/v), about 13% (w/v), about 14% (w/v), about 15% (w/v), about 16% (w/v), about 17% (w/v), about 18% (w/v), about 19% (w/v) or about 20% (w/v), In some embodiments, the pharmaceutical composition comprises sucrose at a concentration of about 8% (w/v).
In some embodiments, the pharmaceutical composition comprises polysorbate-20.
In some embodiments, the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of from about 0.01% (w/v) to about 0.1% (w/v).
In some embodiments, the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of from about 0.01% (w/v) to about 0.08% (w/v).
In some embodiments, the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of from about 0.02% (w/v) to about 0.06% (w/v).
In some embodiments, the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of about 0.01% (w/v), about 0.02% (w/v), about 0.03% (w/v), about 0.04% (w/v), about 0.05% (w/v), about 0.06% (w/v), about 0.07% (w/v), about 0.08% (w/v), about 0.09% (w/v) or about 0.1% (w/v).
In some embodiments, the pharmaceutical composition comprises polysorbate-20 (PS- 20) at a concentration of about 0.04% (w/v).
In some embodiments, the pharmaceutical composition comprises EDTA.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of from about 1 pg/ml to about 50 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 50 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 30 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 20 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 15 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of from about 5 pg/ml to about 10 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of about 1 pg/ml, about 2 pg/ml, about 3 pg/ml, about 4 pg/ml, about 5 pg/ml, about 6 pg/ml, about 7 pg/ml, about 8 pg/ml, about 9 pg/ml, about 10 pg/ml, about 11 pg/ml, about 12 pg/ml, about 13 pg/ml, about 14 pg/ml, about 15 pg/ml, about 16 pg/ml, about 17 pg/ml, about 18 pg/ml, about 19 pg/ml, about 20 pg/ml, about 21 pg/ml, about 22 pg/ml, about 23 pg/ml, about 24 pg/ml, about 25 pg/ml, about 26 pg/ml, about 27 pg/ml, about 28 pg/ml, about 29 pg/ml, about 30 mi§/ ml. about 31 pg/ml, about 32 pg/ml, about 33 pg/ml, about 34 pg/ml, about 35 pg/ml, about 36 pg/ml, about 37 pg/ml, about 38 pg/ml, about 39 pg/ml, about 40 pg/ml, about 41 pg/ml, about 42 pg/ml, about 43 pg/ml, about 44 pg/ml, about 45 pg/ml, about 46 pg/ml, about 47 mi§/ ml. about 48 pg/ml, about 49 pg/ml or about 50 pg/ml.
In some embodiments, the pharmaceutical composition comprises EDTA at a concentration of about 20 pg/ml.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, histidine, sucrose, polysorbate-20 and EDTA.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided for administration as a lyophilized formulation comprising between about 90 mg and about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients. In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
In some embodiments, the lyophilized formulation, once reconstituted, comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the pharmaceutical composition is a liquid.
In some embodiments, the pharmaceutical composition is a frozen liquid.
In some embodiments, the pharmaceutical composition is a lyophilized powder.
In some embodiments, the pharmaceutical composition is provided in a volume of between about 1 ml to about 20 ml.
In some embodiments, the pharmaceutical composition is provided in a volume of about 1 ml, about 2 ml, about 3 ml, about 4 ml, about 5 ml, about 6 ml, about 7 ml, about 8 ml, about 9 ml, about 10 ml, about 11 ml, about 12 ml, about 13 ml, about 14 ml, about 15 ml, about 16 ml, about 17 ml, about 18 ml, about 19 ml or about 20 ml.
In some embodiments, the pharmaceutical composition is provided or reconstituted in a volume of about 3 ml.
In some embodiments, the pharmaceutical composition is provided or reconstituted in a volume of about 3.3 ml.
In some embodiments, the pharmaceutical composition is provided or reconstituted in a volume of about 8 ml.
In some embodiments, the pharmaceutical composition is provided or reconstituted in a volume of about 8.6 ml.
In some embodiments, the pharmaceutical composition is provided or reconstituted in a volume of about 8.8 ml.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5 in a volume of about 3.3 ml.
In some embodiments, the antagonistic anti-PD-l antibody is cetrelimab. Cetrelimab is an IgG4/K antibody characterized by following amino acid sequences: the HCDR1 of SEQ ID NO: 1, the HCDR2 of SEQ ID NO: 2, the HCDR3 of SEQ ID NO: 3, the LCDR1 of SEQ ID NO: 4, the LCDR2 of SEQ ID NO: 5, the LCDR6 of SEQ ID NO: 6, the VH of SEQ ID NO: 7, the VL of SEQ ID NO: 8, the HC of SEQ ID NO: 9 and the LC of SEQ ID NO: 10.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients that upon reconstitution into about 3.3 ml comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the antagonistic anti-PD-l antibody is cetrelimab.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered or provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients that upon reconstitution into about 8.6 ml comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the antagonistic anti-PD-l antibody is cetrelimab.
"Lyophilization," "lyophilized," and "freeze-dried" refer to a process by which the material to be dried is first frozen and then the ice or frozen solvent is removed by sublimation in a vacuum environment. An excipient may be included in pre-lyophilized formulations to enhance stability of the lyophilized product upon storage.
“Reconstitute”,“reconstituted” or“reconstitution” refers to dissolving the lyophilized formulation in a diluent so that the protein in the lyophilized formulation is dispersed in the reconstituted formulation. The reconstituted formulation is suitable for administration, e.g. parenteral administration), and may optionally be suitable for subcutaneous administration. In some embodiments, the diluent is sterile water for injection (sWFI).
“Pharmaceutical composition”,“pharmaceutical formulation“or“formulation” refers to a combination of an active ingredient (e.g. the anti-PD-l antibody) and one or more excipients in either liquid or solid (e.g. lyophilized) form.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by an intravenous infusion. In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is diluted into a volume of between about 100 ml and 1000 ml prior to administration.
In some embodiments, duration of the intravenous infusion is between about 20 minutes and about 80 minutes.
In some embodiments, duration of the intravenous infusion is about 20, about 30, about 40, about 50, about 60, about 70 or about 80 minutes.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by one or more subcutaneous injections.
The invention also provides a method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks, wherein the subject is PD-l axis naive, has received and/or is ineligible for at least one prior therapeutic for the treatment of the cancer, or any combination thereof.
In some embodiments, the method achieves an overall response rate (ORR) of at least 15% in a group of subjects diagnosed with the cancer. ORR is defined as a percentage of subjects achieving partial response (PR) or complete response (CR). ORR may be assessed per the Response Evaluation Criteria in Solid Tumors (RECIST) vl.1 or per irRC in subjects with selected advanced solid tumors (irRC = - IRRC = Immune-Related Response Criteria from Wolchok et al. (2009) Clin Cancer Res 15 : 7412-20).
In some embodiments, the ORR of at least about 15% is achieved after a median duration of treatment of about 1 ½ months or more.
In some embodiments, the ORR of at least about 15% is achieved after a median duration of treatment of about 1 months or more, about 2 months or more, about 3 months or more, about 4 months or more, about 5 months or more, about 6 months or more, about 7 months or more, about 8 months or more, about 9 months or more, about 10 months or more, about 11 months or more, or about 12 months or more.
In some embodiments, the method achieves an ORR of at least about 19% in the group of subjects diagnosed with the cancer.
In some embodiments, the cancer is the NSCLC. In some embodiments, the method achieves an ORR of at least about 30% in a group of subjects diagnosed with PD-L1 high NSCLC or an ORR of at least about 25% in a group of subjects whose PD-L1 expression in the cancer is undetermined.
In some embodiments, the method achieves an ORR of at least about 35% in the group of subjects diagnosed with PD-L1 high NSCLC.
In some embodiments, the cancer is the melanoma.
In some embodiments, the method achieves or an ORR of at least about 25% in a group of subjects diagnosed with melanoma.
In some embodiments, the melanoma is a non-uveal melanoma.
In some embodiments, the method achieves an ORR of at least about 30% in a group of subjects diagnosed with the non-uveal melanoma.
In some embodiments, the method achieves an ORR of at least about 35% in a group of subjects diagnosed with MSI-H CRC.
In some embodiments, the method achieves an ORR of at least about 35% in a group of subjects diagnosed with dMMR CRC.
The invention also provides a method of treating a colorectal cancer (CRC), comprising administering to a subject diagnosed with the CRC an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the CRC.
The invention also provides a method of treating a mismatch repair-deficient (dMMR) colorectal cancer (CRC) or high-level microsatellite instability (MSI-H) CRC, comprising administering to a subject diagnosed with the dMMR CRC or MSI-H CRC an antagonistic anti- PDl antibody or an antigen binding fragment thereof comprising a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the dMMR CRC or the MSI-H CRC.
Approximately 15 % of colorectal carcinomas (CRC) have deficient DNA mismatch repair (dMMR) which is characterized by microsatellite instability (MSI) in the tumor. Tumors with the dMMR/MSI result typically from germline mutation in one of the MMR genes or somatic inactivation of the same pathway. dMMR/MSI tumors include hereditary non-polyposis colorectal cancer (HNPCC), also called Lynch syndrome and sporadic MSI-H CRC. Lynch syndrome is caused by germline mutations in MMR genes MLH1, MSH2, MSH6 or PMS2, or epigenetic inactivation of MSH2. Sporadic MSI-H CRCs are frequently caused by methylation of MLH1 promoter. A subset of MSI-H tumors has no alterations in the MMR genes themselves, but instead overexpress various miRNAs that may silence the MMR genes. For example, miRNA-2l found overexpressed in MSI-H CRC targets MSH2 and MSH6 mRNA.
MSI-H CRC can be detected using polymerase chain reaction (PCR) of tumor tissue samples detecting stability of microsatellite markers. CRC is classified as MSI-H if instability is shown in 30% or more of microsatellite markers with at least 5 markers evaluated. The National Cancer Institute has recommended a panel of 5 microsatellites for MSI screening: BAT25 and BAT26 (mononucleotide repeats), D2S123, D5S346, and D17S250 (dinucleotide repeats).
dMMR can be detected using immunohistochemistry of tumor tissues. CRC is classified as dMMR if loss of at least one MMR genes MLH1, MSH2, MSH6 or PMS2 is detected in the tumor tissue.
In some embodiments, the CRC is a stage II CRC or a stage III CRC. CRC staging is known, using for example the American Joint Committee on Cancer (AJCC) TNM system and diagnosis by an oncologist.
In some embodiments, the subject diagnosed with CRC is refractory to treatment with fluoropyrimidine, oxaliplatin or irinotecan, or any combination thereof.
In some embodiments, the subject diagnosed with CRC has a relapsed tumor after treatment with fluoropyrimidine, oxaliplatin or irinotecan, or any combination thereof.
Various qualitative and/or quantitative methods may be used to determine relapse or refractory nature of the disease. Symptoms that may be associated with relapse or refractory disease are, for example, a decline or plateau of the well-being of the patient or re-establishment or worsening of various symptoms associated with tumors, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a HCDR1 of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a LCDR1 of SEQ ID NO: 4, a LCDR2 or SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the thymus cancer.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) of SEQ ID NO: 8 for a time sufficient to treat the thymus cancer. The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 for a time sufficient to treat the thymus cancer.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of between about 80 mg and about 1000 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 80 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 160 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 320 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 400 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks. The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 560 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 720 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 800 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 880 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
The invention also provides a method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10 at a dosage of about 960 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
In some embodiments, the thymus cancer is a thymoma.
In some embodiments, the thymoma is a type A thymoma.
In some embodiments, the thymoma is a type AB thymoma.
In some embodiments, the thymoma is a type Bl thymoma. In some embodiments, the thymoma is a type B2 thymoma.
In some embodiments, the thymoma is a type B3 thymoma.
In some embodiments, the thymus cancer is a thymic carcinoma.
In some embodiments, the thymic carcinoma is a low grade thymic carcinoma.
In some embodiments, the thymic carcinoma is high grade thymic carcinoma.
In some embodiments, the thymus cancer is a metastatic thymic cancer.
In some embodiments, the thymus cancer has metastasized to lung, lymph node, heart or bone.
In some embodiments, the subject has been treated with surgery, radiation therapy, a chemotherapy or a hormone therapy.
In some embodiments, the subject has been treated with carboplatin, cisplatin, cyclophosphamide, doxorubicin, etoposide, ifosfamide, octreotide, paclitaxel or pemetrexed, or any combination thereof.
Thymus cancer may be staged for example according to the American Society of Clinical Oncology (ASCO) staging system.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof comprises a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) or SEQ ID NO: 8.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgGl, an IgG2, and IgG3 or an IgG4 isotype.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgG4 isotype.
In some embodiments, the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgG4 isotype and comprises proline at position 228, residue numbering according to the EU Index.
In some embodiments, the antagonistic anti-PD-l antibody is a nG4m(a) allotype.
In some embodiments, the antagonistic anti-PD-l antibody or an antigen binding fragment thereof has at least one substitution in an Fc region to modulate antibody effector functions or antibody half-life.
In some embodiments, the antagonistic anti-PD-l antibody comprises a heavy chain of SEQ ID NO: 9 and a light chain of SEQ ID NO: 10.
The invention also provides a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody comprising the HC of SEQ ID NO: 9 and the LC of SEQ ID NO: 10, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate 20 and about 20 pg/ml and EDTA at pH 6.5.
SEQ ID NO: 1
SYAIS
SEQ ID NO: 2
GIIPIFDTANYAQKFQG
SEQ ID NO: 3
PGL AAAYDT GSLD Y
SEQ ID NO: 4
RASQSVRSYLA
SEQ ID NO: 5
DASNRAT
SEQ ID NO: 6
QQRNYWPLT
SEQ ID NO: 7
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFDTAN
YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARPGLAAAYDTGSLDYWGQGT
LVTVSS
SEQ ID NO: 8
EIVLTQSPATLSLSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLIYDASNRATGIPAR
FSGSGSGTDFTLTISSLEPEDFAVYYCQQRNYWPLTFGQGTKVEIK
SEQ ID NO: 9
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFDTAN
YAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARPGLAAAYDTGSLDYWGQGT
LVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFL GGPSVFLFPPKPKDTLMISRTPEVT CVVVDV S QEDPEV QFNWYVDGVEVHNAKTKPREE QFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPS QEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVD KSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
SEQ ID NO: 10
EIVLTQSPATLSLSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLIYDASNRATGIPAR
FSGSGSGTDFTLTISSLEPEDFAVYYCQQRNYWPLTFGQGTKVEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
KADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
The invention also provides a pharmaceutical composition comprising
between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
pharmaceutically acceptable excipients; or
a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
pharmaceutically acceptable excipients.
In some embodiments, the lyophilized formulation, once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
The invention also provides a drug product comprising
between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5; about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients;
a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
pharmaceutically acceptable excipients; or
a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
pharmaceutically acceptable excipients.
In some embodiments, the lyophilized formulation, once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the lyophilized formulation is reconstituted into sterile water for injection (sWFI).
The invention also provides a drug product comprising about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5 in a volume of about 3.3 ml.
The invention also provides a drug product comprising a lyophilized formulation comprising about 90 mg cetrelimab that upon reconstitution into about 3.3 ml comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
The invention also provides a drug product comprising a lyophilized formulation comprising about 240 mg cetrelimab that upon reconstitution into about 8.6 ml comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
The invention also provides a drug product comprising
between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
a lyophilized formulation comprising between about 90 mg and about 240 mg of cetrelimab and one or more pharmaceutically acceptable excipients; a lyophilized formulation comprising about 90 mg of cetrelimab and one or more
pharmaceutically acceptable excipients; or
a lyophilized formulation comprising about 240 mg of cetrelimab and one or more
pharmaceutically acceptable excipients,
for the treatment of a cancer.
In some embodiments, the lyophilized formulation, once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
In some embodiments, the drug product is provided for the treatment of a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer, a prostate cancer, a basal cell carcinoma and an advanced cutaneous squamous cell carcinoma (CSCC), or any combination thereof.
In some embodiments, the drug product is provided for the treatment of a NSCLC, a melanoma, a bladder cancer, a renal cell carcinoma, a SLCL, a CRC, a gastric cancer, a prostate cancer, or an esophageal cancer.
In some embodiments, the drug product is provided for the treatment of PD-L1 high NSCLC.
In some embodiments, the drug product is provided for the treatment of a MSI-H CRC or a dMMR CRC.
In some embodiments, the drug product is provided for the treatment of a non-uveal melanoma.
In some embodiments, the drug product is administered
at a dosage of about 240 mg once in two weeks;
at a dosage of about 480 mg once in four weeks; or
as an initial dose of about 240 mg followed by a second dose of about 480 mg six weeks after the initial dose, and thereafter about 480 mg once in four weeks; or as an initial dose of about 240 mg followed by a second dose of about 480 mg six weeks after the initial dose, and thereafter about 240 mg once in two weeks.
In some embodiments, the drug product the drug product is administered by an intravenous administration of by a subcutaneous administration, or a combination thereof.
Generation of antibodies used in the methods of the invention
Antagonistic anti-PD-l antibodies or antigen-binding fragments thereof used in the methods of the invention may be generated using various technologies. For example, the hybridoma method of Kohler and Milstein may be used to generate monoclonal antibodies. In the hybridoma method, a mouse or other host animal, such as a hamster, rat or monkey, is immunized with human and/or cyno PD-l antigens, such as the extracellular domain of PD-l, followed by fusion of spleen cells from immunized animals with myeloma cells using standard methods to form hybridoma cells. Colonies arising from single immortalized hybridoma cells may be screened for production of antibodies with desired properties, such as specificity of binding, cross-reactivity or lack thereof, affinity for the antigen, and functionality such as antagonistic activity.
Exemplary humanization techniques including selection of human acceptor frameworks include CDR grafting (U.S. Patent No. 5,225,539), SDR grafting (U.S. Patent No. 6,818,749), Resurfacing (Padlan, (1991) Mol Immunol 28:489-499), Specificity Determining Residues Resurfacing (U.S. Patent Publ. No. 2010/0261620), human framework adaptation (U.S. Patent No. 8,748,356) or superhumanization (U.S. Patent No. 7,709, 226). In these methods, CDRs or a subset of CDR residues of parental antibodies are transferred onto human frameworks that may be selected based on their overall homology to the parental frameworks, based on similarity in CDR length, or canonical structure identity, or a combination thereof.
Humanized antibodies may be further optimized to improve their selectivity or affinity to a desired antigen by incorporating altered framework support residues to preserve binding affinity (backmutations) by techniques such as those described in Int. Patent Publ. Nos. W01090/007861 and W01992/22653, or by introducing variation at any of the CDRs for example to improve affinity of the antibody.
Transgenic animals, such as mice or rat carrying human immunoglobulin (Ig) loci in their genome may be used to generate antibodies against PD-l, and are described in for example U.S. Patent No. 6,150,584, Int. Patent Publ. No. W01999/45962, Int. Patent Publ. Nos.
W02002/066630, WO2002/43478, W02002/043478 and W01990/04036. The endogenous immunoglobulin loci in such animal may be disrupted or deleted, and at least one complete or partial human immunoglobulin locus may be inserted into the genome of the animal using homologous or non-homologous recombination, using transchromosomes, or using minigenes. Companies such as Regeneron (http://_www_regeneron_com), Harbour Antibodies
(http://_www_harbourantibodies_com), Open Monoclonal Technology, Inc. (OMT)
(http://_www_omtinc_net), KyMab (http://_www_kymab_com), Trianni
(http://_www.trianni_com) and Ablexis (http://_www_ablexis_com) may be engaged to provide human antibodies directed against a selected antigen using technologies as described above.
Antibodies may be selected from a phage display library, where the phage is engineered to express human immunoglobulins or portions thereof such as Fabs, single chain antibodies (scFv), or unpaired or paired antibody variable regions. The antibodies of the invention may be isolated for example from phage display library expressing antibody heavy and light chain variable regions as fusion proteins with bacteriophage pIX coat protein as described in Shi et al, (2010) J Mol Biol 397:385-96, and Int. Patent Publ. No. WO09/085462). The libraries may be screened for phage binding to human and/or cyno PD-l and the obtained positive clones may be further characterized, the Fabs isolated from the clone lysates, and expressed as full length IgGs.
The CDRs of an antibody may be grafted on any human framework and the functionality of the resulting antibody may be tested. For example, antibody JNJ-63723283 comprises frameworks derived from human germline genes IGHV1-69 and IGKV3-11. Alternatively, JNJ- 63723283 HCDRs may be grafted to other IGHV1 germline gene subgroup frameworks and the LCDRs may be grafted to other IGKV3 germline gene subgroup frameworks and the resulting antibodies are tested for desired functionality. The human germline gene sequences are well known and can be retrieved for example from ImMunoGeneTics Information System®.
Preparation of immunogenic antigens and monoclonal antibody production may be performed using any suitable technique, such as recombinant protein production. The immunogenic antigens may be administered to an animal in the form of purified protein, or protein mixtures including whole cells or cell or tissue extracts, or the antigen may be formed de novo in the animal’s body from nucleic acids encoding said antigen or a portion thereof.
Methods of producing antibodies
Methods of producing antibodies at large scales are known. Antibodies may be produced for example in CHO cells cultured using known methods. The antibody may be isolated and/or purified from culture medium by removing solids by centrifugation or filtering as a first step in the purification process. The antibody may be further purified by standard methods including chromatography (e.g., ion exchange, affinity, size exclusion, and hydroxyapatite chromatography), gel filtration, centrifugation, or differential solubility, ethanol precipitation or by any other available technique for the purification of antibodies. Protease inhibitors such as phenyl methyl sulfonyl fluoride (PMSF), leupeptin, pepstatin or aprotinin can be added at any or all stages to reduce or eliminate degradation of the antibody during the purification process. One of ordinary skill in the art will appreciate that the exact purification technique will vary depending on the character of the polypeptide or protein to be purified, the character of the cells from which the polypeptide or protein is expressed, and the composition of the medium in which the cells were grown.
Further embodiments of the invention
Set out below are certain further embodiments of the invention according to the disclosures elsewhere herein. Features from embodiments of the invention set out above described as relating to the invention disclosed herein also relate to each and every one of these further numbered embodiments.
1) An antagonistic anti-PDl antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for use in treating a subject having a cancer, wherein the antagonistic anti-PD-1 antibody is administered at a dose of between about 240 mg and about 480 mg.
2) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 1, wherein the antagonistic anti-PD-1 antibody or the antigen binding fragment thereof is administered once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
3) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 1 or 2, wherein the antagonistic anti-PD-1 antibody or the antigen binding fragment thereof is administered
a) at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks;
b) at the dosage of about 240 mg once every two weeks;
c) at the dosage of about 240 mg once every three weeks;
d) at the dosage of about 240 mg once every four weeks;
e) at the dosage of about 240 mg once every five weeks; f) at the dosage of about 240 mg once every six weeks;
g) at the dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks;
h) at the dosage of about 480 mg once every two weeks;
i) at the dosage of about 480 mg once every three weeks;
j) at the dosage of about 480 mg once every four weeks;
k) at the dosage of about 480 mg once every five weeks; or
l) at the dosage of about 480 mg once every six weeks.
) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 1 or 2, wherein the cancer is a solid tumor.
) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-4, wherein the solid tumor is an advanced solid tumor.
) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-5, wherein the cancer is selected from the group consisting of a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer, a prostate cancer, a basal cell carcinoma and an advanced cutaneous squamous cell carcinoma (CSCC), or any combination thereof.
) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-6, wherein the subject is PD-l axis naive.
) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-7, wherein the subject has received one, two, three or more prior therapeutics to treat the cancer.
) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-8, wherein the one, two, three or more prior therapeutics to treat the cancer are an anti-CTLA4 antibody, ipilimumab, BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof. 10) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-9, wherein the subject is resistant, refractory or resistant and refractory to the one, two, three or more prior therapeutics to treat the cancer, or any combination thereof.
11) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-10, wherein the one, two, three or more prior therapeutics to treat the cancer are an anti-CTLA4 antibody, ipilimumab, BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
12) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-11, wherein the cancer is PD-L1 positive.
13) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-12, wherein the cancer is PD-L1 high.
14) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-13, wherein PD-L1 expression in the cancer is undetermined.
15) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-14, wherein the cancer expresses a mutant BRAF.
16) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-15, wherein the mutant BRAF comprises a V600E mutation.
17) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-16, wherein the cancer expresses a wild-type BRAF.
18) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-17, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is
a) administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) administered or provided for administration in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) administered or provided for administration in a pharmaceutical composition comprising about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) provided for administration as a lyophilized formulation comprising between about 90 mg and about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients;
e) provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients; or
f) provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
19) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-18, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
20) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-19, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by an intravenous infusion.
21) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-20, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by a subcutaneous injection.
22) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-21, wherein the method achieves an overall response rate (ORR) of at least about 15% in a group of subjects diagnosed with the cancer.
23) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 22, wherein the ORR of at least about 15% is achieved after a median duration of treatment of about 1 1/2 months or more.
24) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 22 or 23, wherein the method achieves an ORR of at least about 19% in the group of subjects diagnosed with the cancer.
25) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 6, wherein the cancer is the non-small cell lung cancer (NSCLC). 26) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 25, wherein the method achieves an ORR of at least about 30% in a group of subjects diagnosed with PD-L1 high NSCLC or an ORR of at least about 25% in a group of subjects whose PD-L1 expression in the cancer is undetermined.
27) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 25 or 26, wherein the method achieves an ORR of at least about 35% in the group of subjects diagnosed with PD-L1 high NSCLC.
28) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 6, wherein the cancer is the melanoma.
29) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 28, wherein the method achieves an ORR of at least about 25% in a group of subjects diagnosed with the melanoma.
30) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 28 or 29, wherein the melanoma is a non-uveal melanoma.
31) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 30, wherein the method achieves an ORR of at least about 30% in a group of subjects diagnosed with the non-uveal melanoma.
32) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 31, wherein the CRC is a microsatellite instability -high (MSI-H) CRC or a mismatch repair-deficient (dMMR) CRC, or a combination thereof.
33) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to embodiment 32, wherein the CRC is a stage II CRC or a stage III CRC.
34) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-33, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof comprises a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) or SEQ ID NO: 8.
35) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-34, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgGl, an IgG2, an IgG3 or an IgG4 isotype.
36) The antagonistic anti-PDl antibody or the antigen binding fragment thereof for use according to any one of embodiments 1-35, wherein the antagonistic anti-PD-l antibody comprises a heavy chain of SEQ ID NO: 9 and a light chain of SEQ ID NO: 10.
37) A pharmaceutical composition comprising a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) a lyophilized formulation comprising between about 90 mg and about 240 mg of
cetrelimab and one or more pharmaceutically acceptable excipients;
e) a lyophilized formulation comprising about 90 mg cetrelimab and one or more
pharmaceutically acceptable excipients; or
f) a lyophilized formulation comprising about 240 mg cetrelimab and one or more
pharmaceutically acceptable excipients.
) The pharmaceutical composition of embodiment 37, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
) A drug product comprising
a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) a lyophilized formulation comprising between about 90 mg and about 240 mg cetrelimab and one or more pharmaceutically acceptable excipients;
e) a lyophilized formulation comprising about 90 mg cetrelimab and one or more
pharmaceutically acceptable excipients; or
f) a lyophilized formulation comprising about 240 mg cetrelimab and one or more
pharmaceutically acceptable excipients.
) The drug product of embodiment 39, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5. ) A drug product comprising
a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) a lyophilized formulation comprising between about 90 mg and about 240 mg cetrelimab and one or more pharmaceutically acceptable excipients;
e) a lyophilized formulation comprising about 90 mg cetrelimab and one or more
pharmaceutically acceptable excipients; or
f) a lyophilized formulation comprising about 240 mg cetrelimab and one or more
pharmaceutically acceptable excipients,
for use in treating a subject having a cancer.
) The drug product of embodiment 41, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.) The drug product of embodiment 41, wherein the cancer is a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a
gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer, a prostate cancer, a basal cell carcinoma and an advanced cutaneous squamous cell carcinoma (CSCC), or any combination thereof.
) The drug product of embodiment 43, wherein
a) the NSCLC is PD-L 1 high NSCLC;
b) the CRC is a MSI-H CRC or a dMMR CRC; or
c) the melanoma is a non-uveal melanoma; or any combination thereof. 45) The drug product of embodiment 41, wherein the drug product is administered
a) at a dosage of about 240 mg once in two weeks;
b) at a dosage of about 480 mg once in four weeks; or
c) as an initial dose of about 240 mg followed by a second dose of about 480 mg six weeks after the initial dose, and thereafter about 480 mg once in four weeks; or
d) as an initial dose of about 240 mg followed by a second dose of about 480 mg six weeks after the initial dose, and thereafter about 240 mg once in two weeks.
46) The drug product of embodiment 41, wherein the drug product is administered by an
intravenous administration of by a subcutaneous administration, or a combination thereof.
47) A method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PD 1 antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDRT) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dosage of between about 80 mg and about 1000 mg once every 2, 3, 4, 5 or 6 weeks.
48) The method of embodiment 47, comprising providing an antagonistic anti-PD 1 antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDRT) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for administration at a dosage of between about 80 mg and about 1000 mg once every 2, 3, 4, 5 or 6 weeks to a subject diagnosed with the cancer, and administering the antagonistic anti-PD- 1 antibody or the antigen binding fragment thereof to the subject diagnosed with the cancer.
49) The method of embodiment 48, wherein the cancer is an advanced solid tumor.
50) The method of any one of embodiments 47-49, where the subject has received or is ineligible to receive at least one prior therapeutic to treat the cancer.
51) The method of any one of embodiments 47-50, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at a dosage of about 80 mg, about 160 mg, about 240 mg, about 320 mg, about 400 mg, about 480 mg, about 560 mg, about 720 mg, about 800 mg, about 880 mg or about 960 mg once every 2, 3, 4, 5 or 6 weeks.
52) The method of any one of embodiments 47-51, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered at the dosage of about 240 mg once every 2 weeks or at the dosage of about 480 mg once every 4 weeks. 53) The method of any one of embodiments 47-52, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is provided in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM Histidine, about 8.0% (w/v) Sucrose, about 0.04%
Polysorbate-20 and about 20 pg/ml and EDTA at pH 6.5.
54) The method of any one of embodiments 47-53, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by an intravenous infusion.
55) The method of any one of embodiments 47-54, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is diluted into a volume of between about 100 ml and 1000 ml prior to administration.
56) The method of any one of embodiments 47-55, wherein duration of the intravenous infusion is between about 20 minutes and about 80 minutes.
57) The method of any one of embodiments 47-56, wherein duration of the intravenous infusion is about 20, about 30, about 40, about 50, about 60, about 70 or about 80 minutes.
58) The method of any one of embodiments 47-57, wherein the cancer is selected from the group consisting of a thymus cancer, a non-small cell lung cancer (NSCLC), a small cell lung cancer (SCLC), a melanoma, a bladder cancer, a renal cancer, a gastric cancer, an esophageal cancer and a colorectal cancer (CRC).
59) The method of any one of embodiments 47-58, wherein the thymus cancer is a thymoma, a thymic carcinoma or a metastatic thymic cancer, or any combination thereof.
60) The method of any one of embodiments 47-59, wherein the thymoma is a type A thymoma, a type AB thymoma, a type Bl thymoma, a type B2 thymoma or a type B3 thymoma.
61) The method of any one of embodiments 47-60, wherein the thymic carcinoma is a low grade thymic carcinoma or a high grade thymic carcinoma.
62) The method of any one of embodiments 47-61, wherein the thymus cancer has metastasized to lung, lymph node, heart or bone.
63) The method of any one of embodiments 47-62, wherein the subject has been treated with surgery, radiation therapy, a chemotherapy or a hormone therapy.
64) The method of any one of embodiments 47-63, wherein the chemotherapy is carboplatin, cisplatin, cyclophosphamide, doxorubicin, etoposide, ifosfamide, octreotide, paclitaxel or pemetrexed, or any combination thereof.
65) The method of any one of embodiments 47-64, wherein the CRC is a microsatellite
instability-high (MSI-H) CRC or a mismatch repair-deficient (dMMR) CRC, or a combination thereof. 66) The method of any one of embodiments 47-65, wherein the CRC is a stage II CRC or a stage III CRC.
67) The method of any one of embodiments 47-66, wherein the subject is refractory to treatment with or has a relapsed CRC after treatment with fluoropyrimidine, oxaliplatin or irinotecan, or any combination thereof.
68) The method of any one of embodiments 47-67, wherein the subject is PD-l axis naive.
69) The method of any one of embodiments 47-68, wherein the subject is PD-l axis naive and has received at least one prior therapeutic to treat the cancer.
70) The method of any one of embodiments 47-69, wherein the cancer is PD-L1 positive.
71) The method of any one of embodiments 47-70, wherein the cancer is PD-L1 high.
72) The method of any one of embodiments 47-71, wherein the method achieves an overall
response rate (ORR) of at least 15% in a group of subjects diagnosed with the cancer.
73) The method of any one of embodiments 47-72, wherein the method achieves an ORR of at least about 35% in a group of subjects diagnosed with MSI-H CRC, an ORR of at least about 35% in a group of subjects diagnosed with dMMR CRC, an ORR of at least about 30% in a group of subjects diagnosed with PD-L1 high NSCLC, or an ORR of at least about 25% in a group of subjects diagnosed with melanoma, or any combination thereof.
74) The method of any one of embodiments 47-73, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof comprises a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) or SEQ ID NO: 8.
75) The method of any one of embodiments 47-74, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgGl, an IgG2, and IgG3 or an IgG4 isotype.
76) The method of any one of embodiments 47-75, wherein the antagonistic anti-PD-l antibody comprises a heavy chain of SEQ ID NO: 9 and a light chain of SEQ ID NO: 10.
77) A pharmaceutical composition comprising about 10 mg/ml of an antagonistic anti-PD-l antibody comprising a heavy chain (HC) of SEQ ID NO: 9 and a light chain (LC) of SEQ ID NO: 10, about 10 mM Histidine, about 8.0% (w/v) Sucrose, about 0.04% Polysorbate-20 and about 20 pg/ml and EDTA at pH 6.5.
78) A method of treating a thymus cancer, comprising administering to a subject diagnosed with the thymus cancer an antagonistic anti-PDl antibody or an antigen binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 for a time sufficient to treat the thymus cancer. 79) The method of any embodiment 78, wherein the thymus cancer is a thymoma, a thymic carcinoma or a metastatic thymic cancer, or any combination thereof.
80) The method of any embodiment 78 or 79, wherein the thymoma is a type A thymoma, a type AB thymoma, a type Bl thymoma, a type B2 thymoma or a type B3 thymoma.
81) The method of any one of embodiments 78-80, wherein the thymic carcinoma is a low grade thymic carcinoma or a high grade thymic carcinoma.
82) The method of any one of embodiments 78-81, wherein the thymus cancer has metastasized to lung, lymph node, heart or bone.
83) The method of any one of embodiments 78-82, wherein the subject has been or will be treated with surgery, radiation therapy, a chemotherapy or a hormone therapy, or any combination thereof.
84) The method of any one of embodiments 78-83, wherein the chemotherapy is carboplatin, cisplatin, cyclophosphamide, doxorubicin, etoposide, ifosfamide, octreotide, paclitaxel or pemetrexed, or any combination thereof.
85) The method of any one of embodiments 78-84, wherein the subject is PD-l axis naive, has received and/or is ineligible to receive at least one prior therapeutic to treat the cancer, or any combination thereof.
86) The method of any one of embodiments 78-85, wherein the subject is PD-l axis naive and has received at least one prior therapeutic to treat the cancer.
87) The method of any one of embodiments 78-86, wherein the cancer is PD-L1 positive.
88) The method of any one of embodiments 78-87, wherein the cancer is PD-L1 high.
89) The method of any one of embodiments 78-88, wherein the method achieves an overall response rate (ORR) of at least 15% in a group of subjects diagnosed with the cancer.
90) The method of any one of embodiments 78-89, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof comprises a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) or SEQ ID NO: 8.
91) The method of any one of embodiments 78-90, wherein the antagonistic anti-PD-l antibody is an IgGl, an IgG2, and IgG3 or an IgG4 isotype.
92) The method of any one of embodiments 78-91, wherein the antagonistic anti-PD-l antibody comprises a heavy chain of SEQ ID NO: 9 and a light chain of SEQ ID NO: 10.
93) The method of any one of embodiments 78-92, wherein the antagonistic anti-PDl antibody or the antigen binding fragment thereof is provided in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM Histidine, about 8.0% (w/v) Sucrose, about 0.04% Polysorbate-20 and about 20 pg/ml and EDTA at pH 6.5.
The present invention will now be described with reference to the following specific, non-limiting examples.
Example 1. A First-in-Human, Open-label, Phase 1/2 Study to Evaluate the Safety, Pharmacokinetics, Pharmacodynamics, and Clinical Activity of JNJ-63723283 (cetrelimab), an Anti-PD-1 Monoclonal Antibody, in Subjects with Advanced Cancers (NCT02908906)
This is a first-in-human (FIH), Phase 1/2, open-label, multicenter study to establish RP2D(s) for JNJ-63723283 in Part 1 and to evaluate the safety and efficacy of the RP2D(s) in Part 2. Part 1 will consist of dosage escalation cohorts and pharmacokinetic/pharmacodynamic cohorts. In Part 2, 1 or more RP2D(s) determined in Part 1 will be evaluated in selected solid tumor types including NSCLC, melanoma, bladder cancer, renal cancer, small-cell lung cancer (SCLC), gastric/esophageal cancer, MSI-H or dMMR CRC, and thymoma (including thymic carcinoma). The overall safety of JNJ-63723283 will be assessed by the Safety Evaluation Team (SET). Subjects will continue to receive JNJ-63723283 until disease progression, unacceptable toxicity, withdrawal of consent, or end of study.
Primary objective:
• To identify the recommended Phase 2 dosage(s) (RP2D[sj) for JNJ-63723283 (Part 1)
• To assess the anti-tumor activity of JNJ-63723283 at the RP2D(s) in subjects with selected advanced cancers including NSCLC, melanoma, renal, bladder, SCLC, gastric/esophageal cancer, high-level microsatellite instability (MSI-H) or mismatch repair-deficient (dMMR) colorectal cancer (CRC), and thymoma (Part 2)
Secondary objectives:
• To characterize the safety of JNJ-63723283 in subjects with advanced solid tumors
• To characterize the pharmacokinetics of JNJ-63723283 administered intravenously
• To assess the immunogenicity of JNJ-63723283
• To assess the clinical activity of JNJ-63723283 Primary endpoint(s)
• Frequency and severity of dosage-limiting toxicity (DLT)
• Overall response rate (ORR) per the Response Evaluation Criteria in Solid Tumors (RECIST) vl. l in subjects with selected advanced solid tumors
Secondary endpoint(s)
• Safety profile of JNJ-63723283 (safety parameters include but are not limited to the
frequency and severity of adverse events [AEs] and immune-related AEs [irAEs], vital signs measurements, clinical laboratory values, and electrocardiograms [ECGs])
• Serum JNJ-63723283 pharmacokinetic parameters including but not limited to maximum observed serum concentration (Cmax), area under the concentration-time curve between 2 defined sampling points, tl and t2 (AUCtl-t2), half-life (T 1/2), total systemic clearance of drug after IV administration (CL), volume of distribution at steady-state (Vss), and accumulation ratio (R)
• Presence of anti- JNJ-63723283 antibodies and effect on serum JNJ-63723283 concentrations
• ORR per the Immune-Related Response Criteria (irRC), duration of response (DOR), clinical benefit rate (CBR), and progression-free survival by both RECIST v. l. l and irRC, and OS
Exploratory:
• To characterize the pharmacodynamics of JNJ-63723283 including quantification of JNJ- 63723283 receptor occupancy on peripheral T cells and cytokine responses to ex vivo stimulation of peripheral T cells
• To explore the relationships between pharmacokinetics, pharmacodynamics, AE profiles, and clinical activity of JNJ-63723283
Subject population
Subjects must be >18 years of age and have an Eastern Cooperative Oncology Group (ECOG) performance status score of 0 or 1. All subjects will have a histologically or cytologically confirmed solid tumor, except lymphoma, that is metastatic or unresectable, and had previously received or were ineligible for standard treatment options. In addition, subjects will not have received prior treatment with an anti-PD-l or anti-PD-Ll antibody (i.e., anti-PD-l and anti-PD-Ll naive). In Part 2, subjects will have one of the following selected tumor types: PD- Ll-high NSCLC, bladder, gastric/esophageal, melanoma, renal, SCLC, MSI-H or dMMR CRC. Dosage and administration
The study drug will initially be administered via IV infusion once every 2 weeks. Dosage escalation will begin at the starting dosage of 80 mg and may continue at dosages 160 mg, 240 mg, 320 mg, 400 mg, 480 mg, 560 mg, 640 mg, 720 mg and 800 mg. The administration schedule and infusion duration may be changed based on emerging safety, pharmacokinetic, and pharmacodynamic/biomarker data, and as confirmed by the SET. In Part 1 alternative dosages and schedules may be explored (e.g., administration once every 3 weeks or every 4 weeks). One or more RP2D(s) for JNJ-63723283 may be evaluated in Part 2.
Safety evaluations
Safety will be assessed by physical examinations, ECOG performance status, clinical laboratory tests, vital signs, electrocardiograms, AE monitoring, and concomitant medication usage. Echocardiogram or multigated acquisition scans will be assessed at screening; subsequent evaluations will be conducted if clinically indicated. The severity of AEs will be assessed using National Cancer Institute Common Terminology Criteria for Adverse Events (NCI-CTCAE, Version 4).
Efficacy evaluations
Response to treatment will be assessed by the investigator according to RECIST vl. l and irRC. Efficacy evaluations will include the following: computed tomography (CT) scans and/or magnetic resonance imaging (MRI), physical examination, and other procedures as necessary.
Statistical methods
The purpose of Part 1 is to identify the RP2D(s) in subjects with advanced solid tumors. Dosage escalation will be supported by a modified Continual Reassessment Method (mCRM) based on a statistical model, Bayesian Logistic Regression Model (BLRM), with Escalation with Overdosage Control (EWOC) principle. The total number of subjects treated will depend on the number of dosage levels explored and the number of subjects enrolled at each dosage level.
In Part 2, it is hypothesized that the ORR of JNJ-63723283 per RECIST vl. l administered at the RP2D(s) is at least 15% in subjects with selected solid tumors. The following are also hypothesized: 35% ORR for MSI-H/dMMR CRC, 30% ORR for PD-Ll-high NSCLC, and 25% ORR for melanoma. The ORR of thymoma is for hypothesis-generating research. Interim monitoring for efficacy will be conducted. Rationale for Pharmacokinetic and Immunogenicity Sampling
Serum samples will be collected and analyzed in Part 1 and Part 2 for JNJ-63723283 concentrations, and estimation of basic pharmacokinetic parameters from this concentration -time data will be performed. Pharmacokinetics will be assessed relative to available clinical safety, pharmacodynamic, and efficacy data, as well as to any efficacious concentration thresholds observed in nonclinical or competitor studies. Pharmacokinetic or pharmacokinetic/ pharmacodynamic analysis and modeling will be used to aid selection of a RP2D regimen for use in Part 2. Immunogenicity (i.e., ADA) will be evaluated for impact on pharmacokinetics and safety. The serum glycoform profile of JNJ-63723283 will also be characterized.
Rationale for Pharmacodynamic and Biomarker Sampling
It is expected that JNJ-63723283 will induce phenotypic changes consistent with activation of T cells in peripheral blood and tumor tissues. Pharmacodynamic evaluations will be based on assessment of activation and proliferation markers as well as cytokine profiles of T cells in peripheral blood. Peripheral blood samples will also be used to quantify the response of the immune cells in ex vivo stimulation assays. As PD-l polymorphisms could impact the effect of anti-PD-l antibodies, PD-l polymorphisms may be evaluated for possible correlation with clinical activity. JNJ-63723283 is anticipated to demonstrate binding to PD-l on circulating immune cells following administration to human subjects. PD-l receptor occupancy by JNJ- 63723283 on circulating CD3+ T cells will be measured using flow cytometry. Characteristics including dosage-dependence, peak occupancy, plateau occupancy, and duration of occupancy at plateau will be assessed, as feasible.
Rationale for PD-L1 Testing for Part 2
Expression of PD-L 1, the ligand for PD-l, correlates with enhanced clinical activity in multiple tumor types including NSCLC cancer. In Part 2, tumor tissue for PD-L1 testing will be required for all tumor types. This is necessary to correlate the clinical response with PD-L1 expression on the tumor tissue.
Rationale for MSI or dMMR Testing for Part 2
Compared with other tumors, MSI-H and dMMR CRC has a higher frequency of DNA mutations and higher level of immune infiltrates, and thus is more susceptible to PD-l blockade therapies. For the CRC group in Part 2, prescreening for MSI-H or dMMR is required. DOSING
The recommended FIH starting dosage regimen of JNJ-63723283 is 80 mg administered as an IV infusion every 2 weeks. Additional dosing intervals such as every 3 weeks, 4 weeks, or 6 weeks may be explored in Part 1 in addition to dosing every 2 weeks for further
characterization of JNJ-63723283 pharmacology. The maximum administered dosage is planned to be 800 mg but may be lower or higher based on emerging data. Administered intravenously, initially over a 60 (±10) minute infusion. In the absence of infusion-related reactions, subsequent infusions may be administered intravenously over 30 (-5/+10) minutes. Longer infusion times may occur if the infusion needs to be paused or slowed due to a safety concern. Also, it is not recommended to administer >100 mL of diluted drug product faster than 30 (-5/+10) minutes, or >250 mL of diluted drug product faster than 60 (±10) minutes.
Inclusion Criteria
Each potential subject must satisfy all of the following criteria to be enrolled in the study:
1. >18 years of age
2. Have evaluable disease,
2a. For Part 2, at least 1 measurable lesion that can be accurately assessed at baseline by CT (or magnetic resonance imaging [MRI] where CT is contraindicated) and is suitable for repeated assessment as per RECIST vl . l
3.2. Type of cancer:
Part 1 of the study:
Has any type of advanced or refractory solid tumor malignancy, except lymphoma, that is metastatic or unresectable and previously received or was ineligible for standard treatment options including appropriate molecularly targeted therapies (e.g., subjects with epidermal growth factor receptor [EGFR] mutant NSCLC or with NSCLC with anaplastic lymphoma tyrosine kinase [ALK] rearrangement).
Part 2 of the study:
Histologically or cytologically confirmed diagnosis of 1 of the following unresectable Stage III or IV solid tumor malignancies and previously received or was ineligible for standard treatment options including appropriate molecularly targeted therapies (e.g., subjects with EGFR mutant NSCLC or with NSCLC with ALK rearrangement):
• NSCLC o PD-Ll-high tumor sample (>50% tumor cells stained positive for PD-L1) by a PD- L 1 immunohistochemistry (IHC) test performed by a local laboratory or by the central laboratory designated by the sponsor
o Documented disease progression on or after at least 1 prior therapy with platinum- containing chemotherapy for advanced/metastatic NSCLC
o Have no more than 3 prior systemic regimens for the treatment of advanced NSCLC and have disease progression on or after last prior treatment (based on RECIST vl. l)
• Bladder cancer (urothelial carcinoma)
• Renal cell carcinoma
• Gastric/esophageal carcinoma
• Melanoma
• SCLC
• MSI-H or dMMR CRC
o MSI-H or dMMR by a polymerase chain reaction (PCR), next generation sequencing, or IHC test performed by a local laboratory or by the central laboratory designated by the sponsor
o Progressed following treatment with a fluoropyrimidine, oxaliplatin, and irinotecan 4. Have an Eastern Cooperative Oncology Group [ECOG] performance status 0 or 1
5.2. Have organ and bone marrow function as follows without blood product support:
Hemoglobin >8.5 g/dL, ANC >1.5 x 109/L, Platelets >75.0 x 109/L, AST and ALT <3 x ULN (or <4 x ULN for subjects with tumor involvement in the liver), Total bilirubin <1.5 x ULNa, Serum creatinine <1.5 x ULN or a calculated GFR >50 mL/min/l.73mm2, Left ventricular ejection fraction Within normal institutional limits; Corrected QT interval (QTcF or QTcB) <480 msec based on the average of triplicate assessments performed 5 (±3) minutes apart
6.1. Has thyroid function laboratory values within normal range. Note: If thyroid stimulating hormone (TSH) is not within normal limits, the subject may still be eligible if T3 (either total or free) and free T4 are within normal limits.
7. Women of childbearing potential must have a negative serum pregnancy test at Screening using highly sensitive pregnancy test.
8. Willing to use contraceptive methods consistent with local regulations for subjects participating in clinical studies during and after the study until 5 months after the last dosage of study drug.
a. Women of childbearing potential must agree to use 2 highly effective methods of contraception consistent with local regulations (<l% per year failure rate when used consistently and correctly).
b. A man who is sexually active with a woman of childbearing potential and has not had a vasectomy must agree to use a barrier method of birth control.
c. Women and men must agree not to donate sperm or eggs (ova, oocytes), respectively, during the study and after the study until 5 months after the last dosage of study drug.
9. Willing and able to adhere to the prohibitions and restrictions specified in this protocol.
10. Each subject (or their legally acceptable representative) must sign an informed consent form (ICF) indicating that he or she understands the purpose of and procedures required for the study and are willing to participate in the study. Consent is to be obtained prior to the initiation of any study -related tests or procedures that are not part of standard of care for the subject’s disease.
11. Subjects enrolled into Part 2 must have tumor tissue available for correlative studies. Fresh tumor biopsy is preferred. Archival tissue must meet the following criteria: archival sections within 4 months of sectioning that have been stored at 2° to 8° C in the dark or archival tumor blocks within 5 years of collection. Subjects without tissues meeting the aforementioned archived tissue criteria must undergo a fresh biopsy.
Exclusion Criteria
Any potential subject who meets any of the following criteria will be excluded from participating in the study:
1. Has uncontrolled intercurrent illness, including but not limited to ongoing or active infection requiring IV antibiotics, symptomatic congestive heart failure (New York Heart Association class III-IV), unstable angina pectoris, cardiac arrhythmia, poorly controlled hypertension or diabetes, or psychiatric illness/social situation that would limited compliance with study requirements
2. Has had prior treatment with an anti-PD-l antibody, anti-PD-Ll antibody or anti-PD-L2 antibody
3. Treatment with any local or systemic anti-neoplastic therapy, radiotherapy (excluding limited palliative radiation), or investigational anticancer agent within 14 days or 4 halflives, whichever is longer, up to a maximum wash-out period of 28 days prior to the initiation of study drug administration.
4. Criterion modified per Amendment 2
4.1. Has brain or leptomeningeal metastases unless asymptomatic, have been treated, have been stable for >4 weeks as documented by radiographic imaging with no evidence of cavitation or hemorrhage in the brain lesion, and do not require prolonged (>2 weeks) systemic corticosteroid therapy. Subjects are not permitted to receive enzyme-inducing antiepileptic drugs.
5. Has not recovered (i.e., <Grade 1 or baseline) from AEs except alopecia, peripheral neuropathy related to prior anticancer therapy and stable anemia (i.e., untransfused Hb >8.5 g/dL without the need for supportive transfusion within 2 weeks of screening) at the time of treatment allocation
6. Criterion modified per Amendment 2
6.1. Has an active autoimmune disease or a documented history of autoimmune disease that requires systemic steroids or immunosuppressive agents.
Note: Subjects with vitiligo or resolved childhood asthma/atopy would be an exception to this rule. Subjects that require intermittent use of bronchodilators or local steroid injections would not be excluded from the study. Subjects with hypothyroidism stable on hormone replacement will not be excluded from the study. Subjects with a history of transient autoimmune manifestations of an acute infectious disease that resolved upon treatment of the infectious agent (e.g., acute Lyme arthritis) will not be excluded from the study.
7. Grade 3 or higher toxicity effects from previous treatment with immunotherapy
8. Known allergies, hypersensitivity, or intolerance to protein-based therapies or with a history of any significant drug allergy (such as anaphylaxis, hepatotoxicity, or immune-mediated thrombocytopenia or anemia), or to JNJ-63723283 excipients (refer to Investigator's Brochure)
9. Has taken immunosuppressive dosages of systemic medications, such as corticosteroids (dosages
>10 mg/day prednisone or equivalent), within 2 weeks before the planned first dosage of study drug
10. A woman who is pregnant, breast-feeding, or planning to become pregnant while enrolled in this study or within 5 months after the last dosage of study drug
11. A man who plans to father a child while enrolled in this study or within 5 months after the last dosage of study drug.
12. Has any condition for which, in the opinion of the investigator, participation would not be in the best interest of the subject (e.g., compromise the well-being) or that could prevent, limit, or confound the protocol-specified assessments
13. Had major surgery (e.g., requiring general anesthesia) within 4 weeks before dosing, or will not have fully recovered from surgery, or has surgery planned during the time the subject is expected to participate in the study or within 4 weeks after the last dosage of study drug administration.
Note: Subjects with planned surgical procedures to be conducted under local anesthesia may participate
14. Criterion modified per Amendment 2
14.1. Active or chronic hepatitis B or hepatitis C disease as determined by hepatitis B surface antigen (HBsAg), hepatitis B core antibody, or hepatitis C antibody (anti-HCV) positivity at screening. If positive, further testing of quantitative levels to rule out active infection is required.
15. Has a history of human immunodeficiency virus (HIV) antibody positive, or tests positive for HIV at Screening
16. Criterion modified per Amendment 2
16.1. Vaccinated with a live vaccine within 28 days prior to the first dosage of study drug.
Annual inactivated influenza vaccine is permitted.
NOTE: Investigators should ensure that all study enrollment criteria have been met at screening. If a subject's clinical status changes (including any available laboratory results or receipt of additional medical records) after screening but before the first dosage of study drug is given such that he or she no longer meets all eligibility criteria, then the subject should be excluded from participation in the study.
Permitted Medications
Throughout the study, investigators may prescribe concomitant medications or treatments (including nutritional support, correction of metabolic disorders, optimal symptom control, and pain management) deemed necessary to provide adequate supportive care. Subjects may continue the use of bisphosphonates or denosumab for bone disease. Concurrent use of hormones for non cancer related conditions (e.g., insulin for diabetes and hormone replacement therapy) is acceptable. Concomitant medications (e.g., acetaminophen/paracetamol or diphenhydramine) deemed necessary by the investigator to provide adequate prophylaxis and management of IRR are allowed.
In addition, the following medications may be administered during the study:
• Standard supportive care therapies (antiemetics, antidiarrheals, anticholinergics,
antispasmodics, antipyretics, antihistamines, analgesics, antibiotics and other antimicrobials, histamine receptor [H2] antagonists or proton pump inhibitors, and other medications intended to treat symptoms or signs of disease) as clinically indicated, according to institutional standards and as deemed necessary by the investigator.
• Documented infectious complication should be treated with oral or IV antibiotics or other anti-infective agents as considered appropriate by the treating investigator for a given infectious condition, according to standard institutional practice. • Growth factor support for the management of treatment-emergent hematological toxicity as recommended according to National Comprehensive Cancer Network/European
Organization for Research and Treatment of Cancer (NCCN/EORTC) guidelines.
Biomarkers
Tumor Tissue at Baseline
Available (archival or fresh) tumor tissue from consenting subjects will be requested from all subjects in Part 1 and required from all subjects in Part 2 for biomarker analysis of PD- L1 expression by IHC by the sponsor or sponsor's designee. Prescreening PD-L1 testing will be required for NSCLC subjects in Part 2 and may be performed by a local laboratory or by the central laboratory designated by the sponsor. For all CRC subjects, prescreening MSI or dMMR testing will also be required by a local laboratory or by the central laboratory designated by the sponsor. Local test results will be centrally confirmed by the sponsor’s designee laboratory. In cases of discordance between local and central results, the central results will be used for analysis. Tumor tissue from the most recent tumor biopsy should be a formalin-fixed paraffin embedded (FFPE) tissue block that has been collected within the past 5 years (preferred) or a minimum of 15 unstained slides that have been processed no more than 4 months prior to study participation and have been stored at 2° C to 8° C in the dark. An additional 5 slides will be collected from CRC patients to support MSI-H analysis. If a site does not have sufficient material, a fresh tumor biopsy will be required for subjects in Part 2. Whole blood will be collected from CRC patients to support tumor tissue MSI and dMMR testing. This blood collection may be stopped due to developments in assay platforms utilized for MSI/dMMR testing.
Physical Description of Study Drug
Drug Product 1 (DPI): The JNJ-63723283 DPI study material supplied for this study is a sterile, frozen liquid in an 8R glass vial with serum stopper and aluminum seal with flip-off cap. Each vial of JNJ-63723283 clinical study material is filled with 3.3 mL of a 10 mg/mL solution of JNJ-63723283 (including 10% overfill in 10 mM histidine, 8.0% (w/v) sucrose, 0.04% (w/v) polysorbate 20, 20 pg/ml EDTA, pH 6.5, e.g. 30 mg/vial deliverable amount).
Drug Product 2 (DP2): The JNJ-63723283 DP2 study material supplied for this study is a sterile, lyophilized formulation in an 8R glass vial with serum stopper and aluminum seal with flip-off cap. Each vial of JNJ-63723283 clinical study material contains 90 mg per vial that after reconstitution is a 30 mg/mL solution of JNJ-63723283 in 10 mM histidine, 8.0% (w/v) sucrose, 0.04% Polysorbate 20 (w/v/), 20 pg/ml. EDTA, pH 6.5.
DP3 : JNJ-63723283 may also be supplied as a sterile, lyophilized formulation in an 30 mL glass vial with serum stopper and aluminum seal with flip-off cap. Each vial of JNJ- 63723283 clinical study material contains 240 mg per vial that after reconstitution is a 30 mg/mL solution of JNJ-63723283 in 10 mM histidine, 8.0% (w/v) sucrose, 0.04% Polysorbate 20 (w/v), 20 pg/ml. EDTA, pH 6.5.
Example 2. Interim results of a phase 1/2 study of JNJ-63723283 in patients with advanced cancers (NCT02908906)
At a clinical data cutoff 11 December 2017, 38 patients were treated with 80 mg, 240 mg, 460 mg or 800 mg of the study drug once every 2 weeks (Q2W), or 480 mg once every 4 weeks (Q4W) in part 1 of the study. Patient demographics and baseline disease characteristics for part 1 are show in Table 1. 12 (32%) patients remain on treatment, 26 (68%) have discontinued from study treatment (Table 2). Median duration of treatment was 51 days (range 1-297 days).
Table 1.
Table 2.
Safety
• Dose Limiting Toxicity (DLT)
— 240 mg Q2W: Grade 3 pleural effusion in a patient with NSCLC that required pleurodesis on study day 26 that was considered by the investigator to be possibly related to study drug because of the temporal relationship to study drug administration. — 800 mg Q2W: Grade 5 dyspnea in a patient with thymoma secondary to myasthenia gravis 14 days after receiving a single dosage of study drug.
• The most common AEs were anemia, fatigue, and vomiting (26% each; Table 3); the most common grade 3-4 AEs were pleural effusion, hyponatremia, anemia, and hypertension (8% each).
· Observed serious AEs included pleural effusion (10%) and dyspnea (8%).
— Immune-related AEs (irAEs) were reported in 37% of patients; most common irAEs were rash, hypothyroidism, and dyspnea (5% each).
— 3 patients discontinued treatment due to possible/probable grade 3 treatment-related pneumonitis, myopathy, and alanine aminotransferase increased.
Table 3.
Preliminary efficacy
4 patients at the 240 mg Q2W dosage (NSCLC, gastric cancer, thymoma, and microsatellite unstable colon cancer) and 1 patient at the 480 mg Q4W dosage (gastric cancer) achieved a partial response (PR). Patient with thymoma had a delayed response 2 months after discontinuation from the study due to immune-mediated hepatitis. 18 (55%) response-evaluable patients achieved stable disease (SD) or better based on RECIST vl. l (Table 4 shows the investigator-assessed best overall response.
Table 4.
Pharmacokinetics and Receptor Occupancy
Serum concentration of JNJ-63723283 in dosaged subjects were consistent with linear and dosage-proportional PK. Table 5 shows the preliminary PK parameters of JNJ-63723283 in patients dosaged 80 mg, 240 mg and 480 mg of JNJ-63723283 after the first dosage. FIG. 1 shows the mean serum concentration -time profiles of JNJ-63723283. Saturation of PD-l receptors on circulating CD3+ T cells was demonstrated after the first dosage and maintained throughout the dosing interval at all dosage levels (ranging from 80 mg to 480 mg) and all frequencies (ranging from Q2W to Q4W). The percentage (%) saturation of PD-l receptors on circulating CD3+ T cells is shown in FIG. 2. The percentage (%) saturation of PD-l receptors on circulating CD3+ T cells is shown in FIG. 3.
Table 5.
T cell functionality in treated patients
PBMCs from treated patients showed near maximal T cell activation in an ex vivo SEB stimulation assay at all dosages and time points tested. FIG. 4 shows the T cell activation in response to SEB prior to and 2 hours after dosage 1 (Dl-Pre, Dl-2hr), at follow-up after dosage 1 (Dl-FU), prior to dosage 2 (D2-Pre), prior to dosage 3 (D3-Pre) and at end of treatment (EOT) in patients who received 240 mg Q2W or 480 mg Q4Q of the antibody.
Methods: JNJ-63723283 pharmacodynamic modulation was characterized by evaluating IL-2 expression, as a measure of T cell activation, in pre-and post-treated ex vivo SEB
(Staphylococcal enterotoxin B) stimulated whole blood samples. Briefly, blood samples were diluted 1 : 10 with RPMI 1640 media followed by a 4-day incubation with lOOng/ml of SEB plus 10 pg/ml of JNJ-63723283 or isotype control, representing maximum and endogenous levels of IL-2 expression, respectively. The ratio of IL-2 expression levels between the isotype and JNJ- 63723283 ex vivo treated blood samples was then calculated to assess the degree of PD modulation, with a ratio of 1 indicating maximum T cell activation.
Conclusions
• JNJ-63723283 displayed a safety profile that was comparable to other anti-PD-l antibodies. · The RP2D of 240 mg Q2W is being evaluated in phase 2; the RP2D may be administered at an alternative regimen of 480 mg Q4W to enable flexibility in various clinical settings.
• Preliminary antitumor activity in patients with previously treated advanced cancers was observed, with 5 patients (15%) achieving a PR and 13 patients (39%) achieving SD.
• JNJ-63723283 exhibited linear and dose-proportional PK within the dose range evaluated. • JNJ-63723283 demonstrated saturable PD-l RO and enhanced T cell activity in ex-vivo SEB stimulation assays at all dose levels and throughout all dosing frequencies tested.
• Additional dose levels and dosing frequencies may be explored.
• The trial is ongoing to further characterize the safety, PK, and clinical activity of JNJ-63723283.
Example 3. Interim results of a phase 1/2 study of JNJ-63723283 in patients with advanced cancers (NCT02908906)
At a clinical data cutoff 04 December 2018, 198 patients were treated with 80 mg, 240 mg, 460 mg or 800 mg of the study drug DP1 once every 2 weeks (Q2W), or 480 mg of the study drug DP1 or DP2 once every 4 weeks (Q4W) in part 1/2 of the study. Patient demographics and baseline disease characteristics for part 1 and part 2 subjects are shown in Table 6.
Table 6.
Table 7 shows the mutation status, number and type of prior therapies for melanoma patients in Part 2. Table 8 shows the PD-L1 status, number and type of prior therapies for NSCLC patients in Part 2. Table 9 shows the MSI (Microsatellite Instability) status (Central testing result) in CRC.
Table 7.
Table 8.
Table 9.
Safety
· The most common TE-AEs (Treatment Emergent Adverse Events) reported were asthenia
(22.2%), fatigue (19.2%), diarrhea (18.2%), dyspnoea (18.2%), pyrexia (17.7%), decreased appetite (16.7%), anaemia (16.7%), nausea (15.7%), back pain (14.1%), ALT increased (12.6%), cough (12.1%), vomiting (11.6%), AST increased (11.6%), abdominal pain (10.1%), constipation (10.1%).
· The most common grade 3-4 TE-AEs reported were anaemia (6.6%), dyspnea (5.1%), pleural effusion (2.5%), pyrexia (5.1%), hyponatremia (3.0%), hyperamylasemia (2.5%), abdominal pain (2.5%), intestinal obstruction (2.5%), fatigue (2.5%), general physical health deterioration (2.5%), ALT increased (3.0%), AST increased (3.0%), GGT increased (3.0%), and hypertension (3.0%).
· Serious TEAEs were observed in nearly 50% of subjects. The most common TE SAEs were dyspnoea (5.1%), pleural effusion (3.5%), intestinal obstruction (3.5%), general physical health deterioration (3.0%), and pyrexia (3.0%).
• Immune-related AEs (irAEs) were reported in 35.9% of patients. • Infusion Related Reactions (IRRs) were reported in 14.1% of all subjects, and 13.6% in subjects receiving the 240 mg Q2W dose. All except 2 IRRs were CTCAE grade 1/2. Only 1 subject did not complete an infusion due to an IRR of a grade 3 hypertension event.
Table 10 shows the summary of the reported adverse events in part 1/2. Table 11 shows the adverse events occurring in >10% subjects.
Table 10.
Table 11.
Preliminary efficacy observed in Part 2 subjects.
140 patients at the 240 mg Q2W dosage (NSCLC, melanoma, and MSI-H/dMMR CRC) were evaluable for response evaluation based on 04 Dec 2018 dataset. 4 (2.9%) patients achieved a complete response (CR) and 23 (16.4%) achieved a partial response (PR). 73 (52.1%) response-evaluable patients achieved stable disease (SD) or better based on RECIST vl. l. The following ORRs were observed by histologic subtype: 37.5% in PDL1+ > 50% NSCLC, 32.6% in non-uveal melanoma, and 12.5% in MSI-H/dMMR CRC. In patients with centrally confirmed MSI-H CRC, the ORR increased to 16.7%. (Table 12 shows the investigator-assessed best overall response and associated 80% confidence intervals.)
Table 12.
Conclusions
• JNJ-63723283 displayed a safety profile in immune-sensitive advanced cancers that was comparable to other anti-PD-1 antibodies.
• JNJ-63723283 exhibited linear and dose-proportional PK within the dose range evaluated.
• JNJ-63723283 demonstrated saturable PD-1 RO and enhanced T cell activity in ex-vivo SEB stimulation assays at all dose levels and throughout all dosing frequencies tested.
• The RP2D of 240 mg Q2W is being evaluated in phase 2; the RP2D may be administered at an alternative regimen of 480 mg Q4W to enable flexibility in various clinical settings.
• Additional dose levels, administration routes (subcutaneous injection), and dosing frequencies may be explored.
• Patients with advanced cancers achieved an ORR of 19% overall; by histologic subtype, observed ORRs were 37.5% in PDL1+ NSCLC, 32.6% in non-uveal melanoma, and 13% in MSI- H/dMMR.
• Follow-up is ongoing on the centrally confirmed MSI-H CRC cohort
• The trial is ongoing to further characterize the safety, PK, and clinical activity of JNJ-63723283 at the RP2D of 240 mg Q2W.
73

Claims

We claim:
1) A method of treating a cancer, comprising administering to a subject diagnosed with the cancer an antagonistic anti-PD 1 antibody or an antigen binding fragment thereof, comprising a heavy chain complementarity determining region 1 (HCDR1) of SEQ ID NO: 1, a HCDR2 of SEQ ID NO: 2, a HCDR3 of SEQ ID NO: 3, a light chain complementarity determining region 1 (LCDR1) of SEQ ID NO: 4, a LCDR2 of SEQ ID NO: 5 and a LCDR3 of SEQ ID NO: 6 at a dose of between about 240 mg and about 480 mg.
2) The method of claim 1, wherein the antagonistic anti-PD- 1 antibody or the antigen binding fragment thereof is administered once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks.
3) The method of claim 2, wherein the antagonistic anti-PD- 1 antibody or the antigen binding fragment thereof is administered
a) at a dosage of about 240 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks;
b) at the dosage of about 240 mg once every two weeks;
c) at the dosage of about 240 mg once every three weeks;
d) at the dosage of about 240 mg once every four weeks;
e) at the dosage of about 240 mg once every five weeks;
f) at the dosage of about 240 mg once every six weeks;
g) at the dosage of about 480 mg once every two weeks, once every three weeks, once every four weeks, once every five weeks or once every six weeks;
h) at the dosage of about 480 mg once every two weeks;
i) at the dosage of about 480 mg once every three weeks;
j) at the dosage of about 480 mg once every four weeks;
k) at the dosage of about 480 mg once every five weeks; or
l) at the dosage of about 480 mg once every six weeks.
4) The method of claim 3, wherein the cancer is a solid tumor.
5) The method of claim 4, wherein the solid tumor is an advanced solid tumor.
6) The method of claim 3, wherein the cancer is selected from the group consisting of a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer, a prostate cancer, a basal cell carcinoma and an advanced cutaneous squamous cell carcinoma (CSCC), or any combination thereof.
7) The method of claim 6, wherein the subject is PD-l axis naive.
8) The method of claim 6, wherein the subject has received one, two, three or more prior
therapeutics to treat the cancer.
9) The method of claim 8, wherein the one, two, three or more prior therapeutics to treat the cancer are an anti-CTLA4 antibody, ipilimumab, BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
10) The method of claim 8, wherein the subject is resistant, refractory or resistant and refractory to the one, two, three or more prior therapeutics to treat the cancer, or any combination thereof.
11) The method of claim 10, wherein the one, two, three or more prior therapeutics to treat the cancer are an anti-CTLA4 antibody, ipilimumab, BRAF/MEK inhibitor, chemotherapy or interferon alpha, or any combination thereof.
12) The method of claim 6, wherein the cancer is PD-L1 positive.
13) The method of claim 12, wherein the cancer is PD-L1 high.
14) The method of claim 6, wherein PD-L1 expression in the cancer is undetermined.
15) The method of claim 6, wherein the cancer expresses a mutant BRAF.
16) The method of claim 15, wherein the mutant BRAF comprises a V600E mutation.
17) The method of claim 6, wherein the cancer expresses a wild-type BRAF.
18) The method of claim 6, wherein the antagonistic anti -PD-l antibody or the antigen binding fragment thereof is
a) administered or provided for administration in a pharmaceutical composition comprising between about 10 mg/ml to about 30 mg/ml of the antagonistic anti -PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) administered or provided for administration in a pharmaceutical composition comprising about 10 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5; c) administered or provided for administration in a pharmaceutical composition comprising about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) provided for administration as a lyophilized formulation comprising between about 90 mg and about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients;
e) provided for administration as a lyophilized formulation comprising about 90 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients; or
f) provided for administration as a lyophilized formulation comprising about 240 mg of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof and one or more pharmaceutically acceptable excipients.
19) The method of claim 18, wherein the lyophilized formulation of d), e) and/or f), once
reconstituted, comprises about 30 mg/ml of the antagonistic anti-PD-l antibody or the antigen binding fragment thereof, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
20) The method of claim 6, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by an intravenous infusion.
21) The method of claim 6, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is administered by a subcutaneous injection.
22) The method of claim 6, wherein the method achieves an overall response rate (ORR) of at least about 15% in a group of subjects diagnosed with the cancer.
23) The method of claim 22, wherein the ORR of at least about 15% is achieved after a median duration of treatment of about 1 1/2 months or more.
24) The method of claim 22, wherein the method achieves an ORR of at least about 19% in the group of subjects diagnosed with the cancer.
25) The method of claim 6, wherein the cancer is the non-small cell lung cancer (NSCLC).
26) The method of claim 25, wherein the method achieves an ORR of at least about 30% in a group of subjects diagnosed with PD-L1 high NSCLC or an ORR of at least about 25% in a group of subjects whose PD-L1 expression in the cancer is undetermined.
27) The method of claim 26, wherein the method achieves an ORR of at least about 35% in the group of subjects diagnosed with PD-L1 high NSCLC.
28) The method of claim 6, wherein the cancer is the melanoma. 29) The method of claim 28, wherein the method achieves an ORR of at least about 25% in a group of subjects diagnosed with the melanoma.
30) The method of claim 29, wherein the melanoma is a non-uveal melanoma.
31) The method of claim 30, wherein the method achieves an ORR of at least about 30% in a group of subjects diagnosed with the non-uveal melanoma.
32) The method of claim 6, wherein the CRC is a microsatellite instability-high (MSI-H) CRC or a mismatch repair-deficient (dMMR) CRC, or a combination thereof.
33) The method of claim 32, wherein the CRC is a stage II CRC or a stage III CRC.
34) The method of claim 6, wherein the antagonistic anti -PD- 1 antibody or the antigen binding fragment thereof comprises a heavy chain variable region (VH) of SEQ ID NO: 7 and a light chain variable region (VL) or SEQ ID NO: 8.
35) The method of claim 34, wherein the antagonistic anti-PD-l antibody or the antigen binding fragment thereof is an IgGl, an IgG2, an IgG3 or an IgG4 isotype.
36) The method of claim 35, wherein the antagonistic anti-PD-l antibody comprises a heavy chain of SEQ ID NO: 9 and a light chain of SEQ ID NO: 10.
37) A pharmaceutical composition comprising
a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) a lyophilized formulation comprising between about 90 mg and about 240 mg of
cetrelimab and one or more pharmaceutically acceptable excipients;
e) a lyophilized formulation comprising about 90 mg cetrelimab and one or more
pharmaceutically acceptable excipients; or
f) a lyophilized formulation comprising about 240 mg cetrelimab and one or more
pharmaceutically acceptable excipients.
38) The pharmaceutical composition of claim 37, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
39) A drug product comprising a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) a lyophilized formulation comprising between about 90 mg and about 240 mg cetrelimab and one or more pharmaceutically acceptable excipients;
e) a lyophilized formulation comprising about 90 mg cetrelimab and one or more
pharmaceutically acceptable excipients; or
f) a lyophilized formulation comprising about 240 mg cetrelimab and one or more
pharmaceutically acceptable excipients.
40) The drug product of claim 39, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5.
41) A drug product comprising
a) between about 10 mg/ml and about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
b) about 10 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
c) about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5;
d) a lyophilized formulation comprising between about 90 mg and about 240 mg cetrelimab and one or more pharmaceutically acceptable excipients;
e) a lyophilized formulation comprising about 90 mg cetrelimab and one or more
pharmaceutically acceptable excipients; or
f) a lyophilized formulation comprising about 240 mg cetrelimab and one or more
pharmaceutically acceptable excipients,
for the treatment of a cancer.
42) The drug product of claim 41, wherein the lyophilized formulation of d), e) and/or f), once reconstituted, comprises about 30 mg/ml cetrelimab, about 10 mM histidine, about 8.0% (w/v) sucrose, about 0.04% (w/v) polysorbate-20 and about 20 pg/ml EDTA at pH 6.5. 43) The drug product of claim 41, wherein the cancer is a lung cancer, a non-small cell lung cancer (NSCLC), a melanoma, a head and neck cancer, a bladder cancer, a gastrointestinal cancer, a gastric cancer, a gastro-esophageal junction cancer, an esophageal cancer, a liver cancer, a colorectal cancer (CRC), a colon cancer, a gallbladder cancer, a biliary tract cancer, an ovarian cancer, a fallopian tube cancer, a cervical cancer, a peritoneal cancer, an endometrial cancer, a small cell lung cancer (SCLC), a breast cancer, a pancreatic cancer, a renal cell carcinoma, a liver cancer, a Merkel cell carcinoma, a primary mediastinal B-cell lymphoma (PMBCL), a Hodgkin’s lymphoma, a non-Hodgkin’s lymphoma, a large diffuse B-cell cell lymphoma (DLBLC), a multiple myeloma, a glioblastoma, an urothelial cancer, a salivary cancer, a mesothelioma, an anal cancer, a prostate cancer, a basal cell carcinoma and an advanced cutaneous squamous cell carcinoma (CSCC), or any combination thereof.
44) The drug product of claim 43, wherein
a) the NSCLC is PD-L 1 high NSCLC;
b) the CRC is a MSI-H CRC or a dMMR CRC; or
c) the melanoma is a non-uveal melanoma; or any combination thereof.
45) The drug product of claim 41, wherein the drug product is administered
a) at a dosage of about 240 mg once in two weeks;
b) at a dosage of about 480 mg once in four weeks; or
c) as an initial dose of about 240 mg followed by a second dose of about 480 mg six weeks after the initial dose, and thereafter about 480 mg once in four weeks; or
d) as an initial dose of about 240 mg followed by a second dose of about 480 mg six weeks after the initial dose, and thereafter about 240 mg once in two weeks.
46) The drug product of claim 41, wherein the drug product is administered by an intravenous administration of by a subcutaneous administration, or a combination thereof.
EP19707451.1A 2018-01-22 2019-01-19 Methods of treating cancers with antagonistic anti-pd-1 antibodies Pending EP3743159A2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201862620106P 2018-01-22 2018-01-22
US201962794195P 2019-01-18 2019-01-18
PCT/IB2019/050449 WO2019142149A2 (en) 2018-01-22 2019-01-19 Methods of treating cancers with antagonistic anti-pd-1 antibodies

Publications (1)

Publication Number Publication Date
EP3743159A2 true EP3743159A2 (en) 2020-12-02

Family

ID=65529735

Family Applications (1)

Application Number Title Priority Date Filing Date
EP19707451.1A Pending EP3743159A2 (en) 2018-01-22 2019-01-19 Methods of treating cancers with antagonistic anti-pd-1 antibodies

Country Status (16)

Country Link
US (1) US12398209B2 (en)
EP (1) EP3743159A2 (en)
JP (1) JP7579705B2 (en)
KR (1) KR20200112867A (en)
CN (2) CN120531867A (en)
AU (1) AU2019208537A1 (en)
BR (1) BR112020014618A2 (en)
CA (1) CA3089174A1 (en)
IL (1) IL275897A (en)
JO (1) JOP20200177A1 (en)
MA (1) MA51677A (en)
MX (1) MX2020007748A (en)
PH (1) PH12020500576A1 (en)
SG (1) SG11202006422PA (en)
WO (1) WO2019142149A2 (en)
ZA (1) ZA202005223B (en)

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4034118A1 (en) * 2019-09-26 2022-08-03 Janssen Pharmaceutica NV Use of fgfr inhibitors in fgfr-genetically altered cancers to enhance patient response to immune checkpoint inhibitors in sequential treatment settings
SI4076385T1 (en) 2019-12-20 2026-04-30 Formycon Ag Formulations of anti-pd1 antibodies
TWI900527B (en) 2020-02-12 2025-10-11 比利時商健生藥品公司 Fgfr tyrosine kinase inhibitors and anti-pd1 agents for the treatment of urothelial carcinoma
EP4146654A1 (en) 2020-05-07 2023-03-15 Adorx therapeutics Limited Antagonists of the adenosine a2a receptor
GB202011996D0 (en) 2020-07-31 2020-09-16 Adorx Therapeutics Ltd Antagonist compounds
CN112194723B (en) * 2020-09-25 2021-09-21 广州百吉生物制药有限公司 Application of immune cells in treating cancer
GB202019622D0 (en) 2020-12-11 2021-01-27 Adorx Therapeutics Ltd Antagonist compounds
WO2022242738A1 (en) * 2021-05-20 2022-11-24 Shanghai Junshi Biosciences Co., Ltd. Use of anti-pd-1 antibody in combination with chemotherapy in treating esophageal cancer
WO2022258011A1 (en) * 2021-06-11 2022-12-15 广东菲鹏制药股份有限公司 Anti-pd-1 humanized antibody or antigen-binding fragment thereof and application thereof
JP2024527517A (en) 2021-06-23 2024-07-25 フォーマイコン アーゲー Anti-PD1 antibody preparation
GB2615307A (en) 2022-01-28 2023-08-09 Adorx Therapeutics Ltd Antagonist compounds
EP4637818A1 (en) 2022-12-21 2025-10-29 Formycon AG Formulations of anti-pd1 antibodies
WO2024171082A1 (en) 2023-02-16 2024-08-22 Sun Pharmaceutical Industries Limited Stable protein compositions of anti-pd1 antibody
WO2025094087A1 (en) * 2023-10-30 2025-05-08 Johnson & Johnson Enterprise Innovation Inc. Safe administration of a2a rector antagonist
WO2025140467A1 (en) * 2023-12-29 2025-07-03 上海复宏汉霖生物技术股份有限公司 Stable high-concentration anti-pd-1 antibody pharmaceutical formulation
TW202602477A (en) 2024-03-08 2026-01-16 美商健生生物科技公司 Combinations of oncolytic viruses and immunomodulators

Family Cites Families (351)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4978672A (en) 1986-03-07 1990-12-18 Ciba-Geigy Corporation Alpha-heterocyclc substituted tolunitriles
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0281604B1 (en) 1986-09-02 1993-03-31 Enzon Labs Inc. Single polypeptide chain binding molecules
JP3101690B2 (en) 1987-03-18 2000-10-23 エス・ビィ・2・インコーポレイテッド Modifications of or for denatured antibodies
DE3884470T2 (en) 1987-06-17 1994-03-10 Sandoz Ag Cyclosporins and their use as medicines.
US5606040A (en) 1987-10-30 1997-02-25 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US6303121B1 (en) 1992-07-30 2001-10-16 Advanced Research And Technology Method of using human receptor protein 4-1BB
IL162181A (en) 1988-12-28 2006-04-10 Pdl Biopharma Inc A method of producing humanized immunoglubulin, and polynucleotides encoding the same
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US6582959B2 (en) 1991-03-29 2003-06-24 Genentech, Inc. Antibodies to vascular endothelial cell growth factor
US20030206899A1 (en) 1991-03-29 2003-11-06 Genentech, Inc. Vascular endothelial cell growth factor antagonists
EP1400536A1 (en) 1991-06-14 2004-03-24 Genentech Inc. Method for making humanized antibodies
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
PT1024191E (en) 1991-12-02 2008-12-22 Medical Res Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
AU687727B2 (en) 1992-10-28 1998-03-05 Genentech Inc. Vascular endothelial cell growth factor antagonists
DK0752248T3 (en) 1992-11-13 2000-11-13 Idec Pharma Corp Therapeutic use of chimeric and radiolabeled antibodies against human B lymphocyte restricted differentiation antibody
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
ES2156149T3 (en) 1992-12-04 2001-06-16 Medical Res Council MULTIVALENT AND MULTI-SPECIFIC UNION PROTEINS, ITS MANUFACTURE AND USE.
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
US7138500B1 (en) 1993-05-07 2006-11-21 Immunex Corporation Antibodies to human 4-1BB
IL108501A (en) 1994-01-31 1998-10-30 Mor Research Applic Ltd Antibodies and pharmaceutical compositions containing them
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5688690A (en) 1994-09-16 1997-11-18 The Wistar Institute Of Anatomy And Biology Human cytotoxic lymphocyte signal transduction surface protein (P38) and monoclonal antibodies thereto
IL117645A (en) 1995-03-30 2005-08-31 Genentech Inc Vascular endothelial cell growth factor antagonists for use as medicaments in the treatment of age-related macular degeneration
AUPO591797A0 (en) 1997-03-27 1997-04-24 Commonwealth Scientific And Industrial Research Organisation High avidity polyvalent and polyspecific reagents
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
ES2233974T3 (en) 1995-09-11 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. ANTIBODY AGAINST THE ALFA CHAIN OF THE 5 HUMAN INTERLEUCINE RECEIVER.
AU7378096A (en) 1995-09-28 1997-04-17 Alexion Pharmaceuticals, Inc. Porcine cell interaction proteins
US7357927B2 (en) 1996-03-12 2008-04-15 Human Genome Sciences, Inc. Death domain containing receptors
ES2308787T3 (en) 1996-08-16 2008-12-01 Schering Corporation ANTIGENS OF MAMPHERE CELL SURFACE; RELATED REAGENTS.
US6111090A (en) 1996-08-16 2000-08-29 Schering Corporation Mammalian cell surface antigens; related reagents
US6140076A (en) 1996-12-06 2000-10-31 Schering Corporation Ig superfamily `dlair` receptors expressed in monocytes
US20060280140A9 (en) 1997-02-06 2006-12-14 Mahany Ronald L LOWER POWER WIRELESS BEACONING NETWORK SUPPORTING PROXIMAL FORMATION, SEPARATION AND REFORMATION OF WIRELESS LOCAL AREA NETWORKS (LAN's), AS TERMINALS MOVE IN AND OUT RANGE OF ONE ANOTHER
US6972323B1 (en) 1997-04-01 2005-12-06 Sankyo Company, Limited Anti-Fas antibodies
KR100816621B1 (en) 1997-04-07 2008-03-24 제넨테크, 인크. Anti-VEGF Antibodies
US20020032315A1 (en) 1997-08-06 2002-03-14 Manuel Baca Anti-vegf antibodies
PT971959E (en) 1997-04-07 2006-05-31 Genentech Inc HUMANIZED ANTIBODIES AND METHODS FOR FORMING HUMANIZED ANTIBODIES
US6884879B1 (en) 1997-04-07 2005-04-26 Genentech, Inc. Anti-VEGF antibodies
EP0983303B1 (en) 1997-05-21 2006-03-08 Biovation Limited Method for the production of non-immunogenic proteins
CO4940418A1 (en) 1997-07-18 2000-07-24 Novartis Ag MODIFICATION OF A CRYSTAL OF A DERIVATIVE OF N-PHENYL-2-PIRIMIDINAMINE, PROCESSES FOR ITS MANUFACTURE AND USE
EP1015616A2 (en) 1997-09-19 2000-07-05 Dana Farber Cancer Institute, Inc. Intrabody-mediated control of immune reactions
GB9722131D0 (en) 1997-10-20 1997-12-17 Medical Res Council Method
JP2001520039A (en) 1997-10-21 2001-10-30 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド Human tumor necrosis factor receptor-like proteins, TR11, TR11SV1 and TR11SV2
AU2591599A (en) 1998-02-09 1999-08-23 Genentech Inc. Novel tumor necrosis factor receptor homolog and nucleic acids encoding the same
US6818749B1 (en) 1998-10-31 2004-11-16 The United States Of America As Represented By The Department Of Health And Human Services Variants of humanized anti carcinoma monoclonal antibody cc49
US7888477B2 (en) 1998-12-17 2011-02-15 Corixa Corporation Ovarian cancer-associated antibodies and kits
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US6703020B1 (en) 1999-04-28 2004-03-09 Board Of Regents, The University Of Texas System Antibody conjugate methods for selectively inhibiting VEGF
WO2001003720A2 (en) 1999-07-12 2001-01-18 Genentech, Inc. Promotion or inhibition of angiogenesis and cardiovascularization by tumor necrosis factor ligand/receptor homologs
PL354286A1 (en) 1999-08-23 2003-12-29 Dana-Farber Cancer Institutedana-Farber Cancer Institute Pd-1, a receptor for b7-4, and uses therefor
AU767394C (en) 1999-12-29 2005-04-21 Immunogen, Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
GB0018891D0 (en) 2000-08-01 2000-09-20 Novartis Ag Organic compounds
WO2001056603A1 (en) 2000-02-01 2001-08-09 Tanox, Inc. Cd40-binding apc-activating molecules
AU2001259215A1 (en) 2000-04-28 2001-11-12 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
US6696620B2 (en) 2000-05-02 2004-02-24 Epicyte Pharmaceutical, Inc. Immunoglobulin binding protein arrays in eukaryotic cells
US6965018B2 (en) 2000-06-06 2005-11-15 Bristol-Myers Squibb Company Antibodies directed to B7-related polypeptide, BSL-2
CA2412494C (en) 2000-06-22 2012-10-23 Genentech, Inc. Agonist anti-trk-c monoclonal antibodies
US7288390B2 (en) 2000-08-07 2007-10-30 Centocor, Inc. Anti-dual integrin antibodies, compositions, methods and uses
US6596541B2 (en) 2000-10-31 2003-07-22 Regeneron Pharmaceuticals, Inc. Methods of modifying eukaryotic cells
CA2430013C (en) 2000-11-30 2011-11-22 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US6995162B2 (en) 2001-01-12 2006-02-07 Amgen Inc. Substituted alkylamine derivatives and methods of use
EP1355948B1 (en) 2001-01-12 2009-03-11 Molecules of Man AB Materials and methods for treatment of hepatitis c
AR036993A1 (en) 2001-04-02 2004-10-20 Wyeth Corp USE OF AGENTS THAT MODULATE THE INTERACTION BETWEEN PD-1 AND ITS LINKS IN THE SUBMODULATION OF IMMUNOLOGICAL ANSWERS
US7667004B2 (en) 2001-04-17 2010-02-23 Abmaxis, Inc. Humanized antibodies against vascular endothelial growth factor
MXPA05000511A (en) 2001-07-12 2005-09-30 Jefferson Foote Super humanized antibodies.
US20030226155A1 (en) 2001-08-30 2003-12-04 Biorexis Pharmaceutical Corporation Modified transferrin-antibody fusion proteins
US20040142325A1 (en) 2001-09-14 2004-07-22 Liat Mintz Methods and systems for annotating biomolecular sequences
DE60213842T2 (en) 2001-10-30 2007-09-06 Novartis Ag STAUROSPORINE DERIVATIVES AS INHIBITORS OF THE FLT3 RECEPTOR TYROSINE KINASE EFFECT
AR039067A1 (en) 2001-11-09 2005-02-09 Pfizer Prod Inc ANTIBODIES FOR CD40
PT1478648E (en) 2002-02-01 2014-07-15 Ariad Pharma Inc Phosphorus-containing compounds and uses thereof
KR100984595B1 (en) 2002-03-13 2010-09-30 어레이 바이오파마 인크. N3 alkylated benzimidazole derivatives as MEV inhibitors
DE60317677T2 (en) 2002-06-13 2008-10-30 Crucell Holland B.V. OX40 (= CD134) RECEPTOR AGONISTS AND THERAPEUTIC USES
US8546541B2 (en) 2002-06-20 2013-10-01 Washington University Compositions and methods for modulating lymphocyte activity
AU2003281200A1 (en) 2002-07-03 2004-01-23 Tasuku Honjo Immunopotentiating compositions
GB0215676D0 (en) 2002-07-05 2002-08-14 Novartis Ag Organic compounds
US20040047858A1 (en) 2002-09-11 2004-03-11 Blumberg Richard S. Therapeutic anti-BGP(C-CAM1) antibodies and uses thereof
EP1560593B1 (en) 2002-10-25 2016-04-20 Genentech, Inc. Novel composition and methods for the treatment of immune related diseases
DE60332483D1 (en) 2002-11-15 2010-06-17 Novartis Vaccines & Diagnostic METHODS FOR THE PREVENTION AND TREATMENT OF CANCER METASTASIS AND CANCER LOSS ASSOCIATED WITH CANCER METASTASIS
CN101899114A (en) 2002-12-23 2010-12-01 惠氏公司 Anti-PD-1 antibody and uses thereof
SI1611112T1 (en) 2003-02-11 2012-12-31 Vernalis (R&D) Limited Isoxazole compounds as inhibitors of heat shock proteins
BRPI0407446A (en) 2003-02-13 2006-01-31 Pharmacia Corp C-met Antibodies for cancer treatment
US20070048740A1 (en) 2003-02-14 2007-03-01 Research Association For Biotechnology Full-length cDNA
US20050009136A1 (en) 2003-02-19 2005-01-13 Dyax Corporation PAPP-A ligands
WO2004094676A1 (en) 2003-04-17 2004-11-04 Cytec Technology Corp. Composition and process for the solvent extraction of metals using aldoxime or ketoxime extractants
US20050025763A1 (en) 2003-05-08 2005-02-03 Protein Design Laboratories, Inc. Therapeutic use of anti-CS1 antibodies
US7618632B2 (en) 2003-05-23 2009-11-17 Wyeth Method of treating or ameliorating an immune cell associated pathology using GITR ligand antibodies
UA101945C2 (en) 2003-05-30 2013-05-27 Дженентек, Инк. Treatment of cancer using bevacizumab
HRP20120845T1 (en) 2003-07-02 2012-11-30 Innate Pharma Pan-kir2dl nk-receptor antibodies and their use in diagnostic and therapy
WO2005007190A1 (en) 2003-07-11 2005-01-27 Schering Corporation Agonists or antagonists of the clucocorticoid-induced tumour necrosis factor receptor (gitr) or its ligand for the treatment of immune disorders, infections and cancer
WO2005044853A2 (en) 2003-11-01 2005-05-19 Genentech, Inc. Anti-vegf antibodies
US7758859B2 (en) 2003-08-01 2010-07-20 Genentech, Inc. Anti-VEGF antibodies
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
US7288638B2 (en) 2003-10-10 2007-10-30 Bristol-Myers Squibb Company Fully human antibodies against human 4-1BB
EP1682103A1 (en) 2003-10-27 2006-07-26 Novartis AG Indolyl-pyrroledione derivatives for the treatment of neurological and vascular disorders related to beta-amyloid generation and/or aggregation
EP2478912B1 (en) 2003-11-06 2016-08-31 Seattle Genetics, Inc. Auristatin conjugates with anti-HER2 or anti-CD22 antibodies and their use in therapy
CA2545166A1 (en) 2003-11-11 2005-05-19 Chugai Seiyaku Kabushiki Kaisha Humanized anti-cd47 antibody
US7612179B2 (en) 2003-11-28 2009-11-03 Astrazeneca Ab antibodies binding to a C-terminal fragment of apoliopoprotein E
RU2006122946A (en) 2003-11-28 2008-01-10 Астразенека Аб (Se) ANTIBODIES
WO2005055808A2 (en) 2003-12-02 2005-06-23 Genzyme Corporation Compositions and methods to diagnose and treat lung cancer
JP2007518823A (en) 2004-01-23 2007-07-12 アムゲン インコーポレイテッド Quinoline, quinazoline, pyridine, and pyrimidine compounds and their use in the treatment of inflammation, angiogenesis, and cancer
US7973139B2 (en) 2004-03-26 2011-07-05 Human Genome Sciences, Inc. Antibodies against nogo receptor
GB0409799D0 (en) 2004-04-30 2004-06-09 Isis Innovation Method of generating improved immune response
WO2005113556A1 (en) 2004-05-13 2005-12-01 Icos Corporation Quinazolinones as inhibitors of human phosphatidylinositol 3-kinase delta
US20060002932A1 (en) 2004-06-04 2006-01-05 Duke University Methods and compositions for enhancement of immunity by in vivo depletion of immunosuppressive cell activity
SI1761528T1 (en) 2004-06-11 2008-06-30 Japan Tobacco Inc 5-AMINO-2,4,7-TRIOXO-3,4,7,8-TETRAHYDRO-2H-PYRIDO?á2,3-D?åPYRIMIDINE DERIVATIVES AND RELATED COMPOUNDS FOR THE TREATMENT OF CANCER
US7378423B2 (en) 2004-06-11 2008-05-27 Japan Tobacco Inc. Pyrimidine compound and medical use thereof
GB0512324D0 (en) 2005-06-16 2005-07-27 Novartis Ag Organic compounds
US20060009360A1 (en) 2004-06-25 2006-01-12 Robert Pifer New adjuvant composition
US20060099203A1 (en) 2004-11-05 2006-05-11 Pease Larry R B7-DC binding antibody
WO2006028936A2 (en) 2004-09-02 2006-03-16 Genentech, Inc. Heteromultimeric molecules
JP5173428B2 (en) 2004-11-10 2013-04-03 ディアデクサス インコーポレーテッド Ovr110 antibody compositions and methods of use
US8188232B1 (en) 2004-11-15 2012-05-29 Washington University In St. Louis Compositions and methods for modulating lymphocyte activity
WO2006074228A1 (en) 2005-01-07 2006-07-13 Lexicon Pharmaceuticals, Inc. Monoclonal antibodies against angiopoietin-like protein 4 (angptl4 )
WO2006096527A2 (en) 2005-03-04 2006-09-14 Diversa Corporation Nucleic acids and proteins and methods for making and using them
JP5171611B2 (en) 2005-03-25 2013-03-27 ナショナル リサーチ カウンシル オブ カナダ Method for isolating soluble polypeptides
PT2343320T (en) 2005-03-25 2018-01-23 Gitr Inc Anti-gitr antibodies and uses thereof
AU2006232287B2 (en) 2005-03-31 2011-10-06 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
DK2439273T3 (en) 2005-05-09 2019-06-03 Ono Pharmaceutical Co HUMAN MONOCLONAL ANTIBODIES FOR PROGRAMMED DEATH-1 (PD-1) AND PROCEDURES FOR TREATMENT OF CANCER USING ANTI-PD-1 ANTIBODIES ALONE OR IN COMBINATION WITH OTHER IMMUNTER APPLICATIONS
PL1879573T3 (en) 2005-05-10 2013-05-31 Incyte Holdings Corp Modulators of indoleamine 2,3-dioxygenase and methods of using the same
GB0510390D0 (en) 2005-05-20 2005-06-29 Novartis Ag Organic compounds
US8303955B2 (en) 2005-05-26 2012-11-06 Seattle Genetics, Inc. Humanized anti-CD40 antibodies and their methods of use
CA2611861C (en) 2005-06-08 2017-11-28 The Brigham And Women's Hospital, Inc. Methods and compositions for the treatment of persistent infections
JP2006345852A (en) 2005-06-16 2006-12-28 Virxsys Corp Antibody complex
DE102005028778A1 (en) 2005-06-22 2006-12-28 SUNJÜT Deutschland GmbH Multi-layer foil, useful for lining a flexible container, comprises a barrier layer, a stretch-poor plastic layer, an antistatic plastic layer and a layer containing a safe material for food
WO2007004415A1 (en) 2005-07-01 2007-01-11 Murata Manufacturing Co., Ltd. Multilayer ceramic substrate, process for producing the same and composite green sheet for production of multilayer ceramic substrate
PT1907424E (en) 2005-07-01 2015-10-09 Squibb & Sons Llc Human monoclonal antibodies to programmed death ligand 1 (pd-l1)
EP2397498A3 (en) 2005-07-18 2013-11-27 Amgen, Inc Human anti-B7RP1 neutralizing antibodies
TWI387592B (en) 2005-08-30 2013-03-01 Novartis Ag Substituted benzimidazoles and methods of their use as inhibitors of kinases associated with tumorigenesis
PT1931710T (en) 2005-08-31 2017-03-28 Merck Sharp & Dohme Engineered anti-il-23 antibodies
WO2007067991A2 (en) 2005-12-08 2007-06-14 Medarex, Inc. Human monoclonal antibodies to o8e
SG10202003901UA (en) 2005-12-13 2020-05-28 Incyte Holdings Corp Heteroaryl substituted pyrrolo[2,3-b]pyridines and pyrrolo[2,3-b]pyrimidines as janus kinase inhibitors
WO2007133822A1 (en) 2006-01-19 2007-11-22 Genzyme Corporation Gitr antibodies for the treatment of cancer
JO2660B1 (en) 2006-01-20 2012-06-17 نوفارتيس ايه جي PI-3 Kinase inhibitors and methods of their use
CN101495136A (en) 2006-02-15 2009-07-29 英克隆系统公司 Antibody formulations
PT1999154E (en) 2006-03-24 2013-01-24 Merck Patent Gmbh Engineered heterodimeric protein domains
UA93548C2 (en) 2006-05-05 2011-02-25 Айерем Елелсі Compounds and compositions as hedgehog pathway modulators
JP2009541275A (en) 2006-06-22 2009-11-26 ノボ・ノルデイスク・エー/エス Production of bispecific antibodies
PE20110220A1 (en) 2006-08-02 2011-04-11 Novartis Ag DERIVATIVES OF 2-OXO-ETHYL-AMINO-PROPIONAMIDE-PYRROLIDIN-2-IL-SUBSTITUTED AS INHIBITORS OF THE BINDING OF THE PROTEIN Smac TO THE INHIBITOR OF THE PROTEIN OF APOPTOSIS
AR064801A1 (en) 2006-08-18 2009-04-29 Xoma Technology Ltd PRLR SPECIFIC ANTIBODY (PROLACTIN RECEPTOR) AND ITS USES
AU2007286808B2 (en) 2006-08-21 2012-12-06 Genentech, Inc. Aza-benzofuranyl compounds and methods of use
CN101516914A (en) 2006-09-29 2009-08-26 霍夫曼-拉罗奇有限公司 Antibodies against CCR5 and uses thereof
GB0620894D0 (en) 2006-10-20 2006-11-29 Univ Southampton Human immune therapies using a CD27 agonist alone or in combination with other immune modulators
EP2097447A4 (en) 2006-11-15 2010-12-29 Medarex Inc Human monoclonal antibodies to btla and methods of use
EA017405B9 (en) 2006-12-08 2014-05-30 АйАрЭм ЭлЭлСи Compounds and compositions as protein kinase inhibitors
US20080226635A1 (en) 2006-12-22 2008-09-18 Hans Koll Antibodies against insulin-like growth factor I receptor and uses thereof
EP2124998B8 (en) 2006-12-27 2015-05-06 The Johns Hopkins University Methods for detecting inflammation and auto-immune diseases
EP1987839A1 (en) 2007-04-30 2008-11-05 I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease
BR122017025062B8 (en) 2007-06-18 2021-07-27 Merck Sharp & Dohme monoclonal antibody or antibody fragment to human programmed death receptor pd-1, polynucleotide and composition comprising said antibody or fragment
US8591886B2 (en) 2007-07-12 2013-11-26 Gitr, Inc. Combination therapies employing GITR binding molecules
KR20100058509A (en) 2007-07-31 2010-06-03 메디뮨 엘엘씨 Multispecific epitope binding proteins and uses thereof
WO2009024531A1 (en) 2007-08-17 2009-02-26 INSERM (Institut National de la Santé et de la Recherche Médicale) Method for treating and diagnosing hematologic malignancies
US8748356B2 (en) 2007-10-19 2014-06-10 Janssen Biotech, Inc. Methods for use in human-adapting monoclonal antibodies
MX2010004831A (en) 2007-11-02 2010-05-21 Novartis Ag Improved nogo-a binding molecules and pharmaceutical use thereof.
PT2594590E (en) 2007-12-14 2015-01-14 Bristol Myers Squibb Co Method of producing binding molecules for the human ox40 receptor
AU2008343589A1 (en) 2007-12-19 2009-07-09 Centocor Ortho Biotech Inc. Design and generation of human de novo pIX phage display libraries via fusion to pIX or pVII, vectors, antibodies and methods
JP5421925B2 (en) 2007-12-19 2014-02-19 ジェネンテック, インコーポレイテッド 5-Anilinoimidazopyridine and method of use
US8227577B2 (en) 2007-12-21 2012-07-24 Hoffman-La Roche Inc. Bivalent, bispecific antibodies
US20090162359A1 (en) 2007-12-21 2009-06-25 Christian Klein Bivalent, bispecific antibodies
US9266967B2 (en) 2007-12-21 2016-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
US8242247B2 (en) 2007-12-21 2012-08-14 Hoffmann-La Roche Inc. Bivalent, bispecific antibodies
EP2262837A4 (en) 2008-03-12 2011-04-06 Merck Sharp & Dohme BINDING PROTEINS WITH PD-1
EP2252293B1 (en) 2008-03-14 2018-06-27 Intellikine, LLC Kinase inhibitors and methods of use
PE20091628A1 (en) 2008-03-19 2009-11-19 Novartis Ag CRYSTALLINE FORMS AND TWO SOLVATED FORMS OF LACTIC ACID SALTS OF 4-AMINO-5-FLUORO-3- [5- (4-METHYLPIPERAZIN-1-IL) -1H-BENZIMIDAZOL-2-IL] QUINOLIN-2 (1H) - ONA
FR2929946B1 (en) 2008-04-11 2010-05-28 Pf Medicament NOVEL ANTI-CD151 ANTIBODIES AND THEIR USE FOR THE TREATMENT OF CANCER
EP2279003A4 (en) 2008-05-01 2013-04-03 Gtc Biotherapeutics Inc ANTI-CD137 ANTIBODIES AS AN AGENT IN THE TREATMENT OF INFLAMMATORY CONDITIONS
ES2554513T3 (en) 2008-05-23 2015-12-21 Novartis Ag Quinoline and quinoxaline derivatives as protein tyrosine kinase inhibitors
PE20100087A1 (en) 2008-06-25 2010-02-08 Irm Llc COMPOUNDS AND COMPOSITIONS AS KINASE INHIBITORS
NZ590667A (en) 2008-07-02 2013-01-25 Emergent Product Dev Seattle Tgf-b antagonist multi-target binding proteins
BRPI0915231A2 (en) 2008-07-08 2018-06-12 Intellikine Inc kinase inhibitor compounds and methods of use
US20100041663A1 (en) 2008-07-18 2010-02-18 Novartis Ag Organic Compounds as Smo Inhibitors
WO2010017103A2 (en) 2008-08-04 2010-02-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Fully human anti-human nkg2d monoclonal antibodies
AR072999A1 (en) 2008-08-11 2010-10-06 Medarex Inc HUMAN ANTIBODIES THAT JOIN GEN 3 OF LYMPHOCYTARY ACTIVATION (LAG-3) AND THE USES OF THESE
ES2522346T3 (en) 2008-08-22 2014-11-14 Novartis Ag Pyrrolopyrimidine compounds as CDK inhibitors
PL2344474T3 (en) 2008-09-02 2016-03-31 Novartis Ag Picolinamide derivatives as kinase inhibitors
UA104147C2 (en) 2008-09-10 2014-01-10 Новартис Аг PYROLIDINDICARBONIC ACID DERIVATIVE AND ITS APPLICATION IN THE TREATMENT OF PROLIFERATIVE DISEASES
AU2009290544B2 (en) 2008-09-12 2015-07-16 Oxford University Innovation Limited PD-1 specific antibodies and uses thereof
US9181342B2 (en) 2008-09-12 2015-11-10 Isis Innovation Limited PD-1 specific antibodies and uses thereof
CN102149820B (en) 2008-09-12 2014-07-23 国立大学法人三重大学 Cells capable of expressing exogenous GITR ligands
CA2738429C (en) 2008-09-26 2016-10-25 Intellikine, Inc. Heterocyclic kinase inhibitors
US8552154B2 (en) 2008-09-26 2013-10-08 Emory University Anti-PD-L1 antibodies and uses therefor
KR101050829B1 (en) 2008-10-02 2011-07-20 서울대학교산학협력단 Anticancer agents comprising an anti-PD-1 antibody or an anti-PD-L1 antibody
JP2012505654A (en) 2008-10-14 2012-03-08 ヤンセン バイオテツク,インコーポレーテツド Methods for humanizing and affinity maturating antibodies
JO3096B1 (en) 2008-11-07 2017-03-15 Imclone Llc Anti-tgf-beta receptor ii antibodies
MA32934B1 (en) 2008-11-28 2012-01-02 Novartis Ag Counter fittings for HSP90
EP3255060A1 (en) 2008-12-09 2017-12-13 F. Hoffmann-La Roche AG Anti-pd-l1 antibodies and their use to enhance t-cell function
WO2010078580A2 (en) 2009-01-05 2010-07-08 The Johns Hopkins University Immunotherapy for contact dermatitis using co-signal regulation
CA2746470A1 (en) 2009-01-06 2010-07-15 Raymond-David Pridmore Processing of macronutrients
US20120017292A1 (en) 2009-01-16 2012-01-19 Kovalic David K Isolated novel nucleic acid and protein molecules from corn and methods of using those molecules to generate transgene plants with enhanced agronomic traits
EP2210903A1 (en) 2009-01-21 2010-07-28 Monoclonal Antibodies Therapeutics Anti-CD160 monoclonal antibodies and uses thereof
JP5844159B2 (en) 2009-02-09 2016-01-13 ユニヴェルシテ デクス−マルセイユUniversite D’Aix−Marseille PD-1 antibody and PD-L1 antibody and use thereof
UA103918C2 (en) 2009-03-02 2013-12-10 Айерем Элелси N-(hetero)aryl, 2-(hetero)aryl-substituted acetamides for use as wnt signaling modulators
AR075989A1 (en) 2009-04-10 2011-05-11 Lilly Co Eli ANTIBODY DKK -1 (DICKKOPF-1) HUMAN DESIGNED BY ENGINEERING
WO2010129304A2 (en) 2009-04-27 2010-11-11 Oncomed Pharmaceuticals, Inc. Method for making heteromultimeric molecules
KR20180077322A (en) 2009-04-30 2018-07-06 텔 하쇼머 메디컬 리서치 인프라스트럭쳐 앤드 서비시스 리미티드. Anti ceacam1 antibodies and methods of using same
RU2420587C2 (en) 2009-06-25 2011-06-10 Открытое акционерное общество "Всероссийский научный Центр молекулярной диагностики и лечения" (ОАО ВНЦМДЛ) HUMANISED ANTIBODIES AND Fab BOUND WITH ANTIGEN F1 OF Yersinia pestis, AND METHOD FOR PRODUCING THEREOF WITH USING YEAST
WO2010149755A1 (en) 2009-06-26 2010-12-29 Novartis Ag 1, 3-disubstituted imidazolidin-2-one derivatives as inhibitors of cyp 17
BR112012007875A2 (en) 2009-07-31 2016-11-22 Medarex Inc fully human antibodies to btla
AR077975A1 (en) 2009-08-28 2011-10-05 Irm Llc PIRAZOL PYRIMIDINE DERIVATIVES AND COMPOSITIONS AS PROTEIN KINASE INHIBITORS
KR101790802B1 (en) 2009-09-03 2017-10-27 머크 샤프 앤드 돔 코포레이션 Anti-gitr antibodies
GB0919054D0 (en) 2009-10-30 2009-12-16 Isis Innovation Treatment of obesity
PL2504364T3 (en) 2009-11-24 2017-12-29 Medimmune Limited Targeted binding agents against b7-h1
US8961967B2 (en) 2009-11-30 2015-02-24 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
US8440693B2 (en) 2009-12-22 2013-05-14 Novartis Ag Substituted isoquinolinones and quinazolinones
CA2785907A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Ron binding constructs and methods of use thereof
UY33227A (en) 2010-02-19 2011-09-30 Novartis Ag PIRROLOPIRIMIDINE COMPOUNDS AS INHIBITORS OF THE CDK4 / 6
CN102985441B (en) 2010-02-19 2015-04-22 俄克拉何马大学董事会 Monoclonal antibody inhibiting Wnt signal transduction pathway and its preparation method and use
EP2542256B1 (en) 2010-03-04 2019-05-22 MacroGenics, Inc. Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof
EP2545078A1 (en) 2010-03-11 2013-01-16 UCB Pharma, S.A. Pd-1 antibody
HRP20241208T1 (en) 2010-04-20 2024-11-22 Genmab A/S HETERODIMER PROTEINS CONTAINING FC FRAGMENT OF ANTIBODIES AND PROCEDURES FOR THEIR PRODUCTION
EP2566514A4 (en) 2010-05-03 2013-11-27 Abbvie Inc Methods of inhibiting fibrosis using anti-pai-1 antibodies
PT2569013T (en) 2010-05-14 2017-02-08 Univ Leland Stanford Junior HUMANIZED AND CHEMISTRY MONOCLONAL ANTIBODIES FOR CD47
AU2011262758B8 (en) 2010-06-11 2014-09-04 Kyowa Kirin Co., Ltd. Anti-tim-3 antibody
WO2011159877A2 (en) 2010-06-18 2011-12-22 The Brigham And Women's Hospital, Inc. Bi-specific antibodies against tim-3 and pd-1 for immunotherapy in chronic immune conditions
AU2011290672B2 (en) 2010-08-20 2015-07-09 Novartis Ag Antibodies for epidermal growth factor receptor 3 (HER3)
CA2809089C (en) 2010-08-23 2018-12-18 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
MX337040B (en) 2010-09-09 2016-02-09 Pfizer 4-1bb binding molecules.
ES2757857T3 (en) 2010-09-27 2020-04-30 Janssen Biotech Inc Human Collagen II Binding Antibodies
MX2019000046A (en) 2010-11-04 2023-10-05 Boehringer Ingelheim Int Anti-il-23 antibodies.
ES2758994T3 (en) 2010-11-05 2020-05-07 Zymeworks Inc Stable heterodimeric antibody design with mutations in the Fc domain
GB201020995D0 (en) 2010-12-10 2011-01-26 Bioinvent Int Ab Biological materials and uses thereof
PT2691112T (en) 2011-03-31 2018-07-10 Merck Sharp & Dohme Stable formulations of antibodies to human programmed death receptor pd-1 and related treatments
JP6072771B2 (en) 2011-04-20 2017-02-01 メディミューン,エルエルシー Antibodies and other molecules that bind to B7-H1 and PD-1
WO2012145568A1 (en) 2011-04-21 2012-10-26 Albert Einstein College Of Medicine Of Yeshiva University Antibodies to human b7x for treatment of metastatic cancer
WO2012177624A2 (en) 2011-06-21 2012-12-27 The Johns Hopkins University Focused radiation for augmenting immune-based therapies against neoplasms
WO2013006490A2 (en) 2011-07-01 2013-01-10 Cellerant Therapeutics, Inc. Antibodies that specifically bind to tim3
MX368257B (en) 2011-08-01 2019-09-26 Genentech Inc Methods of treating cancer using pd-1 axis binding antagonists and mek inhibitors.
CA2845810C (en) 2011-08-23 2017-03-28 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
GB201115280D0 (en) 2011-09-05 2011-10-19 Alligator Bioscience Ab Antibodies, uses and methods
US9593062B2 (en) 2011-09-07 2017-03-14 Deutschland Krebsforschungszentrum Means and methods for treating and/or preventing natural AHR ligand-dependent cancer
WO2013039954A1 (en) 2011-09-14 2013-03-21 Sanofi Anti-gitr antibodies
WO2013054320A1 (en) 2011-10-11 2013-04-18 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
BR112014010580B1 (en) 2011-11-04 2021-01-12 Zymeworks, Inc. isolated heteromultimeric fc construct, composition, use of an isolated heteromultimeric fc construct, nucleic acid composition and method for expressing the isolated heteromultimeric fc construct
KR102063028B1 (en) 2012-01-23 2020-01-07 리제너론 파아마슈티컬스, 인크. Stabilized formulations containing anti-ang2 antibodies
UY34591A (en) 2012-01-26 2013-09-02 Novartis Ag IMIDAZOPIRROLIDINONA COMPOUNDS
UY34632A (en) 2012-02-24 2013-05-31 Novartis Ag OXAZOLIDIN- 2- ONA COMPOUNDS AND USES OF THE SAME
AR090263A1 (en) 2012-03-08 2014-10-29 Hoffmann La Roche COMBINED ANTIBODY THERAPY AGAINST HUMAN CSF-1R AND USES OF THE SAME
CN104379574B (en) 2012-05-15 2017-03-01 诺华股份有限公司 For suppressing the heterocyclic carbamate derivatives of the activity of ABL1, ABL2 and BCR ABL1
PE20161416A1 (en) 2012-05-15 2017-01-08 Novartis Ag BENZAMIDE DERIVATIVES FOR INHIBITION OF ABL1, ABL2 AND BCR-ABL1 ACTIVITY
HK1203971A1 (en) 2012-05-15 2015-11-06 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
CA2870339C (en) 2012-05-15 2020-06-02 Novartis Ag Compounds and compositions for inhibiting the activity of abl1, abl2 and bcr-abl1
WO2013171642A1 (en) 2012-05-15 2013-11-21 Novartis Ag Benzamide derivatives for inhibiting the activity of abl1, abl2 and bcr-abl1
EP3202419A1 (en) 2012-06-06 2017-08-09 OncoMed Pharmaceuticals, Inc. Pvrig binding agents that modulate the hippo pathway and uses thereof
JO3300B1 (en) 2012-06-06 2018-09-16 Novartis Ag Compounds and compositions for modulating egfr activity
IN2014KN00920A (en) 2012-06-21 2015-10-09 Compugen Ltd
WO2014022332A1 (en) 2012-07-31 2014-02-06 The Brigham And Women's Hospital, Inc. Modulation of the immune response
WO2014031718A1 (en) 2012-08-23 2014-02-27 Merck Sharp & Dohme Corp. Stable formulations of antibodies to tslp
US9376489B2 (en) 2012-09-07 2016-06-28 Novartis Ag IL-18 binding molecules
KR102270618B1 (en) 2012-10-30 2021-06-30 아펙시젠, 인코포레이티드 Anti-cd40 antibodies and methods of use
JP2015536964A (en) 2012-11-08 2015-12-24 ノバルティス アーゲー Pharmaceutical combinations comprising B-RAF inhibitors and histone deacetylase inhibitors and their use in the treatment of proliferative diseases
MX361088B (en) 2012-11-21 2018-11-26 Janssen Biotech Inc ANTIBODIES OF THE RECEIVER OF THE ISOLATED EPIDERMAL GROWTH FACTOR / OF THE RECEPTOR OF THE HEPATOCITES GROWTH FACTOR (EGFR / C-MET) BIESPECFICOS.
EP2925365A1 (en) 2012-11-28 2015-10-07 Novartis AG Combination therapy
CA2894879A1 (en) 2012-12-19 2014-06-26 Amplimmune, Inc. B7-h4 specific antibodies, and compositions and methods of use thereof
KR20200024345A (en) 2013-01-10 2020-03-06 젠맵 비. 브이 Human igg1 fc region variants and uses thereof
JO3519B1 (en) 2013-01-25 2020-07-05 Amgen Inc Antibody combinations for CDH19 and CD3
US9498532B2 (en) 2013-03-13 2016-11-22 Novartis Ag Antibody drug conjugates
JP6387360B2 (en) 2013-03-14 2018-09-05 ノバルティス アーゲー 3-pyrimidin-4-yl-oxazolidine-2-one as an inhibitor of mutant IDH
EP2970451A1 (en) 2013-03-14 2016-01-20 Amgen Inc. Chrdl-1 antigen binding proteins and methods of treatment
WO2014159562A1 (en) 2013-03-14 2014-10-02 Bristol-Myers Squibb Company Combination of dr5 agonist and anti-pd-1 antagonist and methods of use
JP6436965B2 (en) 2013-03-14 2018-12-12 ジェネンテック, インコーポレイテッド Anti-B7-H4 antibody and immunoconjugate
US9242969B2 (en) 2013-03-14 2016-01-26 Novartis Ag Biaryl amide compounds as kinase inhibitors
EP2968985A2 (en) 2013-03-15 2016-01-20 Amgen, Inc. Human antigen binding proteins that bind to proprotein convertase subtilisin kexin type 9
MX366910B (en) 2013-03-15 2019-07-30 Janssen Biotech Inc Manufacturing methods to control c-terminal lysine, galactose and sialic acid content in recombinant proteins.
SG10201708048XA (en) 2013-03-18 2017-10-30 Biocerox Prod Bv Humanized anti-cd134 (ox40) antibodies and uses thereof
SMT202100065T1 (en) 2013-05-02 2021-03-15 Anaptysbio Inc Antibodies directed against programmed death-1 (pd-1)
WO2014183066A2 (en) 2013-05-10 2014-11-13 Whitehead Institute For Biomedical Research Protein modification of living cells using sortase
WO2014183885A1 (en) 2013-05-17 2014-11-20 INSERM (Institut National de la Santé et de la Recherche Médicale) Antagonist of the btla/hvem interaction for use in therapy
WO2014194302A2 (en) 2013-05-31 2014-12-04 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-1
CN104250302B (en) 2013-06-26 2017-11-14 上海君实生物医药科技股份有限公司 The anti-antibody of PD 1 and its application
BR112016000853A2 (en) 2013-07-16 2017-12-12 Genentech Inc methods for treating or delaying, reducing or inhibiting cancer relapse or progression and the progression of an immune-related disease in an individual, to increase, improve or stimulate an immune response or function in an individual and kit.
CN105916878A (en) 2013-07-24 2016-08-31 丹娜法伯癌症研究院 Anti-galectin-1 monoclonal antibodies and fragments thereof
AR097306A1 (en) 2013-08-20 2016-03-02 Merck Sharp & Dohme MODULATION OF TUMOR IMMUNITY
KR20250024106A (en) 2013-08-22 2025-02-18 더 카운실 오브 더 퀸즐랜드 인스티튜트 오브 메디컬 리서치 Immunoreceptor modulation for treating cancer and viral infections
US10077305B2 (en) 2013-09-10 2018-09-18 Medimmune Limited Antibodies against PD-1 and uses thereof
CN112552401B (en) 2013-09-13 2023-08-25 广州百济神州生物制药有限公司 anti-PD 1 antibodies and their use as therapeutic and diagnostic agents
CN104558177B (en) 2013-10-25 2020-02-18 苏州思坦维生物技术股份有限公司 Monoclonal antibody for antagonizing and inhibiting programmed death receptor PD-1and ligand combination thereof, and coding sequence and application thereof
AP2016009099A0 (en) 2013-11-01 2016-03-31 Novartis Ag Aminoheteroaryl benzamides as kinase inhibitors
SG10201804945WA (en) 2013-12-12 2018-07-30 Shanghai hengrui pharmaceutical co ltd Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof
AU2014364593A1 (en) 2013-12-17 2016-07-07 Genentech, Inc. Methods of treating cancer using PD-1 axis binding antagonists and an anti-CD20 antibody
CN106029697B (en) 2013-12-20 2021-06-04 英特维特国际股份有限公司 Canine antibodies with modified CH2-CH3 sequences
US9456612B2 (en) 2013-12-26 2016-10-04 Zimplistic Pte. Ltd. Dry flour dispensing apparatus and using the same for a food preparation appliance
CN103721255A (en) 2014-01-07 2014-04-16 苏州大学 Application of co-blocking of PD-1 and TIM-3 signal paths to anti-stomach-cancer treatment
TWI680138B (en) 2014-01-23 2019-12-21 美商再生元醫藥公司 Human antibodies to pd-l1
TWI681969B (en) 2014-01-23 2020-01-11 美商再生元醫藥公司 Human antibodies to pd-1
PE20170255A1 (en) 2014-01-24 2017-03-22 Dana Farber Cancer Inst Inc ANTIBODY MOLECULES BINDING AND USES OF PD-1
HUE045065T2 (en) 2014-01-31 2019-12-30 Novartis Ag TIM-3 antibody molecules and their uses
ES2936810T3 (en) 2014-05-16 2023-03-22 Pfizer Bispecific antibodies with engineered CH1-CL interfaces
WO2015195163A1 (en) 2014-06-20 2015-12-23 R-Pharm Overseas, Inc. Pd-l1 antagonist fully human antibody
TWI693232B (en) 2014-06-26 2020-05-11 美商宏觀基因股份有限公司 Covalently bonded diabodies having immunoreactivity with pd-1 and lag-3, and methods of use thereof
US10280223B2 (en) 2014-07-09 2019-05-07 Nippon Zenyaku Kogyo Co., Ltd. Anti-canine PD-1 antibody or anti-canine PD-L1 antibody
BR112017001385B1 (en) 2014-07-22 2023-12-05 Cb Therapeutics, Inc. ISOLATED ANTIBODY OR FRAGMENT THEREOF THAT BINDS PD-1, USE OF IT, COMPOSITION, ISOLATED POLYNUCLEOTIDE AND EXPRESSION VECTOR
US9982052B2 (en) 2014-08-05 2018-05-29 MabQuest, SA Immunological reagents
KR102357893B1 (en) 2014-08-05 2022-02-04 맵퀘스트 에스아 Immunological reagents binding to pd-1
GB201419084D0 (en) 2014-10-27 2014-12-10 Agency Science Tech & Res Anti-PD-1 antibodies
EP3218409A2 (en) 2014-11-11 2017-09-20 Sutro Biopharma, Inc. Anti-pd-1 antibodies, compositions comprising anti-pd-1 antibodies and methods of using anti-pd-1 antibodies
TWI595006B (en) 2014-12-09 2017-08-11 禮納特神經系統科學公司 Anti-PD-1 antibodies and methods of using same
DK3237446T3 (en) 2014-12-22 2021-07-26 Pd 1 Acquisition Group Llc Anti-PD-1-antistoffer
KR20250004095A (en) 2015-04-17 2025-01-07 브리스톨-마이어스 스큅 컴퍼니 Compositions comprising a combination of an anti-pd-1 antibody and another antibody
US20180155429A1 (en) * 2015-05-28 2018-06-07 Bristol-Myers Squibb Company Treatment of pd-l1 positive lung cancer using an anti-pd-1 antibody
CN105061597B (en) 2015-06-09 2016-04-27 北京东方百泰生物科技有限公司 The monoclonal antibody of a kind of anti-PD-1 and preparation method thereof
KR20180019725A (en) 2015-06-23 2018-02-26 메모리얼 슬로안-케터링 캔서 센터 Novel pd-1 immune modulating agents
EA037548B1 (en) 2015-06-24 2021-04-12 Янссен Байотек, Инк. Immune modulation and treatment of solid tumors with antibodies that specifically bind cd38
US20170044265A1 (en) * 2015-06-24 2017-02-16 Janssen Biotech, Inc. Immune Modulation and Treatment of Solid Tumors with Antibodies that Specifically Bind CD38
MX383464B (en) 2015-07-13 2025-03-14 Cytomx Therapeutics Inc ANTI-PD-1 ANTIBODIES, ACTIVATABLE ANTI-PD-1 ANTIBODIES, AND METHODS OF USING THE SAME.
CN106699888B (en) 2015-07-28 2020-11-06 上海昀怡健康科技发展有限公司 PD-1 antibody and preparation method and application thereof
EP3328425B1 (en) 2015-07-29 2021-08-25 Novartis AG Combined use of anti pd-1 and anti m-csf antibodies in the treatment of cancer
RU2018105846A (en) 2015-07-29 2019-08-28 Новартис Аг COMBINATION OF PD-1 ANTAGONIST WITH EGFR INHIBITOR
HUE068868T2 (en) 2015-07-30 2025-02-28 Macrogenics Inc Pd-1-binding molecules and methods of use thereof
WO2017024465A1 (en) 2015-08-10 2017-02-16 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibodies
WO2017024515A1 (en) 2015-08-11 2017-02-16 Wuxi Biologics (Cayman) Inc. Novel anti-pd-1 antibodies
EP4458417A3 (en) 2015-08-11 2025-02-19 Wuxi Biologics Ireland Limited Novel anti-pd-1 antibodies
AU2016317915B2 (en) 2015-09-01 2021-02-18 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
MX2018003713A (en) 2015-09-24 2018-08-15 Teva Pharmaceuticals Int Gmbh Preventing, treating, and reducing (persistent) post-traumatic headache.
CN106999591B (en) 2015-09-28 2021-02-23 苏州盛迪亚生物医药有限公司 anti-PD-1 antibody preparation and application thereof in medicine
US10981991B2 (en) 2015-09-29 2021-04-20 Shanghai Zhangjiang Biotechnology Co., Ltd. PD-1 antibodies and uses thereof
BR112018006237A2 (en) 2015-09-29 2018-10-09 Celgene Corp pd-1 binding proteins and methods of using them
WO2017055966A1 (en) 2015-10-01 2017-04-06 Pfizer Inc. Low viscosity antibody compositions
ES2924402T3 (en) 2015-10-02 2022-10-06 Symphogen As Anti-PD-1 Antibodies and Compositions
EP3150636A1 (en) 2015-10-02 2017-04-05 F. Hoffmann-La Roche AG Tetravalent multispecific antibodies
WO2017055404A1 (en) 2015-10-02 2017-04-06 F. Hoffmann-La Roche Ag Bispecific antibodies specific for pd1 and tim3
ES2895034T3 (en) 2015-10-02 2022-02-17 Hoffmann La Roche Anti-PD1 Antibodies and Procedures for Use
CN106632674B (en) 2015-10-30 2018-11-16 泽达生物医药有限公司 A kind of anti-PD-1 monoclonal antibody, its medical composition and its use
PE20181326A1 (en) 2015-11-03 2018-08-20 Janssen Biotech Inc ANTIBODIES THAT SPECIFICALLY BIND PD-1 AND ITS USES
CA3003777A1 (en) 2015-11-18 2017-05-26 Merck Sharp & Dohme Corp. Pd1/ctla4 binders
CN106699889A (en) 2015-11-18 2017-05-24 礼进生物医药科技(上海)有限公司 PD-1 resisting antibody and treatment application thereof
ES2986067T3 (en) * 2015-12-17 2024-11-08 Novartis Ag Antibody molecules against PD-1 and their uses
WO2017122130A1 (en) 2016-01-11 2017-07-20 Novartis Ag Immune-stimulating humanized monoclonal antibodies against human interleukin-2, and fusion proteins thereof
CN118453872A (en) 2016-05-06 2024-08-09 塔里斯生物医药公司 Method for treating lower urinary tract urothelial cancer
US10336812B2 (en) 2016-05-10 2019-07-02 Janssen Biotech, Inc. GDF15 fusion proteins and uses thereof
WO2017196847A1 (en) 2016-05-10 2017-11-16 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Variable new antigen receptor (vnar) antibodies and antibody conjugates targeting tumor and viral antigens
JP2019517512A (en) 2016-06-03 2019-06-24 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Use of anti-PD-1 antibodies in the treatment of patients with colorectal cancer
WO2017214182A1 (en) 2016-06-07 2017-12-14 The United States Of America. As Represented By The Secretary, Department Of Health & Human Services Fully human antibody targeting pdi for cancer immunotherapy
WO2018026248A1 (en) 2016-08-05 2018-02-08 주식회사 와이바이오로직스 Novel antibody against programmed cell death protein (pd-1), and use thereof
WO2018027524A1 (en) 2016-08-09 2018-02-15 Innovent Biologics (Suzhou) Co., Ltd. Pd-1 antibody formulation
CN106977602B (en) 2016-08-23 2018-09-25 中山康方生物医药有限公司 A kind of anti-PD1 monoclonal antibodies, its medical composition and its use
MY192158A (en) 2016-09-14 2022-08-03 Abbvie Biotherapeutics Inc Anti-pd-1 antibodies and their uses
PE20191076A1 (en) 2016-09-14 2019-08-20 Beijing hanmi pharm co ltd ANTIBODY SPECIFICALLY JOINING PD-1 AND A FUNCTIONAL FRAGMENT OF THE SAME
MX2019002867A (en) 2016-09-19 2019-11-12 Celgene Corp Methods of treating immune disorders using pd-1 binding proteins.
PT3515938T (en) 2016-09-21 2025-04-10 Cstone Pharmaceuticals Shanghai Co Ltd The novel monoclonal antibodies to programmed death 1 (pd-1)
EP3624896A4 (en) 2017-05-16 2021-03-31 Biomed Valley Discoveries, Inc. COMPOSITIONS AND METHODS FOR THE TREATMENT OF CANCER WITH ATYPICAL BRAF MUTATIONS
CA3075215A1 (en) * 2017-09-08 2019-03-14 4Sc Ag Hdac inhibitor in combination with immune checkpoint modulator for cancer therapy

Also Published As

Publication number Publication date
US20190225689A1 (en) 2019-07-25
BR112020014618A2 (en) 2020-12-08
IL275897A (en) 2020-08-31
CA3089174A1 (en) 2019-07-25
MX2020007748A (en) 2020-09-25
KR20200112867A (en) 2020-10-05
ZA202005223B (en) 2022-03-30
JOP20200177A1 (en) 2020-07-19
SG11202006422PA (en) 2020-08-28
AU2019208537A1 (en) 2020-07-09
MA51677A (en) 2020-12-02
PH12020500576A1 (en) 2021-05-17
JP7579705B2 (en) 2024-11-08
CN120531867A (en) 2025-08-26
JP2021511341A (en) 2021-05-06
US12398209B2 (en) 2025-08-26
WO2019142149A2 (en) 2019-07-25
WO2019142149A3 (en) 2019-09-26
CN111629788A (en) 2020-09-04

Similar Documents

Publication Publication Date Title
US12398209B2 (en) Methods of treating cancers with antagonistic anti-PD-1 antibodies
US11446377B2 (en) Anti-B7-H1 and anti-CTLA-4 antibodies for treating non-small cell lung cancer
JP6841656B2 (en) Treatment of Cancer Using PD-1 Axle Antagonist and Taxane
CN110494161A (en) Combination of anti-PD-L1 antibody and DNA-PK inhibitor for the treatment of cancer
AU2016304597A1 (en) Methods and compositions for tumor therapy
JP2026031542A (en) Anti-CD73, anti-PD-L1 antibodies and chemotherapy for treating tumors - Patent Application 20070122997
TW202417479A (en) Combination therapy of anti-pd-1 active agent, anti-tim-3 active agent, and anti-lag-3 active agent for treating cancer
US20240327519A1 (en) Methods and compositions for treating cancer
EP3813868A1 (en) Dosing regimens for targeted tgf-b inhibition for use in treating cancer in treatment naive subjects
JP2025542297A (en) Combination Therapy for Lung Cancer
KR20240099411A (en) Corticosteroid reduction in treatment with anti-CD38 antibodies
HK40035107A (en) Methods of treating cancers with antagonistic anti-pd-1 antibodies
US20240092934A1 (en) Assessment of ceacam1 expression on tumor infiltrating lymphocytes
TW202612729A (en) Combination therapy involving anti-hla-g antibodies and anti-egfr antibodies and anti-pd-1 antibodies
WO2024163494A1 (en) Methods and compositions for treating non-small cell lung cancer and triple-negative breast cancer
JP2024536201A (en) Anti-galectin-9 antibodies and therapeutic uses thereof
JP2025539459A (en) Compositions and methods for neoadjuvant treatment in cancer
HK40112915A (en) Anti-galectin-9 antibodies and therapeutic uses thereof
HK40109234A (en) Methods and compositions for treating cancer
JP2025530130A (en) Methods of treating cancer with anti-TMEFF2xCD3 bispecific antibodies
HK40118859A (en) Anti-cd73, anti-pd-l1 antibodies and chemotherapy for treating tumors
CN120887995A (en) Treatment methods and approaches for castration-resistant prostate cancer

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20200814

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20230404

P01 Opt-out of the competence of the unified patent court (upc) registered

Effective date: 20230530