EP3265553A1 - Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof - Google Patents
Listeria-based compositions comprising a peptide minigene expression system and methods of use thereofInfo
- Publication number
- EP3265553A1 EP3265553A1 EP16759454.8A EP16759454A EP3265553A1 EP 3265553 A1 EP3265553 A1 EP 3265553A1 EP 16759454 A EP16759454 A EP 16759454A EP 3265553 A1 EP3265553 A1 EP 3265553A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- another embodiment
- listeria
- cancer
- recombinant
- recombinant listeria
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 241000186781 Listeria Species 0.000 title claims abstract description 385
- 238000000034 method Methods 0.000 title claims abstract description 263
- 230000014509 gene expression Effects 0.000 title claims abstract description 66
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 213
- 239000000203 mixture Substances 0.000 title abstract description 146
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 276
- 239000000427 antigen Substances 0.000 claims abstract description 191
- 230000028993 immune response Effects 0.000 claims abstract description 50
- 230000001939 inductive effect Effects 0.000 claims abstract description 22
- 108090000623 proteins and genes Proteins 0.000 claims description 293
- 101150082952 ACTA1 gene Proteins 0.000 claims description 167
- 150000007523 nucleic acids Chemical class 0.000 claims description 151
- 101710164436 Listeriolysin O Proteins 0.000 claims description 130
- 201000011510 cancer Diseases 0.000 claims description 123
- 108020004707 nucleic acids Proteins 0.000 claims description 121
- 102000039446 nucleic acids Human genes 0.000 claims description 121
- 239000013612 plasmid Substances 0.000 claims description 107
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 102
- 150000001413 amino acids Chemical class 0.000 claims description 93
- 102000004169 proteins and genes Human genes 0.000 claims description 79
- 235000018102 proteins Nutrition 0.000 claims description 78
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 77
- 102000037865 fusion proteins Human genes 0.000 claims description 71
- 108020001507 fusion proteins Proteins 0.000 claims description 71
- 235000001014 amino acid Nutrition 0.000 claims description 68
- 108700026244 Open Reading Frames Proteins 0.000 claims description 57
- 101150023527 actA gene Proteins 0.000 claims description 47
- 230000028327 secretion Effects 0.000 claims description 47
- 238000012217 deletion Methods 0.000 claims description 46
- 230000037430 deletion Effects 0.000 claims description 46
- 230000002238 attenuated effect Effects 0.000 claims description 44
- 230000001580 bacterial effect Effects 0.000 claims description 44
- 102000004190 Enzymes Human genes 0.000 claims description 43
- 108090000790 Enzymes Proteins 0.000 claims description 43
- 210000000349 chromosome Anatomy 0.000 claims description 41
- 101150030499 lnt gene Proteins 0.000 claims description 37
- 230000002503 metabolic effect Effects 0.000 claims description 36
- 239000008194 pharmaceutical composition Substances 0.000 claims description 35
- 239000002671 adjuvant Substances 0.000 claims description 34
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 30
- 241000186779 Listeria monocytogenes Species 0.000 claims description 28
- 108090000848 Ubiquitin Proteins 0.000 claims description 28
- 230000027455 binding Effects 0.000 claims description 26
- 230000015572 biosynthetic process Effects 0.000 claims description 21
- 230000004044 response Effects 0.000 claims description 21
- 239000002773 nucleotide Substances 0.000 claims description 20
- 125000003729 nucleotide group Chemical group 0.000 claims description 20
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 claims description 17
- 206010025323 Lymphomas Diseases 0.000 claims description 16
- 230000003115 biocidal effect Effects 0.000 claims description 16
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 claims description 14
- 102000004357 Transferases Human genes 0.000 claims description 14
- 108090000992 Transferases Proteins 0.000 claims description 14
- 210000004899 c-terminal region Anatomy 0.000 claims description 14
- 101150093386 prfA gene Proteins 0.000 claims description 14
- 101150046348 inlB gene Proteins 0.000 claims description 13
- 206010061818 Disease progression Diseases 0.000 claims description 11
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 11
- 230000005750 disease progression Effects 0.000 claims description 11
- 230000004083 survival effect Effects 0.000 claims description 11
- 206010006187 Breast cancer Diseases 0.000 claims description 10
- 208000026310 Breast neoplasm Diseases 0.000 claims description 10
- 230000006023 anti-tumor response Effects 0.000 claims description 10
- 230000002708 enhancing effect Effects 0.000 claims description 10
- 210000001165 lymph node Anatomy 0.000 claims description 10
- 230000000259 anti-tumor effect Effects 0.000 claims description 9
- 206010027476 Metastases Diseases 0.000 claims description 8
- 108010041525 Alanine racemase Proteins 0.000 claims description 7
- 108091034117 Oligonucleotide Proteins 0.000 claims description 7
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 7
- 201000008968 osteosarcoma Diseases 0.000 claims description 7
- 150000008574 D-amino acids Chemical class 0.000 claims description 6
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 claims description 6
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 claims description 6
- 108090001066 Racemases and epimerases Proteins 0.000 claims description 6
- 102000004879 Racemases and epimerases Human genes 0.000 claims description 6
- 230000001093 anti-cancer Effects 0.000 claims description 6
- 208000032839 leukemia Diseases 0.000 claims description 6
- 206010009944 Colon cancer Diseases 0.000 claims description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 5
- 208000017604 Hodgkin disease Diseases 0.000 claims description 5
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims description 5
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 5
- 230000009401 metastasis Effects 0.000 claims description 5
- 206010061289 metastatic neoplasm Diseases 0.000 claims description 5
- 229940035032 monophosphoryl lipid a Drugs 0.000 claims description 5
- 239000001397 quillaja saponaria molina bark Substances 0.000 claims description 5
- 229930182490 saponin Natural products 0.000 claims description 5
- 150000007949 saponins Chemical class 0.000 claims description 5
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 claims description 4
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 4
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 4
- 206010017758 gastric cancer Diseases 0.000 claims description 4
- 210000003714 granulocyte Anatomy 0.000 claims description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 4
- 201000008129 pancreatic ductal adenocarcinoma Diseases 0.000 claims description 4
- 201000011549 stomach cancer Diseases 0.000 claims description 4
- 208000034578 Multiple myelomas Diseases 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 2
- 230000008826 genomic mutation Effects 0.000 claims 17
- 102000044159 Ubiquitin Human genes 0.000 claims 8
- 206010005949 Bone cancer Diseases 0.000 claims 3
- 208000018084 Bone neoplasm Diseases 0.000 claims 3
- 206010070308 Refractory cancer Diseases 0.000 claims 3
- 208000016691 refractory malignant neoplasm Diseases 0.000 claims 3
- 206010041823 squamous cell carcinoma Diseases 0.000 claims 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims 3
- 230000001934 delay Effects 0.000 claims 2
- 108091007433 antigens Proteins 0.000 abstract description 184
- 102000036639 antigens Human genes 0.000 abstract description 184
- 239000013598 vector Substances 0.000 abstract description 46
- 239000012634 fragment Substances 0.000 description 173
- 210000004027 cell Anatomy 0.000 description 99
- 241000894006 Bacteria Species 0.000 description 84
- 102000004196 processed proteins & peptides Human genes 0.000 description 67
- 229940024606 amino acid Drugs 0.000 description 64
- 229920001184 polypeptide Polymers 0.000 description 51
- 241000699670 Mus sp. Species 0.000 description 49
- 229960005486 vaccine Drugs 0.000 description 49
- 230000002163 immunogen Effects 0.000 description 44
- 108020004414 DNA Proteins 0.000 description 43
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 42
- 201000010099 disease Diseases 0.000 description 38
- 238000003752 polymerase chain reaction Methods 0.000 description 37
- 101100434723 Bacillus subtilis (strain 168) alr1 gene Proteins 0.000 description 33
- 101100215901 Staphylococcus aureus (strain NCTC 8325 / PS 47) alr2 gene Proteins 0.000 description 33
- 101100171116 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) dprA gene Proteins 0.000 description 33
- 101100276985 Xenopus laevis ccdc88c gene Proteins 0.000 description 33
- 101150070828 alr gene Proteins 0.000 description 33
- 229940088598 enzyme Drugs 0.000 description 31
- 230000001965 increasing effect Effects 0.000 description 31
- 101150024289 hly gene Proteins 0.000 description 30
- 230000035772 mutation Effects 0.000 description 30
- 230000004927 fusion Effects 0.000 description 29
- 210000003289 regulatory T cell Anatomy 0.000 description 29
- 241000701806 Human papillomavirus Species 0.000 description 27
- 241000607479 Yersinia pestis Species 0.000 description 25
- 230000010354 integration Effects 0.000 description 24
- 230000001105 regulatory effect Effects 0.000 description 21
- 230000001018 virulence Effects 0.000 description 21
- 239000012636 effector Substances 0.000 description 20
- 238000002474 experimental method Methods 0.000 description 20
- 241001465754 Metazoa Species 0.000 description 19
- 230000005867 T cell response Effects 0.000 description 18
- 238000003786 synthesis reaction Methods 0.000 description 18
- 238000011282 treatment Methods 0.000 description 18
- 208000024891 symptom Diseases 0.000 description 17
- 108010006533 ATP-Binding Cassette Transporters Proteins 0.000 description 16
- 102000005416 ATP-Binding Cassette Transporters Human genes 0.000 description 16
- 208000022361 Human papillomavirus infectious disease Diseases 0.000 description 16
- 102400000757 Ubiquitin Human genes 0.000 description 16
- 229960005091 chloramphenicol Drugs 0.000 description 16
- 208000015181 infectious disease Diseases 0.000 description 16
- 101150114864 plcA gene Proteins 0.000 description 16
- 210000000952 spleen Anatomy 0.000 description 16
- 238000011740 C57BL/6 mouse Methods 0.000 description 15
- 239000013604 expression vector Substances 0.000 description 15
- 230000012010 growth Effects 0.000 description 15
- 230000001404 mediated effect Effects 0.000 description 15
- 239000000047 product Substances 0.000 description 15
- 210000004988 splenocyte Anatomy 0.000 description 15
- 230000004614 tumor growth Effects 0.000 description 15
- 241000588724 Escherichia coli Species 0.000 description 14
- 102100037850 Interferon gamma Human genes 0.000 description 14
- 108010074328 Interferon-gamma Proteins 0.000 description 14
- 125000003275 alpha amino acid group Chemical group 0.000 description 14
- 101150013359 E7 gene Proteins 0.000 description 13
- 102100022399 Ribosome biogenesis protein NOP53 Human genes 0.000 description 13
- 230000002950 deficient Effects 0.000 description 13
- 238000001727 in vivo Methods 0.000 description 13
- 210000004881 tumor cell Anatomy 0.000 description 13
- 101100452614 Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) inlC gene Proteins 0.000 description 12
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 12
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 12
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 12
- 230000002759 chromosomal effect Effects 0.000 description 12
- 238000010276 construction Methods 0.000 description 12
- 238000003780 insertion Methods 0.000 description 12
- 230000037431 insertion Effects 0.000 description 12
- 230000010076 replication Effects 0.000 description 12
- 102000004127 Cytokines Human genes 0.000 description 11
- 108090000695 Cytokines Proteins 0.000 description 11
- 239000003242 anti bacterial agent Substances 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 11
- 230000002949 hemolytic effect Effects 0.000 description 11
- 230000003053 immunization Effects 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 11
- 239000002953 phosphate buffered saline Substances 0.000 description 11
- 238000011144 upstream manufacturing Methods 0.000 description 11
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 10
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 10
- 102100038358 Prostate-specific antigen Human genes 0.000 description 10
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 10
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 10
- 238000011374 additional therapy Methods 0.000 description 10
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 10
- 208000035473 Communicable disease Diseases 0.000 description 9
- 229940088710 antibiotic agent Drugs 0.000 description 9
- 230000000890 antigenic effect Effects 0.000 description 9
- 238000002649 immunization Methods 0.000 description 9
- 230000000415 inactivating effect Effects 0.000 description 9
- 230000002401 inhibitory effect Effects 0.000 description 9
- 201000001441 melanoma Diseases 0.000 description 9
- 239000006228 supernatant Substances 0.000 description 9
- 238000002255 vaccination Methods 0.000 description 9
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 8
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 8
- 230000001772 anti-angiogenic effect Effects 0.000 description 8
- 230000005975 antitumor immune response Effects 0.000 description 8
- 238000010367 cloning Methods 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 7
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 7
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 7
- 102100037241 Endoglin Human genes 0.000 description 7
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 7
- 108010002687 Survivin Proteins 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 230000002491 angiogenic effect Effects 0.000 description 7
- 239000013611 chromosomal DNA Substances 0.000 description 7
- 230000006801 homologous recombination Effects 0.000 description 7
- 238000002744 homologous recombination Methods 0.000 description 7
- 230000005847 immunogenicity Effects 0.000 description 7
- 230000002601 intratumoral effect Effects 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 238000002703 mutagenesis Methods 0.000 description 7
- 231100000350 mutagenesis Toxicity 0.000 description 7
- 210000004882 non-tumor cell Anatomy 0.000 description 7
- 235000015097 nutrients Nutrition 0.000 description 7
- 230000007480 spreading Effects 0.000 description 7
- 238000003892 spreading Methods 0.000 description 7
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 7
- 101150029707 ERBB2 gene Proteins 0.000 description 6
- 238000010222 PCR analysis Methods 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 230000037354 amino acid metabolism Effects 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 210000002216 heart Anatomy 0.000 description 6
- 230000036039 immunity Effects 0.000 description 6
- 238000009169 immunotherapy Methods 0.000 description 6
- 230000036961 partial effect Effects 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 101150050662 plcB gene Proteins 0.000 description 6
- 230000035755 proliferation Effects 0.000 description 6
- 108010014186 ras Proteins Proteins 0.000 description 6
- 239000007787 solid Substances 0.000 description 6
- 241000894007 species Species 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 230000005030 transcription termination Effects 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- WHUUTDBJXJRKMK-GSVOUGTGSA-N D-glutamic acid Chemical compound OC(=O)[C@H](N)CCC(O)=O WHUUTDBJXJRKMK-GSVOUGTGSA-N 0.000 description 5
- 229930182847 D-glutamic acid Natural products 0.000 description 5
- 241000725303 Human immunodeficiency virus Species 0.000 description 5
- 101000954493 Human papillomavirus type 16 Protein E6 Proteins 0.000 description 5
- 101000954519 Human papillomavirus type 18 Protein E6 Proteins 0.000 description 5
- 101000767629 Human papillomavirus type 18 Protein E7 Proteins 0.000 description 5
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 5
- -1 Mucl Proteins 0.000 description 5
- 201000005702 Pertussis Diseases 0.000 description 5
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 5
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 5
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 5
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 5
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 5
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 5
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 239000008186 active pharmaceutical agent Substances 0.000 description 5
- 210000000612 antigen-presenting cell Anatomy 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 210000000172 cytosol Anatomy 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 230000029087 digestion Effects 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- 244000052769 pathogen Species 0.000 description 5
- 230000002093 peripheral effect Effects 0.000 description 5
- 239000013600 plasmid vector Substances 0.000 description 5
- 230000037452 priming Effects 0.000 description 5
- 230000006798 recombination Effects 0.000 description 5
- 238000005215 recombination Methods 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 108091008146 restriction endonucleases Proteins 0.000 description 5
- 238000007920 subcutaneous administration Methods 0.000 description 5
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 5
- 238000001356 surgical procedure Methods 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 5
- 230000001131 transforming effect Effects 0.000 description 5
- 201000008827 tuberculosis Diseases 0.000 description 5
- 229920001817 Agar Polymers 0.000 description 4
- 108700028369 Alleles Proteins 0.000 description 4
- 102000008076 Angiogenic Proteins Human genes 0.000 description 4
- 108010074415 Angiogenic Proteins Proteins 0.000 description 4
- 206010051999 Anogenital dysplasia Diseases 0.000 description 4
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 4
- 235000014469 Bacillus subtilis Nutrition 0.000 description 4
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 4
- 206010008263 Cervical dysplasia Diseases 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 4
- 102000003745 Hepatocyte Growth Factor Human genes 0.000 description 4
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 4
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 4
- 101000881679 Homo sapiens Endoglin Proteins 0.000 description 4
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 4
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 4
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 4
- 108091054437 MHC class I family Proteins 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 101000746457 Neisseria gonorrhoeae UPF0213 protein in glnA 3'region Proteins 0.000 description 4
- 206010037742 Rabies Diseases 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 102000003425 Tyrosinase Human genes 0.000 description 4
- 108060008724 Tyrosinase Proteins 0.000 description 4
- 206010046905 Vaginal dysplasia Diseases 0.000 description 4
- 208000003152 Yellow Fever Diseases 0.000 description 4
- 239000008272 agar Substances 0.000 description 4
- 230000030741 antigen processing and presentation Effects 0.000 description 4
- 210000004556 brain Anatomy 0.000 description 4
- 208000007951 cervical intraepithelial neoplasia Diseases 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 210000000805 cytoplasm Anatomy 0.000 description 4
- 101150012893 dat gene Proteins 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 208000002672 hepatitis B Diseases 0.000 description 4
- 238000009396 hybridization Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 206010022000 influenza Diseases 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 101150108670 inlC gene Proteins 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 210000005210 lymphoid organ Anatomy 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 201000000050 myeloid neoplasm Diseases 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 230000005855 radiation Effects 0.000 description 4
- 102000016914 ras Proteins Human genes 0.000 description 4
- 238000003753 real-time PCR Methods 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 230000004936 stimulating effect Effects 0.000 description 4
- 208000011580 syndromic disease Diseases 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 208000030507 AIDS Diseases 0.000 description 3
- 208000023275 Autoimmune disease Diseases 0.000 description 3
- 241000193738 Bacillus anthracis Species 0.000 description 3
- 108010078791 Carrier Proteins Proteins 0.000 description 3
- 206010008631 Cholera Diseases 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 230000004544 DNA amplification Effects 0.000 description 3
- 206010058314 Dysplasia Diseases 0.000 description 3
- 108010000912 Egg Proteins Proteins 0.000 description 3
- 102000002322 Egg Proteins Human genes 0.000 description 3
- 108010036395 Endoglin Proteins 0.000 description 3
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 3
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 3
- 241000192125 Firmicutes Species 0.000 description 3
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 3
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 3
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 3
- 102100034867 Kallikrein-7 Human genes 0.000 description 3
- 101710176222 Kallikrein-7 Proteins 0.000 description 3
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 3
- 101710192602 Latent membrane protein 1 Proteins 0.000 description 3
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 3
- 102000043129 MHC class I family Human genes 0.000 description 3
- 201000005505 Measles Diseases 0.000 description 3
- 208000005647 Mumps Diseases 0.000 description 3
- 241001494479 Pecora Species 0.000 description 3
- 229930182555 Penicillin Natural products 0.000 description 3
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 3
- 108010004729 Phycoerythrin Proteins 0.000 description 3
- 208000000474 Poliomyelitis Diseases 0.000 description 3
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 230000024932 T cell mediated immunity Effects 0.000 description 3
- 206010043376 Tetanus Diseases 0.000 description 3
- 102100040247 Tumor necrosis factor Human genes 0.000 description 3
- 241000700647 Variola virus Species 0.000 description 3
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 3
- 208000008383 Wilms tumor Diseases 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 230000001154 acute effect Effects 0.000 description 3
- 239000002870 angiogenesis inducing agent Substances 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- 238000009175 antibody therapy Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 238000002619 cancer immunotherapy Methods 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 210000003169 central nervous system Anatomy 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 238000011254 conventional chemotherapy Methods 0.000 description 3
- 239000012228 culture supernatant Substances 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 210000002969 egg yolk Anatomy 0.000 description 3
- 235000013345 egg yolk Nutrition 0.000 description 3
- 238000001378 electrochemiluminescence detection Methods 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- 231100000283 hepatitis Toxicity 0.000 description 3
- 208000005252 hepatitis A Diseases 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000011081 inoculation Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- 108010082117 matrigel Proteins 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 208000010805 mumps infectious disease Diseases 0.000 description 3
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 3
- 210000004898 n-terminal fragment Anatomy 0.000 description 3
- 210000000496 pancreas Anatomy 0.000 description 3
- 230000007918 pathogenicity Effects 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 229940049954 penicillin Drugs 0.000 description 3
- 229960000502 poloxamer Drugs 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 102000040430 polynucleotide Human genes 0.000 description 3
- 239000002157 polynucleotide Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 238000001959 radiotherapy Methods 0.000 description 3
- 201000005404 rubella Diseases 0.000 description 3
- 230000003248 secreting effect Effects 0.000 description 3
- 230000002269 spontaneous effect Effects 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 229960005322 streptomycin Drugs 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- NMWKYTGJWUAZPZ-WWHBDHEGSA-N (4S)-4-[[(4R,7S,10S,16S,19S,25S,28S,31R)-31-[[(2S)-2-[[(1R,6R,9S,12S,18S,21S,24S,27S,30S,33S,36S,39S,42R,47R,53S,56S,59S,62S,65S,68S,71S,76S,79S,85S)-47-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-methylbutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-phenylpropanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]-18-(4-aminobutyl)-27,68-bis(3-amino-3-oxopropyl)-36,71,76-tribenzyl-39-(3-carbamimidamidopropyl)-24-(2-carboxyethyl)-21,56-bis(carboxymethyl)-65,85-bis[(1R)-1-hydroxyethyl]-59-(hydroxymethyl)-62,79-bis(1H-imidazol-4-ylmethyl)-9-methyl-33-(2-methylpropyl)-8,11,17,20,23,26,29,32,35,38,41,48,54,57,60,63,66,69,72,74,77,80,83,86-tetracosaoxo-30-propan-2-yl-3,4,44,45-tetrathia-7,10,16,19,22,25,28,31,34,37,40,49,55,58,61,64,67,70,73,75,78,81,84,87-tetracosazatetracyclo[40.31.14.012,16.049,53]heptaoctacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-7-(3-carbamimidamidopropyl)-25-(hydroxymethyl)-19-[(4-hydroxyphenyl)methyl]-28-(1H-imidazol-4-ylmethyl)-10-methyl-6,9,12,15,18,21,24,27,30-nonaoxo-16-propan-2-yl-1,2-dithia-5,8,11,14,17,20,23,26,29-nonazacyclodotriacontane-4-carbonyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[(2S)-1-[[(1S)-1-carboxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](Cc4ccccc4)NC3=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc3ccccc3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3CCC[C@H]3C(=O)N[C@@H](C)C(=O)N2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2c[nH]cn2)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1)C(=O)N[C@@H](C)C(O)=O NMWKYTGJWUAZPZ-WWHBDHEGSA-N 0.000 description 2
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 2
- 101710139410 1-phosphatidylinositol phosphodiesterase Proteins 0.000 description 2
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- 208000026872 Addison Disease Diseases 0.000 description 2
- 208000004881 Amebiasis Diseases 0.000 description 2
- 206010001980 Amoebiasis Diseases 0.000 description 2
- 206010002198 Anaphylactic reaction Diseases 0.000 description 2
- 206010003594 Ataxia telangiectasia Diseases 0.000 description 2
- 206010055128 Autoimmune neutropenia Diseases 0.000 description 2
- 206010050245 Autoimmune thrombocytopenia Diseases 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 101100152417 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) tarI gene Proteins 0.000 description 2
- 244000063299 Bacillus subtilis Species 0.000 description 2
- 208000023328 Basedow disease Diseases 0.000 description 2
- 108010081589 Becaplermin Proteins 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 2
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 2
- 201000007155 CD40 ligand deficiency Diseases 0.000 description 2
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 2
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 2
- 241000282465 Canis Species 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 102000000018 Chemokine CCL2 Human genes 0.000 description 2
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 2
- 208000008818 Chronic Mucocutaneous Candidiasis Diseases 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 208000015943 Coeliac disease Diseases 0.000 description 2
- 241000711573 Coronaviridae Species 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 108010041986 DNA Vaccines Proteins 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- 206010012468 Dermatitis herpetiformis Diseases 0.000 description 2
- 206010059866 Drug resistance Diseases 0.000 description 2
- 241000224432 Entamoeba histolytica Species 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 241000701959 Escherichia virus Lambda Species 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 2
- 108010000916 Fimbriae Proteins Proteins 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 101710177291 Gag polyprotein Proteins 0.000 description 2
- 206010018364 Glomerulonephritis Diseases 0.000 description 2
- 102000017722 Glutamine amidotransferases Human genes 0.000 description 2
- 108050005901 Glutamine amidotransferases Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 2
- 208000015023 Graves' disease Diseases 0.000 description 2
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 2
- 241000606790 Haemophilus Species 0.000 description 2
- 241000606768 Haemophilus influenzae Species 0.000 description 2
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 2
- 108010006464 Hemolysin Proteins Proteins 0.000 description 2
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 2
- 208000007514 Herpes zoster Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 2
- 101000643024 Homo sapiens Stimulator of interferon genes protein Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 102000004890 Interleukin-8 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- 101710148809 Internalin C Proteins 0.000 description 2
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 description 2
- 241000186806 Listeria grayi Species 0.000 description 2
- 241000186780 Listeria ivanovii Species 0.000 description 2
- 241000186807 Listeria seeligeri Species 0.000 description 2
- 241000186814 Listeria welshimeri Species 0.000 description 2
- 206010024641 Listeriosis Diseases 0.000 description 2
- 102000003939 Membrane transport proteins Human genes 0.000 description 2
- 108090000301 Membrane transport proteins Proteins 0.000 description 2
- 201000009906 Meningitis Diseases 0.000 description 2
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 2
- 206010028080 Mucocutaneous candidiasis Diseases 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 2
- 102100028762 Neuropilin-1 Human genes 0.000 description 2
- 108090000772 Neuropilin-1 Proteins 0.000 description 2
- 102000008299 Nitric Oxide Synthase Human genes 0.000 description 2
- 108010021487 Nitric Oxide Synthase Proteins 0.000 description 2
- 108010038807 Oligopeptides Proteins 0.000 description 2
- 102000015636 Oligopeptides Human genes 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 241000150452 Orthohantavirus Species 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 241000721454 Pemphigus Species 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 208000031845 Pernicious anaemia Diseases 0.000 description 2
- 102100035846 Pigment epithelium-derived factor Human genes 0.000 description 2
- 102100039277 Pleiotrophin Human genes 0.000 description 2
- 208000009362 Pneumococcal Pneumonia Diseases 0.000 description 2
- 206010035728 Pneumonia pneumococcal Diseases 0.000 description 2
- 208000006994 Precancerous Conditions Diseases 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 2
- 208000033759 Prolymphocytic T-Cell Leukemia Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 102100037097 Protein disulfide-isomerase A3 Human genes 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- 208000025747 Rheumatic disease Diseases 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 2
- 241000607768 Shigella Species 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- 208000007156 Spondylarthritis Diseases 0.000 description 2
- 102100035533 Stimulator of interferon genes protein Human genes 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- 201000009594 Systemic Scleroderma Diseases 0.000 description 2
- 206010042953 Systemic sclerosis Diseases 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 208000026651 T-cell prolymphocytic leukemia Diseases 0.000 description 2
- 108010017842 Telomerase Proteins 0.000 description 2
- 108020005038 Terminator Codon Proteins 0.000 description 2
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 2
- 102100031372 Thymidine phosphorylase Human genes 0.000 description 2
- 108700023160 Thymidine phosphorylases Proteins 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 2
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 2
- 206010052779 Transplant rejections Diseases 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- 208000006391 Type 1 Hyper-IgM Immunodeficiency Syndrome Diseases 0.000 description 2
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
- 208000037386 Typhoid Diseases 0.000 description 2
- 208000024780 Urticaria Diseases 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- 206010047400 Vibrio infections Diseases 0.000 description 2
- 206010047642 Vitiligo Diseases 0.000 description 2
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 2
- 208000006110 Wiskott-Aldrich syndrome Diseases 0.000 description 2
- 201000001696 X-linked hyper IgM syndrome Diseases 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 206010002022 amyloidosis Diseases 0.000 description 2
- 230000036783 anaphylactic response Effects 0.000 description 2
- 208000003455 anaphylaxis Diseases 0.000 description 2
- 108010069801 angiopoietin 4 Proteins 0.000 description 2
- 230000005809 anti-tumor immunity Effects 0.000 description 2
- 208000010668 atopic eczema Diseases 0.000 description 2
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 2
- 229940065181 bacillus anthracis Drugs 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 210000000601 blood cell Anatomy 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 201000008275 breast carcinoma Diseases 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 2
- 239000013599 cloning vector Substances 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- 201000001981 dermatomyositis Diseases 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 206010013023 diphtheria Diseases 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 108010051081 dopachrome isomerase Proteins 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 201000002491 encephalomyelitis Diseases 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 229940007078 entamoeba histolytica Drugs 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 229960003276 erythromycin Drugs 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 244000000013 helminth Species 0.000 description 2
- 239000003228 hemolysin Substances 0.000 description 2
- 208000026095 hyper-IgM syndrome type 1 Diseases 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 101150106970 inlA gene Proteins 0.000 description 2
- 101150067296 inlJ gene Proteins 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- 229940096397 interleukin-8 Drugs 0.000 description 2
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 2
- 238000001361 intraarterial administration Methods 0.000 description 2
- 101150014059 ispD gene Proteins 0.000 description 2
- 101150022203 ispDF gene Proteins 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 206010025135 lupus erythematosus Diseases 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 201000004792 malaria Diseases 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 206010063344 microscopic polyangiitis Diseases 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 206010028417 myasthenia gravis Diseases 0.000 description 2
- 230000009826 neoplastic cell growth Effects 0.000 description 2
- 201000008383 nephritis Diseases 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 210000003668 pericyte Anatomy 0.000 description 2
- 230000002688 persistence Effects 0.000 description 2
- 210000000680 phagosome Anatomy 0.000 description 2
- 108090000102 pigment epithelium-derived factor Proteins 0.000 description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 description 2
- 208000005987 polymyositis Diseases 0.000 description 2
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 108010049718 pseudouridine synthases Proteins 0.000 description 2
- 230000002685 pulmonary effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- KIDHWZJUCRJVML-UHFFFAOYSA-N putrescine Chemical compound NCCCCN KIDHWZJUCRJVML-UHFFFAOYSA-N 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 206010039083 rhinitis Diseases 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 239000012723 sample buffer Substances 0.000 description 2
- 210000003786 sclera Anatomy 0.000 description 2
- 208000010157 sclerosing cholangitis Diseases 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical group NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 208000022218 streptococcal pneumonia Diseases 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 229960000814 tetanus toxoid Drugs 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- 208000016367 transient hypogammaglobulinemia of infancy Diseases 0.000 description 2
- 230000005945 translocation Effects 0.000 description 2
- 201000008297 typhoid fever Diseases 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- GMKMEZVLHJARHF-UHFFFAOYSA-N (2R,6R)-form-2.6-Diaminoheptanedioic acid Natural products OC(=O)C(N)CCCC(N)C(O)=O GMKMEZVLHJARHF-UHFFFAOYSA-N 0.000 description 1
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 description 1
- JVJGCCBAOOWGEO-RUTPOYCXSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-4-amino-2-[[(2s,3s)-2-[[(2s,3s)-2-[[(2s)-2-azaniumyl-3-hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-3-methylpentanoyl]amino]-4-oxobutanoyl]amino]-3-phenylpropanoyl]amino]-4-carboxylatobutanoyl]amino]-6-azaniumy Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 JVJGCCBAOOWGEO-RUTPOYCXSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- BJHCYTJNPVGSBZ-YXSASFKJSA-N 1-[4-[6-amino-5-[(Z)-methoxyiminomethyl]pyrimidin-4-yl]oxy-2-chlorophenyl]-3-ethylurea Chemical group CCNC(=O)Nc1ccc(Oc2ncnc(N)c2\C=N/OC)cc1Cl BJHCYTJNPVGSBZ-YXSASFKJSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- AXAVXPMQTGXXJZ-UHFFFAOYSA-N 2-aminoacetic acid;2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound NCC(O)=O.OCC(N)(CO)CO AXAVXPMQTGXXJZ-UHFFFAOYSA-N 0.000 description 1
- 108010030844 2-methylcitrate synthase Proteins 0.000 description 1
- 108010080376 3-Deoxy-7-Phosphoheptulonate Synthase Proteins 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108010075604 5-Methyltetrahydrofolate-Homocysteine S-Methyltransferase Proteins 0.000 description 1
- 102000011848 5-Methyltetrahydrofolate-Homocysteine S-Methyltransferase Human genes 0.000 description 1
- 102100025643 60S ribosomal protein L12 Human genes 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical group CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000009746 Adult T-Cell Leukemia-Lymphoma Diseases 0.000 description 1
- 208000016683 Adult T-cell leukemia/lymphoma Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102100039338 Aminomethyltransferase, mitochondrial Human genes 0.000 description 1
- 108050001492 Ammonium transporters Proteins 0.000 description 1
- 108091093088 Amplicon Proteins 0.000 description 1
- 108010048154 Angiopoietin-1 Proteins 0.000 description 1
- 102000009088 Angiopoietin-1 Human genes 0.000 description 1
- 102100033402 Angiopoietin-4 Human genes 0.000 description 1
- 102100025665 Angiopoietin-related protein 1 Human genes 0.000 description 1
- 108010009906 Angiopoietins Proteins 0.000 description 1
- 102000009840 Angiopoietins Human genes 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 108010037870 Anthranilate Synthase Proteins 0.000 description 1
- 241000712891 Arenavirus Species 0.000 description 1
- 241001167018 Aroa Species 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 208000036170 B-Cell Marginal Zone Lymphoma Diseases 0.000 description 1
- 108091007065 BIRCs Proteins 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 101100072559 Bacillus subtilis (strain 168) alsS gene Proteins 0.000 description 1
- 101100216993 Bacillus subtilis (strain 168) aroD gene Proteins 0.000 description 1
- 101100221537 Bacillus subtilis (strain 168) comK gene Proteins 0.000 description 1
- 101100394745 Bacillus subtilis (strain 168) hepT gene Proteins 0.000 description 1
- 241000193388 Bacillus thuringiensis Species 0.000 description 1
- 208000004926 Bacterial Vaginosis Diseases 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108030001720 Bontoxilysin Proteins 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 208000003508 Botulism Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 241000589562 Brucella Species 0.000 description 1
- 241000589567 Brucella abortus Species 0.000 description 1
- 206010006500 Brucellosis Diseases 0.000 description 1
- 241000722910 Burkholderia mallei Species 0.000 description 1
- 206010069747 Burkholderia mallei infection Diseases 0.000 description 1
- 241001136175 Burkholderia pseudomallei Species 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 108700012439 CA9 Proteins 0.000 description 1
- 101100268670 Caenorhabditis elegans acc-3 gene Proteins 0.000 description 1
- 101100275473 Caenorhabditis elegans ctc-3 gene Proteins 0.000 description 1
- 101100170173 Caenorhabditis elegans del-1 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 208000008889 California Encephalitis Diseases 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 101100339117 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) hisF1 gene Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 241000242722 Cestoda Species 0.000 description 1
- GHOKWGTUZJEAQD-UHFFFAOYSA-N Chick antidermatitis factor Natural products OCC(C)(C)C(O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-UHFFFAOYSA-N 0.000 description 1
- 241001502567 Chikungunya virus Species 0.000 description 1
- 241000606161 Chlamydia Species 0.000 description 1
- 101100227595 Chlamydia pneumoniae folKP gene Proteins 0.000 description 1
- 241001647378 Chlamydia psittaci Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 206010061764 Chromosomal deletion Diseases 0.000 description 1
- 108010071536 Citrate (Si)-synthase Proteins 0.000 description 1
- 102000006732 Citrate synthase Human genes 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 101100538459 Clostridium perfringens (strain 13 / Type A) truA1 gene Proteins 0.000 description 1
- 101100100749 Clostridium perfringens (strain 13 / Type A) truA2 gene Proteins 0.000 description 1
- 241000223205 Coccidioides immitis Species 0.000 description 1
- 241001522757 Coccidioides posadasii Species 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 1
- 108010062580 Concanavalin A Proteins 0.000 description 1
- 102000034534 Cotransporters Human genes 0.000 description 1
- 108020003264 Cotransporters Proteins 0.000 description 1
- 241000606678 Coxiella burnetii Species 0.000 description 1
- 241000150230 Crimean-Congo hemorrhagic fever orthonairovirus Species 0.000 description 1
- 241000223936 Cryptosporidium parvum Species 0.000 description 1
- 241000179197 Cyclospora Species 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 1
- 208000001490 Dengue Diseases 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 101100465553 Dictyostelium discoideum psmB6 gene Proteins 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- SNRUBQQJIBEYMU-UHFFFAOYSA-N Dodecane Natural products CCCCCCCCCCCC SNRUBQQJIBEYMU-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 101100491986 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) aromA gene Proteins 0.000 description 1
- 206010014584 Encephalitis california Diseases 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102400001047 Endostatin Human genes 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 101100507308 Enterococcus faecalis mvaS gene Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 108050004280 Epsilon toxin Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 101100155531 Escherichia coli (strain K12) ispU gene Proteins 0.000 description 1
- 101100139916 Escherichia coli (strain K12) rarA gene Proteins 0.000 description 1
- 101000867232 Escherichia coli Heat-stable enterotoxin II Proteins 0.000 description 1
- 206010061850 Extranodal marginal zone B-cell lymphoma (MALT type) Diseases 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 1
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 201000006353 Filariasis Diseases 0.000 description 1
- 241000711950 Filoviridae Species 0.000 description 1
- 108010014612 Follistatin Proteins 0.000 description 1
- 102000016970 Follistatin Human genes 0.000 description 1
- 108050000897 Formate/nitrite transporters Proteins 0.000 description 1
- 241000589602 Francisella tularensis Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 101150082479 GAL gene Proteins 0.000 description 1
- 108090000926 GMP synthase (glutamine-hydrolyzing) Proteins 0.000 description 1
- 102100033452 GMP synthase [glutamine-hydrolyzing] Human genes 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 241000224467 Giardia intestinalis Species 0.000 description 1
- 201000003641 Glanders Diseases 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 101100175482 Glycine max CG-3 gene Proteins 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 206010018693 Granuloma inguinale Diseases 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 241000190708 Guanarito mammarenavirus Species 0.000 description 1
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 1
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 1
- 206010061192 Haemorrhagic fever Diseases 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 108010034145 Helminth Proteins Proteins 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 102000004989 Hepsin Human genes 0.000 description 1
- 108090001101 Hepsin Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 208000017605 Hodgkin disease nodular sclerosis Diseases 0.000 description 1
- 101000804764 Homo sapiens Lymphotactin Proteins 0.000 description 1
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 1
- 101000622137 Homo sapiens P-selectin Proteins 0.000 description 1
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 1
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 101000617727 Homo sapiens Pregnancy-specific beta-1-glycoprotein 4 Proteins 0.000 description 1
- 101000659995 Homo sapiens Ribosomal L1 domain-containing protein 1 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701828 Human papillomavirus type 11 Species 0.000 description 1
- 241000341655 Human papillomavirus type 16 Species 0.000 description 1
- 101100156155 Human papillomavirus type 16 E7 gene Proteins 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 108010002231 IgA-specific serine endopeptidase Proteins 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 108010063678 Indole-3-Glycerol-Phosphate Synthase Proteins 0.000 description 1
- 102100040061 Indoleamine 2,3-dioxygenase 1 Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000055031 Inhibitor of Apoptosis Proteins Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 102000004559 Interleukin-13 Receptors Human genes 0.000 description 1
- 108010017511 Interleukin-13 Receptors Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 241000712890 Junin mammarenavirus Species 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 229930182821 L-proline Natural products 0.000 description 1
- 201000009908 La Crosse encephalitis Diseases 0.000 description 1
- 101000743006 Lactococcus lactis subsp. cremoris UPF0177 protein in abiGi 5'region Proteins 0.000 description 1
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 1
- 208000006404 Large Granular Lymphocytic Leukemia Diseases 0.000 description 1
- 206010023927 Lassa fever Diseases 0.000 description 1
- 101100509110 Leifsonia xyli subsp. xyli (strain CTCB07) ispDF gene Proteins 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 101000839464 Leishmania braziliensis Heat shock 70 kDa protein Proteins 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 102000016267 Leptin Human genes 0.000 description 1
- 108010092277 Leptin Proteins 0.000 description 1
- 108700027766 Listeria monocytogenes hlyA Proteins 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- 102100035304 Lymphotactin Human genes 0.000 description 1
- 201000003791 MALT lymphoma Diseases 0.000 description 1
- 241000712898 Machupo mammarenavirus Species 0.000 description 1
- 108091006978 Magnesium transporters Proteins 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 239000005913 Maltodextrin Substances 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical group [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 101100261636 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) trpB2 gene Proteins 0.000 description 1
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 1
- 241000243190 Microsporidia Species 0.000 description 1
- 102100030335 Midkine Human genes 0.000 description 1
- 108010092801 Midkine Proteins 0.000 description 1
- ZOKXTWBITQBERF-UHFFFAOYSA-N Molybdenum Chemical group [Mo] ZOKXTWBITQBERF-UHFFFAOYSA-N 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101000707232 Mus musculus SH2 domain-containing protein 2A Proteins 0.000 description 1
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 101100063392 Mycobacterium leprae (strain TN) folP1 gene Proteins 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 208000034179 Neoplasms, Glandular and Epithelial Diseases 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 102000003797 Neuropeptides Human genes 0.000 description 1
- 108090000189 Neuropeptides Proteins 0.000 description 1
- 101100491597 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) arg-6 gene Proteins 0.000 description 1
- 241000526636 Nipah henipavirus Species 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 108010075205 OVA-8 Proteins 0.000 description 1
- 241000713112 Orthobunyavirus Species 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 102100023472 P-selectin Human genes 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 101100338762 Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) hepB gene Proteins 0.000 description 1
- 101800005149 Peptide B Proteins 0.000 description 1
- 208000027190 Peripheral T-cell lymphomas Diseases 0.000 description 1
- 102000016462 Phosphate Transport Proteins Human genes 0.000 description 1
- 108010092528 Phosphate Transport Proteins Proteins 0.000 description 1
- 108010064785 Phospholipases Proteins 0.000 description 1
- 102000015439 Phospholipases Human genes 0.000 description 1
- 102100027330 Phosphoribosylaminoimidazole carboxylase Human genes 0.000 description 1
- 108090000434 Phosphoribosylaminoimidazolesuccinocarboxamide synthases Proteins 0.000 description 1
- 102100036473 Phosphoribosylformylglycinamidine synthase Human genes 0.000 description 1
- 108030004873 Phosphoribosylformylglycinamidine synthases Proteins 0.000 description 1
- 101001135788 Pinus taeda (+)-alpha-pinene synthase, chloroplastic Proteins 0.000 description 1
- 102100035194 Placenta growth factor Human genes 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 1
- 108010001014 Plasminogen Activators Proteins 0.000 description 1
- 102000001938 Plasminogen Activators Human genes 0.000 description 1
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 1
- 241000224016 Plasmodium Species 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 241000223821 Plasmodium malariae Species 0.000 description 1
- 241000223810 Plasmodium vivax Species 0.000 description 1
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 description 1
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 1
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 241000233872 Pneumocystis carinii Species 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 102100022021 Pregnancy-specific beta-1-glycoprotein 4 Human genes 0.000 description 1
- 108091000054 Prion Proteins 0.000 description 1
- 102000029797 Prion Human genes 0.000 description 1
- 102100037632 Progranulin Human genes 0.000 description 1
- 108010012809 Progranulins Proteins 0.000 description 1
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 1
- 108050003267 Prostaglandin G/H synthase 2 Proteins 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 101710194807 Protective antigen Proteins 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 108050008901 Proton-dependent oligopeptide transporter Proteins 0.000 description 1
- 102000000348 Proton-dependent oligopeptide transporter Human genes 0.000 description 1
- 101100408135 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) phnA gene Proteins 0.000 description 1
- 206010037151 Psittacosis Diseases 0.000 description 1
- 239000005700 Putrescine Substances 0.000 description 1
- 101100169519 Pyrococcus abyssi (strain GE5 / Orsay) dapAL gene Proteins 0.000 description 1
- 206010037688 Q fever Diseases 0.000 description 1
- 108020004518 RNA Probes Proteins 0.000 description 1
- 239000003391 RNA probe Substances 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101000737809 Rattus norvegicus Cadherin-related family member 5 Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 240000000528 Ricinus communis Species 0.000 description 1
- 241000606697 Rickettsia prowazekii Species 0.000 description 1
- 241000606651 Rickettsiales Species 0.000 description 1
- 208000000705 Rift Valley Fever Diseases 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 101150006301 SECA2 gene Proteins 0.000 description 1
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 1
- 208000001203 Smallpox Diseases 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241001219481 Spongospora subterranea Species 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 244000057717 Streptococcus lactis Species 0.000 description 1
- 235000014897 Streptococcus lactis Nutrition 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 101100126492 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) ispG1 gene Proteins 0.000 description 1
- 241000187392 Streptomyces griseus Species 0.000 description 1
- 102400000096 Substance P Human genes 0.000 description 1
- 101800003906 Substance P Proteins 0.000 description 1
- 108050004141 Sugar phosphate transporters Proteins 0.000 description 1
- 102000015898 Sugar phosphate transporters Human genes 0.000 description 1
- 102000018509 Sulfate Transporters Human genes 0.000 description 1
- 108010091582 Sulfate Transporters Proteins 0.000 description 1
- 208000031672 T-Cell Peripheral Lymphoma Diseases 0.000 description 1
- 201000008717 T-cell large granular lymphocyte leukemia Diseases 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 108091005735 TGF-beta receptors Proteins 0.000 description 1
- 102100036494 Testisin Human genes 0.000 description 1
- 108050003829 Testisin Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 1
- 241000242541 Trematoda Species 0.000 description 1
- 241000869417 Trematodes Species 0.000 description 1
- 241000589884 Treponema pallidum Species 0.000 description 1
- 206010044608 Trichiniasis Diseases 0.000 description 1
- 241000224527 Trichomonas vaginalis Species 0.000 description 1
- 241001489151 Trichuris Species 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 108020000963 Uroporphyrinogen-III synthase Proteins 0.000 description 1
- 102000008790 VE-cadherin Human genes 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 208000037009 Vaginitis bacterial Diseases 0.000 description 1
- 102000016548 Vascular Endothelial Growth Factor Receptor-1 Human genes 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 208000028227 Viral hemorrhagic fever Diseases 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- 101100055397 Wigglesworthia glossinidia brevipalpis alr gene Proteins 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical group [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 108091006550 Zinc transporters Proteins 0.000 description 1
- VRGWBRLULZUWAJ-XFFXIZSCSA-N [(2s)-2-[(1r,3z,5s,8z,12z,15s)-5,17-dihydroxy-4,8,12,15-tetramethyl-16-oxo-18-bicyclo[13.3.0]octadeca-3,8,12,17-tetraenyl]propyl] acetate Chemical compound C1\C=C(C)/CC\C=C(C)/CC[C@H](O)\C(C)=C/C[C@@H]2C([C@@H](COC(C)=O)C)=C(O)C(=O)[C@]21C VRGWBRLULZUWAJ-XFFXIZSCSA-N 0.000 description 1
- SWPYNTWPIAZGLT-UHFFFAOYSA-N [amino(ethoxy)phosphanyl]oxyethane Chemical compound CCOP(N)OCC SWPYNTWPIAZGLT-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 210000002534 adenoid Anatomy 0.000 description 1
- 230000000240 adjuvant effect Effects 0.000 description 1
- 201000006966 adult T-cell leukemia Diseases 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 108090000637 alpha-Amylases Proteins 0.000 description 1
- 102000004139 alpha-Amylases Human genes 0.000 description 1
- 229940024171 alpha-amylase Drugs 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 101150118463 argG gene Proteins 0.000 description 1
- 101150037081 aroA gene Proteins 0.000 description 1
- 101150090235 aroB gene Proteins 0.000 description 1
- 101150042732 aroC gene Proteins 0.000 description 1
- 101150102858 aroD gene Proteins 0.000 description 1
- 101150040872 aroE gene Proteins 0.000 description 1
- 101150108612 aroQ gene Proteins 0.000 description 1
- 101150057409 asnB gene Proteins 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 101150099905 atpA2 gene Proteins 0.000 description 1
- 101150090348 atpC gene Proteins 0.000 description 1
- 101150099875 atpE gene Proteins 0.000 description 1
- 101150103189 atpG gene Proteins 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 229940053031 botulinum toxin Drugs 0.000 description 1
- KQNZDYYTLMIZCT-KQPMLPITSA-N brefeldin A Chemical compound O[C@@H]1\C=C\C(=O)O[C@@H](C)CCC\C=C\[C@@H]2C[C@H](O)C[C@H]21 KQNZDYYTLMIZCT-KQPMLPITSA-N 0.000 description 1
- JUMGSHROWPPKFX-UHFFFAOYSA-N brefeldin-A Natural products CC1CCCC=CC2(C)CC(O)CC2(C)C(O)C=CC(=O)O1 JUMGSHROWPPKFX-UHFFFAOYSA-N 0.000 description 1
- 229940056450 brucella abortus Drugs 0.000 description 1
- 101150057791 bsh gene Proteins 0.000 description 1
- 229940074375 burkholderia mallei Drugs 0.000 description 1
- 108010018828 cadherin 5 Proteins 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 101150055766 cat gene Proteins 0.000 description 1
- 101150038972 cbiD gene Proteins 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 108091092356 cellular DNA Proteins 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 108091006116 chimeric peptides Proteins 0.000 description 1
- 229940038705 chlamydia trachomatis Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 201000010902 chronic myelomonocytic leukemia Diseases 0.000 description 1
- 239000011436 cob Substances 0.000 description 1
- 101150103647 cobQ gene Proteins 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical group [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 238000007821 culture assay Methods 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 101150049467 dadX gene Proteins 0.000 description 1
- 101150011371 dapA gene Proteins 0.000 description 1
- 208000025729 dengue disease Diseases 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 150000001982 diacylglycerols Chemical class 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 230000002416 diarrheagenic effect Effects 0.000 description 1
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 1
- ZPTBLXKRQACLCR-XVFCMESISA-N dihydrouridine Chemical group O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)CC1 ZPTBLXKRQACLCR-XVFCMESISA-N 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000000688 enterotoxigenic effect Effects 0.000 description 1
- 108060002566 ephrin Proteins 0.000 description 1
- 102000012803 ephrin Human genes 0.000 description 1
- 208000010932 epithelial neoplasm Diseases 0.000 description 1
- 108700020302 erbB-2 Genes Proteins 0.000 description 1
- 101150026389 fabF gene Proteins 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 101150045875 folP gene Proteins 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 244000078673 foodborn pathogen Species 0.000 description 1
- 231100000221 frame shift mutation induction Toxicity 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 229940118764 francisella tularensis Drugs 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 244000053095 fungal pathogen Species 0.000 description 1
- VRGWBRLULZUWAJ-UHFFFAOYSA-N fusaproliferin Natural products C1C=C(C)CCC=C(C)CCC(O)C(C)=CCC2C(C(COC(C)=O)C)=C(O)C(=O)C21C VRGWBRLULZUWAJ-UHFFFAOYSA-N 0.000 description 1
- 108700004026 gag Genes Proteins 0.000 description 1
- 101150098622 gag gene Proteins 0.000 description 1
- 201000006585 gastric adenocarcinoma Diseases 0.000 description 1
- 238000012224 gene deletion Methods 0.000 description 1
- 238000003633 gene expression assay Methods 0.000 description 1
- 238000012637 gene transfection Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 229940085435 giardia lamblia Drugs 0.000 description 1
- 201000006592 giardiasis Diseases 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 101150041871 gltB gene Proteins 0.000 description 1
- 101150039906 gltD gene Proteins 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- KWIUHFFTVRNATP-UHFFFAOYSA-N glycine betaine Chemical group C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000005090 green fluorescent protein Substances 0.000 description 1
- 230000009643 growth defect Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 208000035392 hereditary 6 prostate cancer Diseases 0.000 description 1
- 208000032154 hereditary 8 prostate cancer Diseases 0.000 description 1
- 101150096813 hisF gene Proteins 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000008696 hypoxemic pulmonary vasoconstriction Effects 0.000 description 1
- 101150033780 ilvB gene Proteins 0.000 description 1
- 101150077793 ilvH gene Proteins 0.000 description 1
- 101150060643 ilvN gene Proteins 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000003832 immune regulation Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 238000010324 immunological assay Methods 0.000 description 1
- 208000025095 immunoproliferative disease Diseases 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 208000037801 influenza A (H1N1) Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000035990 intercellular signaling Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 150000002506 iron compounds Chemical group 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 108020001983 isochorismate synthase Proteins 0.000 description 1
- 101150018742 ispF gene Proteins 0.000 description 1
- 101150081094 ispG gene Proteins 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 1
- 229940039781 leptin Drugs 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 231100000636 lethal dose Toxicity 0.000 description 1
- 101150087199 leuA gene Proteins 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 230000000998 lymphohematopoietic effect Effects 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 102000042200 major facilitator family Human genes 0.000 description 1
- 108091077527 major facilitator family Proteins 0.000 description 1
- 208000006178 malignant mesothelioma Diseases 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 229940035034 maltodextrin Drugs 0.000 description 1
- 125000003071 maltose group Chemical group 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 208000020968 mature T-cell and NK-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- GMKMEZVLHJARHF-SYDPRGILSA-N meso-2,6-diaminopimelic acid Chemical compound [O-]C(=O)[C@@H]([NH3+])CCC[C@@H]([NH3+])C([O-])=O GMKMEZVLHJARHF-SYDPRGILSA-N 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- CWWARWOPSKGELM-SARDKLJWSA-N methyl (2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s)-5-amino-2-[[(2s)-5-amino-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-1-[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-5 Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)OC)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CCCN=C(N)N)C1=CC=CC=C1 CWWARWOPSKGELM-SARDKLJWSA-N 0.000 description 1
- 229960003085 meticillin Drugs 0.000 description 1
- 101150083023 mgsA gene Proteins 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229910052750 molybdenum Inorganic materials 0.000 description 1
- 239000011733 molybdenum Substances 0.000 description 1
- 101150047269 murI gene Proteins 0.000 description 1
- 231100000707 mutagenic chemical Toxicity 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 229940022007 naked DNA vaccine Drugs 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 231100001222 nononcogenic Toxicity 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 102000022744 oligopeptide binding proteins Human genes 0.000 description 1
- 108091013547 oligopeptide binding proteins Proteins 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 229940127241 oral polio vaccine Drugs 0.000 description 1
- 201000002740 oral squamous cell carcinoma Diseases 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 201000000901 ornithosis Diseases 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 101150013947 pabB gene Proteins 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 229940055726 pantothenic acid Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000000149 penetrating effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 108010082406 peptide permease Proteins 0.000 description 1
- 210000003200 peritoneal cavity Anatomy 0.000 description 1
- 230000008823 permeabilization Effects 0.000 description 1
- 210000001986 peyer's patch Anatomy 0.000 description 1
- 101150053431 phaZ gene Proteins 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 101150028857 phoP gene Proteins 0.000 description 1
- 108010073128 phosphatidylcholine-specific phospholipase C Proteins 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000004260 plant-type cell wall biogenesis Effects 0.000 description 1
- 229940127126 plasminogen activator Drugs 0.000 description 1
- 229940118768 plasmodium malariae Drugs 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 101150076253 plbC gene Proteins 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- 229930185346 proliferin Natural products 0.000 description 1
- 229960002429 proline Drugs 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 201000001514 prostate carcinoma Diseases 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 101150054232 pyrG gene Proteins 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 101150079601 recA gene Proteins 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000028617 response to DNA damage stimulus Effects 0.000 description 1
- 229940046939 rickettsia prowazekii Drugs 0.000 description 1
- 101150095594 rluB gene Proteins 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 239000012898 sample dilution Substances 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 201000004409 schistosomiasis Diseases 0.000 description 1
- 230000001932 seasonal effect Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229940063673 spermidine Drugs 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 201000010740 swine influenza Diseases 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 101150000850 thrC gene Proteins 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 241001147422 tick-borne encephalitis virus group Species 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 208000003982 trichinellosis Diseases 0.000 description 1
- 201000007588 trichinosis Diseases 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 101150019416 trpA gene Proteins 0.000 description 1
- 101150081616 trpB gene Proteins 0.000 description 1
- 101150111232 trpB-1 gene Proteins 0.000 description 1
- 101150044170 trpE gene Proteins 0.000 description 1
- 101150017621 truA gene Proteins 0.000 description 1
- 201000002311 trypanosomiasis Diseases 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- 206010061393 typhus Diseases 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 101150103517 uppS gene Proteins 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 108010063664 uroporphyrin-III C-methyltransferase Proteins 0.000 description 1
- 102000003643 uroporphyrinogen-III synthase Human genes 0.000 description 1
- 201000006266 variola major Diseases 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 239000000304 virulence factor Substances 0.000 description 1
- 230000007923 virulence factor Effects 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 108010062110 water dikinase pyruvate Proteins 0.000 description 1
- 244000000028 waterborne pathogen Species 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 229940098232 yersinia enterocolitica Drugs 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 108010088577 zinc-binding protein Proteins 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/90—Isomerases (5.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/52—Bacterial cells; Fungal cells; Protozoal cells
- A61K2039/522—Bacterial cells; Fungal cells; Protozoal cells avirulent or attenuated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/52—Bacterial cells; Fungal cells; Protozoal cells
- A61K2039/523—Bacterial cells; Fungal cells; Protozoal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/036—Fusion polypeptide containing a localisation/targetting motif targeting to the medium outside of the cell, e.g. type III secretion
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20071—Demonstrated in vivo effect
Definitions
- compositions including Listeria delivery vectors comprising minigene expression constructs, and methods of using the same for inducing an immune response against an antigen-expressing tumor or cancer and for treating the same, and vaccinating against the same in subjects bearing the tumors or cancer.
- Listeria monocytogenes is an intracellular pathogen that primarily infects antigen presenting cells and has adapted for life in the cytoplasm of these cells.
- Host cells such as macrophages, actively phagocytose L. monocytogenes and the majority of the bacteria are degraded in the phagolysosome.
- Some of the bacteria escape into the host cytosol by perforating the phagosomal membrane through the action of a hemolysin, listeriolysin O (LLO).
- LLO listeriolysin O
- L. monocytogenes can polymerize the host actin and pass directly from cell to cell further evading the host immune system and resulting in a negligible antibody response to L. monocytogenes.
- Recombinant protein expression from Listeria has involved introducing DNA sequences encoding full-length proteins or large polypeptides containing the antigenic sequence(s) of interest, but this has not been possible in instances where the expression of multiple peptide determinants from heterologous sources was desired.
- the peptides have been expressed as a single polypeptide construct containing the peptides of interest separated by amino acid linkers of varying lengths and these have required proteasomal activity for the production of MHC class I binding peptide determinants. This may lead to loss of antigen presentation.
- a minigene system of the disclosure provides the advantage that it allows multiple peptides to be loaded into cells using a single Listeria delivery vector.
- the present disclosure provides a recombinant Listeria strain comprising a minigene nucleic acid construct, said construct comprising an open reading frame encoding a chimeric protein, wherein said chimeric protein comprises s:
- said signal sequence, said ubiquitin and said peptide in a.-c. are respectively arranged in tandem from the amino-terminus to the carboxy-terminus.
- the present disclosure provides for a method of eliciting an anti-tumor or anti-cancer response in a subject having a tumor or cancer, said method comprising the step of administering to said subject a recombinant Listeria comprising a minigene nucleic acid construct, said construct comprising an open reading frame encoding a chimeric protein, wherein said chimeric protein comprises:
- said signal sequence, said ubiquitin and said peptide in a.-c. are respectively arranged in tandem from the amino-terminus to the carboxy-terminus, thereby enhancing an anti-tumor response in said subject.
- the disclosure provides a method of treating a tumor or cancer in a subject, said method comprising the step of administering to said subject a recombinant Listeria comprising a minigene nucleic acid construct, said construct comprising an open reading frame encoding a chimeric protein, wherein said chimeric protein comprises:
- said signal sequence, said ubiquitin and said peptide in a.-c. are respectively arranged in tandem from the amino-terminus to the carboxy-terminus, thereby enhancing an anti-tumor response in said subject.
- FIGS 1A-B show that Lm-E7 and Lm-LLO-E7 use different expression systems to express and secrete E7.
- Lm-E7 was generated by introducing a gene cassette into the orfZ domain of the L. monocytogenes genome ( Figure 1A). The hly promoter drives expression of the hly signal sequence and the first five amino acids (AA) of LLO followed by HPV-16 E7 ( Figure IB).
- Lm- LLO-E7 was generated by transforming the prfA- strain XFL-7 with the plasmid pGG-55.
- pGG-55 has the hly promoter driving expression of a non-hemolytic fusion of LLO-E7.
- pGG-55 also contains the prfA gene to select for retention of the plasmid by XFL-7 in vivo.
- FIG. 2 shows that Lm-E7 and Lm-LLO-E7 secrete E7.
- Lm-Gag (lane 1), Lm-E7 (lane 2), Lm-LLO-NP (lane 3), Lm-LLO-E7 (lane 4), XFL-7 (lane 5), and 10403S (lane 6) were grown overnight at 37°C in Luria-Bertoni broth. Equivalent numbers of bacteria, as determined by OD at 600 nm absorbance, were pelleted and 18 ml of each supernatant was TCA precipitated. E7 expression was analyzed by Western blot. The blot was probed with an anti-E7 rnAb, followed by HRP-conjugated anti-mouse (Amersham), and then developed using ECL detection reagents.
- FIG. 3 shows that tumor immunotherapeutic efficacy of LLO-E7 fusions. Tumor size in millimeters in mice is shown at 7, 14, 21, 28 and 56 days post tumor-inoculation. Naive mice: open- circles; Lm-LLO-E7: filled circles; Lm-E7: squares; Lm-Gag: open diamonds; and Lm-LLO-NP: filled triangles.
- FIG. 4 shows that splenocytes from Lm-LLO-E7-immunized mice proliferate when exposed to TC-1 cells.
- C57BL/6 mice were immunized and boosted with Lm-LLO-E7, Lm-E7, or control rLm strains.
- Splenocytes were harvested 6 days after the boost and plated with irradiated TC- 1 cells at the ratios shown. The cells were pulsed with H thymidine and harvested. Cpm is defined as (experimental cpm) - (no-TC-1 control).
- Figure 5A shows (A) Western blot demonstrating that Lm-ActA-E7 secretes E7.
- Figure 5B shows Tumor size in mice administered Lm-ActA-E7 (rectangles), Lm-E7 (ovals), Lm-LLO-E7 (X), and naive mice (non-vaccinated; solid triangles).
- FIG. 6A shows schematic representation of the plasmid inserts used to create 4 LM vaccines.
- Lm-LLO-E7 insert contains all of the Listeria genes used. It contains the hly promoter, the first 1.3 kb of the hly gene (which encodes the protein LLO), and the HPV-16 E7 gene. The first 1.3 kb of hly includes the signal sequence (ss) and the PEST region.
- Lm-PEST-E7 includes the hly promoter, the signal sequence, and PEST and E7 sequences but excludes the remainder of the truncated LLO gene.
- Lm-APEST-E7 excludes the PEST region, but contains the hly promoter, the signal sequence, E7, and the remainder of the truncated LLO.
- Lm-E7epi has only the hly promoter, the signal sequence, and E7.
- Figure 6B Top panel: Listeria constructs containing PEST regions induce tumor regression.
- Bottom panel Average tumor sizes at day 28 post-tumor challenge in 2 separate experiments.
- Figure 6C shows Listeria constructs containing PEST regions induce a higher percentage of
- Figure 7 A shows Induction of E7-specific IFN-gamma-secreting CD8 + T cells in the spleens and the numbers penetrating the tumors, in mice administered TC-1 tumor cells and subsequently administered Lm-E7, Lm-LLO-E7, Lm-ActA-E7, or no vaccine (naive).
- Figure 7B shows induction and penetration of E7 specific CD8 + cells in the spleens and tumors of the mice described for (A).
- Figures 8A-B show Listeria constructs containing PEST regions induce a higher percentage of E7-specific lymphocytes within the tumor.
- Figure 8A representative data from 1 experiment.
- Figure 8B average and SE of data from all 3 experiments.
- FIG. 9A shows a schematic map of E. coli-Listeria shuttle plasmid pGG55.
- CAT(-) E. coli chloramphenicol transferase
- CAT(+) Listeria chloramphenicol transferase
- Ori Lm replication origin for Listeria
- Ori Ec pl5 origin of replication for E. coli
- prfA Listeria pathogenicity regulating factor A
- LLO C-terminally truncated listeriolysin O, including its promoter
- E7 HPV E7. Selected restriction sites are also depicted.
- FIG. 9B shows a schematic map of E. coli-Listeria shuttle plasmid pTV3 (below).
- CAT(-) E. coli chloramphenicol transferase
- CAT(+) Listeria chloramphenicol transferase
- Ori Lm replication origin for Listeria
- Ori Ec pl5 origin of replication for E. coli
- prfA Listeria pathogenicity regulating factor A
- LLO C-terminally truncated listeriolysin O, including its promoter
- E7 HPV E7
- p60-dal expression cassette of p60 promoter and Listeria dal gene. Selected restriction sites are also depicted.
- Figure 10 shows the DNA sequence (SEQ ID NO: 74) present upstream and downstream of the inlC region on the genome of Listeria strain EGD. DNA-up (red), inlC gene (blue) and DNA- down (black).
- Figure 11 shows the sequence of DNA (SEQ ID NO: 75) that is cloned in the temperature sensitive plasmid, pKSV7 to create inl C deletion mutant.
- the restriction enzyme sites used for cloning of these regions are indicated in caps and underlined.
- the EcoRI-PstI insert is cloned in the vector, pKSV7.
- Figure 12 shows a Schematic representation of the Lm-dd and Lm-dd actA strains.
- the gel showing the size of PCR products using oligo's 1/2 and oligo's 3/4 obtained using e chromosomal DNA of the strains, Lm-dd and Lm-ddAactA as template.
- Figure 13 shows the DNA sequence (SEQ ID NO: 57) present upstream and downstream of the actA gene in the Listeria chromosome.
- the region in italics contains the residual actA sequence element that is present in the LmddAactA strain.
- the underlined sequence gtcgac represent the restriction site of Xhol, which is the junction between the N-T and C-T region of actA.
- Figure 14 depicts tumor regression in response to administration of LM vaccine strains (A). Circles represent naive mice, inverted triangles represent mice administered Lmdd-TV3, and crosses represent mice administered Lm-LLOE7.
- Figures 15A-B show ( Figure 15A) Plasmid map of pAdvl64, which harbors bacillus subtilis dal gene under the control of constitutive Listeria p60 promoter for complementation of the chromosomal dal-dat deletion in LmddA strain. It also contains the fusion of truncated LLO (1-441) to the chimeric human Her2/neu gene, which was constructed by the direct fusion of 3 fragments the Her2/neu: ECl (aa 40-170), EC2 (aa 359-518) and ICI (aa 679-808).
- Figures 16A-C Cytotoxic T cell responses elicited by Her2/neu Listeria- based vaccines in splenocytes from immunized mice were tested using NT-2 cells as stimulators and 3T3/neu cells as targets. Lm-control was based on the LmddA background that was identical in all ways but expressed an irrelevant antigen (HPV16-E7).
- Figure 16B IFN- ⁇ secreted by the splenocytes from immunized FVB/N mice into the cell culture medium, measured by ELISA, after 24 hours of in vitro stimulation with mitomycin C treated NT-2 cells.
- FIG. 16C IFN- ⁇ secretion by splenocytes from HLA-A2 transgenic mice immunized with the chimeric vaccine, in response to in vitro incubation with peptides from different regions of the protein.
- a recombinant ChHer2 protein was used as positive control and an irrelevant peptide or no peptide groups constituted the negative controls as listed in the figure legend.
- IFN- ⁇ secretion was detected by an ELISA assay using cell culture supernatants harvested after 72 hours of co-incubation. Each data point was an average of triplicate data +/- standard error. * P value ⁇ 0.001.
- FIG. 18 shows FVB/N mice were inoculated s.c. with 1 x 10 6 NT-2 cells and immunized three times with each vaccine at one week intervals. Spleens were harvested 7 days after the second immunization. After isolation of the immune cells, they were stained for detection of Tregs by anti CD3, CD4, CD25 and FoxP3 antibodies, dot-plots of the Tregs from a representative experiment showing the frequency of CD25 + /FoxP3 + T cells, expressed as percentages of the total CD3 + or CD3 + CD4 + T cells across the different treatment groups.
- Figures 19A-B show FVB/N mice were inoculated s.c. with 1 x 10 6 NT-2 cells and immunized three times with each vaccine at one week intervals. Tumors were harvested 7 days after the second immunization. After isolation of the immune cells, they were stained for detection of Tregs by anti CD3, CD4, CD25 and FoxP3 antibodies.
- Figure 19A dot-plots of the Tregs from a representative experiment.
- Figure 19B Frequency of CD25 + /FoxP3 + T cells, expressed as percentages of the total CD3 + or CD3 + CD4 + T cells (left panel) and intratumoral CD8/Tregs ratio (right panel) across the different treatment groups. Data is shown as mean+SEM obtained from 2 independent experiments.
- Figures 20A-C represent a schematic map of a recombinant Listeria protein minigene construct.
- Figure 20A represents a construct producing the ovalbumin derived SIINFEKL peptide.
- Figure 20B represents a comparable recombinant protein in which a GBM derived peptide has been introduced in place of SIINFEKL by PCR cloning.
- Figure 20C represents a construct designed to express 4 separate peptide antigens from a strain of Listeria.
- compositions and methods for eliciting an antitumor or anti-cancer response are disclosed herein.
- the present disclosure provides a recombinant Listeria strain comprising a minigene nucleic acid construct comprising an open reading frame encoding a chimeric protein, wherein said chimeric protein comprises:
- said signal sequence, said ubiquitin and said peptide in a.-c. are respectively arranged in tandem from the amino-terminus to the carboxy-terminus.
- the Listeria further comprises two or more open reading frames linked by a Shine-Dalgarno ribosome binding site nucleic acid sequence.
- the recombinant Listeria further comprises one to four open reading frames linked by a Shine-Dalgarno ribosome binding site nucleic acid sequence between each open reading frame.
- each open reading frame comprises a different peptide.
- the present disclosure provides for a method of eliciting an anti-tumor or anti-cancer response in a subject having a tumor or cancer, said method comprising the step of administering to said subject a recombinant Listeria comprising a minigene nucleic acid construct comprising an open reading frame encoding a chimeric protein, wherein said chimeric protein comprises:
- ubiquitin (Ub) protein b. a ubiquitin (Ub) protein
- c a peptide
- said signal sequence, said ubiquitin and said peptide in a.-c. are respectively arranged in tandem from the amino-terminus to the carboxy-terminus, thereby enhancing an anti-tumor response in said subject.
- the disclosure provides a method of treating a tumor or cancer in a subject, said method comprising the step of administering to said subject a recombinant Listeria comprising a minigene nucleic acid construct comprising an open reading frame encoding a chimeric protein, wherein said chimeric protein comprises:
- said signal sequence, said ubiquitin and said peptide in a.-c. are respectively arranged in tandem from the amino-terminus to the carboxy-terminus, thereby enhancing an anti-tumor response in said subject.
- nucleic acid molecule molecule
- nucleic acid construct molecule
- minigene nucleic acid construct molecule
- nucleic acid and grammatical equivalents thereof may refer to a molecule, which may include, but is not limited to, prokaryotic sequences, eukaryotic mRNA, cDNA from eukaryotic mRNA, genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and even synthetic DNA sequences.
- the term also refers to sequences that include any of the known base analogs of DNA and RNA.
- fusion peptides generated using the methods disclosed herein are further linked to a HIS tag or a SIINFECKL tag.
- These tags may be expressed and the antigenic epitopes presented allowing a clinician to follow the immunogenicity of the secreted peptide by following immune responses to these "tag" sequence peptides. Such immune response can be monitored using a number of reagents including but not limited to, monoclonal antibodies and DNA or RNA probes specific for these tags. It will be appreciated by a skilled artisan that the sequences for the tags may be incorporated into the nucleic acid sequences encoding the fusion peptide sequences.
- vectors disclosed herein such as plasmid or phage vectors comprise the nucleic acid sequences encoding the fusion peptides or chimeric proteins disclosed herein.
- compositions and methods for inducing an immune response against a tumor antigen In another embodiment, the tumor antigen is a heterologous antigen. In another embodiment, the tumor antigen is a self-antigen. In another embodiment, disclosed herein are compositions and methods for inducing an immune response against an infectious disease antigen. In another embodiment, the infectious disease antigen is a heterologous antigen. In another embodiment, the compositions and methods of this disclosure are used for vaccinating against a tumor or a cancer.
- compositions and methods of the present disclosure prevent the occurrence of escape mutations following treatment.
- compositions and methods for providing progression free survival to a subject suffering from a tumor or cancer are compositions and methods for immunizing a subject against a cancer or tumor.
- compositions and methods for immunizing a subject against a cancer or tumor are compositions and methods for immunizing a subject against a cancer or tumor.
- the cancer is metastasis.
- a recombinant attenuated Listeria strain comprising a nucleic acid construct encoding a chimeric protein.
- the nucleic acid construct is a recombinant nucleic acid construct.
- a recombinant attenuated Listeria strain comprising a recombinant nucleic acid construct comprising an open reading frame encoding a bacterial secretion signal sequence (SS), a ubiquitin (Ub) protein, and a peptide sequence.
- the nucleic acid construct encodes a chimeric protein comprising a bacterial secretion signal sequence, a ubiquitin protein, and a peptide sequence.
- the chimeric protein is arranged in the following manner (SS-Ub-Peptide):
- the nucleic acid construct comprises a codon that corresponds to the carboxy-terminus of the peptide moiety is followed by two stop codons to ensure termination of protein synthesis.
- nucleic acids encoding the recombinant polypeptides disclosed herein also comprise a signal peptide or sequence.
- the bacterial secretion signal sequence encoded by the nucleic acid constructs disclosed herein is a Listeria secretion signal sequence.
- the fusion protein of methods and compositions of the present disclosure comprises an LLO signal sequence from Listeriolyson O (LLO).
- LLO Listeriolyson O
- a heterologous antigen may be expressed through the use of a signal sequence, such as a Listeria! signal sequence, for example, the hemolysin (hly) signal sequence or the actA signal sequence.
- foreign genes can be expressed downstream from a L.
- the signal peptide is bacterial (Listerial or non-Listerial). In one embodiment, the signal peptide is native to the bacterium. In another embodiment, the signal peptide is foreign to the bacterium. In another embodiment, the signal peptide is a signal peptide from Listeria monocytogenes, such as a secAl signal peptide. In another embodiment, the signal peptide is an Usp45 signal peptide from Lactococcus lactis, or a Protective Antigen signal peptide from Bacillus anthracis.
- the signal peptide is a secA2 signal peptide, such the p60 signal peptide from Listeria monocytogenes.
- the recombinant nucleic acid molecule optionally comprises a third polynucleotide sequence encoding p60, or a fragment thereof.
- the signal peptide is a Tat signal peptide, such as a B. subtilis Tat signal peptide (e.g., PhoD).
- the signal peptide is in the same translational reading frame encoding the recombinant polypeptide.
- the secretion signal sequence is from a Listeria protein.
- the secretion signal is an ActA 3 oo secretion signal.
- the secretion signal is an ActAioo secretion signal.
- the nucleic acid construct comprises an open reading frame encoding a ubiquitin protein.
- the ubiquitin is a full-length protein. It will be appreciated by the skilled artisan that the Ubiquitin in the expressed construct disclosed herein (expressed from the nucleic acid construct disclosed herein) is cleaved at the carboxy-terminus from the rest of the recombinant chimeric protein expressed from the nucleic acid construct through the action of hydrolases upon entry to the host cell cytosol. This liberates the amino-terminus of the peptide moiety, producing a peptide (length depends on the specific peptide) in the host cell cytosol.
- the peptide encoded by the nucleic acid constructs disclosed herein is 8-10 amino acids (AA) in length. In another embodiment, the peptide is 10-20 AA long. In another embodiment, the peptide is a 21-30 AA long. In another embodiment, the peptide is 31-50 AA long. In another embodiment, the peptide is 51-100 AA long.
- the peptide is an antigenic peptide. In another embodiment, the peptide is derived from a tumor antigen. In another embodiment, the peptide is derived from an infectious disease antigen. In another embodiment, the peptide is derived from a self-antigen. In another embodiment, the peptide is derived from an angiogenic antigen. [0056] In one embodiment, the antigen from which the peptide disclosed herein is derived from is derived from a fungal pathogen, bacteria, parasite, helminth, or viruses.
- the antigen from which the peptide derived herein is selected from tetanus toxoid, hemagglutinin molecules from influenza virus, diphtheria toxoid, HIV gpl20, HIV gag protein, IgA protease, insulin peptide B, Spongospora subterranea antigen, vibriose antigens, Salmonella antigens, pneumococcus antigens, respiratory syncytial virus antigens, Haemophilus influenza outer membrane proteins, Helicobacter pylori urease, Neisseria meningitidis pilins, N.
- gonorrhoeae pilins the melanoma-associated antigens (TRP-2, MAGE-1, MAGE-3, gp-100, tyrosinase, MART-1, HSP- 70, beta-HCG), human papilloma virus antigens El and E2 from type HPV-16, -18, -31, -33, -35 or - 45 human papilloma viruses, the tumor antigens CEA, the ras protein, mutated or otherwise, the p53 protein, mutated or otherwise, Mucl, mesothelin, EGFRVIII or pSA.
- the peptide is derived from an antigen that is associated with one of the following diseases; cholera, diphtheria, Haemophilus, hepatitis A, hepatitis B, influenza, measles, meningitis, mumps, pertussis, small pox, pneumococcal pneumonia, polio, rabies, rubella, tetanus, tuberculosis, typhoid, Varicella-zoster, whooping cough, yellow fever, the immunogens and antigens from Addison's disease, allergies, anaphylaxis, Bruton's syndrome, cancer, including solid and blood borne tumors, eczema, Hashimoto's thyroiditis, polymyositis, dermatomyositis, type 1 diabetes mellitus, acquired immune deficiency syndrome, transplant rejection, such as kidney, heart, pancreas, lung, bone, and liver transplants,
- the antigen from which the peptide disclosed herein is derived is a tumor-associated antigen, which in one embodiment, is one of the following tumor antigens: a MAGE (Melanoma-Associated Antigen E) protein, e.g.
- CEA carcinoembryonic antigen
- the antigen for the compositions and methods as disclosed herein are melanoma-associated antigens, which in one embodiment are TRP- 2, MAGE-1, MAGE-3, gp-100, tyrosinase, HSP-70, beta-HCG, or a combination thereof.
- Other tumor-associated antigens known in the art are also contemplated in the present invention.
- the peptide is derived from a chimeric Her2 antigen described in US patent application serial no. 12/945,386, which is hereby incorporated by reference herein in its entirety.
- the peptide is derived from an antigen selected from a HPV-E7 (from either an HPV 16 or HPV 18 strain), a HPV-E6 (from either an HPV 16 or HPV 18 strain), Her- 2/neu, NY-ESO-1, telomerase (TERT, SCCE, CEA, LMP-1, p53, carboxic anhydrase IX (CAIX), PSMA, a prostate stem cell antigen (PSCA), a HMW-MAA, WT-1, HIV-1 Gag, Proteinase 3, Tyrosinase related protein 2, PSA (pro state- specific antigen), EGFR-III, survivin, baculoviral inhibitor of apoptosis repeat-containing 5 (BIRC5), LMP-1, p53, PSMA, PSCA, Mucl, PSA (prostate-specific antigen), or a combination thereof.
- a HPV-E7 from either an HPV 16 or HPV 18 strain
- HPV-E6 from either an HP
- a polypeptide expressed by the Listeria of the present disclosure may be a neuropeptide growth factor antagonist, which in one embodiment is [D-Argl, D-Phe5, D-Trp7,9, Leul l] substance P, [Arg6, D-Trp7,9, NmePhe8] substance P(6-l l).
- a neuropeptide growth factor antagonist which in one embodiment is [D-Argl, D-Phe5, D-Trp7,9, Leul l] substance P, [Arg6, D-Trp7,9, NmePhe8] substance P(6-l l).
- the heterologous antigen is an infectious disease antigen.
- the antigen is an auto antigen or a self-antigen.
- the peptide is capable of being loaded onto an MHC class I molecule. In another embodiment, the peptide is capable of being loaded onto MHC class ⁇ molecules. In another embodiment, the peptide is an MHC class I peptide. In another embodiment, the peptide is an MHC class ⁇ peptide. In another embodiment, the peptide can be recognized by T cell receptors on a CD8+ T cell, when bound to an MHC class I molecule on the surface of a host cell. In another embodiment, the peptide can be recognized by T cell receptors on a CD4+ T cell, when bound to an MHC class ⁇ molecule on the surface of a host cell.
- the peptide can be recognized by an antibody or small molecule present on the surface of an effector CD4+ or CD 8+ cell that is specific for binding the peptide, when bound to an MHC class I or MHC class II molecule on the surface of a host cell.
- the expression system disclosed herein comprises the use of the nucleic acid construct encoding the chimeric protein disclosed herein.
- this expression system is designed to facilitate panels of recombinant proteins containing distinct peptide moieties at the carboxy terminus. This is accomplished, in one embodiment, by a PCR reaction utilizing a sequence encoding on the of the bacterial secretion signal sequence-ubiquitin-peptide (SS-Ub-Peptide) constructs as a template.
- SS-Ub-Peptide sequence-ubiquitin-peptide
- a new SS-Ub-Peptide sequence can be generated in a single PCR reaction (see Examples herein).
- the 5' primer encoding the bacterial promoter and the first few nucleotides of the bacterial secretion signal sequence may be the same for all the constructs. A schematic representation of this construct is provided in Figure 1 herein.
- the recombinant Listeria comprises a second nucleic acid molecule or construct comprising an open reading frame encoding a metabolic enzyme, wherein the metabolic enzyme complements a mutation, deletion or inactivation in an endogenous gene of the Listeria.
- the metabolic enzyme complements an endogenous gene that is lacking in the chromosome of the recombinant Listeria strain.
- the second nucleic acid molecule comprises an open reading frame encoding a second metabolic enzyme that complements a mutation in an endogenous gene of the Listeria.
- the second nucleic acid molecule comprises an open reading frame encoding a second metabolic enzyme that complements an endogenous gene that is mutated in the chromosome of the recombinant Listeria strain.
- fragment refers to a protein or polypeptide that is shorter or comprises fewer amino acids than the full length protein or polypeptide.
- a fragment has 10-20 nucleic or amino acids, while in another embodiment, a fragment has more than 5 nucleic or amino acids, while in another embodiment, a fragment has 100-200 nucleic or amino acids, while in another embodiment, a fragment has 100-500 nucleic or amino acids, while in another embodiment, a fragment has 50-200 nucleic or amino acids, while in another embodiment, a fragment has 10-250 nucleic or amino acids.
- the nucleic constructs or nucleic acid molecules are expressed from at least one episomal or plasmid vector.
- a plasmid vector is stably maintained in the recombinant Listeria strain in the absence of antibiotic selection.
- the plasmid does not confer antibiotic resistance upon the recombinant Listeria.
- the recombinant Listeria strain disclosed herein lacks antibiotic resistance genes.
- the recombinant Listeria strain disclosed herein comprises a plasmid comprising a nucleic acid encoding an antibiotic resistance gene.
- the recombinant Listeria comprises an episomal vector that carries the nucleic acid construct disclosed herein.
- the episomal vector is extra- chromosomal in that it does not integrate into the genome of the Listeria.
- the recombinant Listeria comprises a plasmid vector that carries the nucleic acid construct disclosed herein.
- the plasmid vector contains integration sequences for integrating into the Listeria chromosome.
- the terms "genome” and "chromosome” are used interchangeably herein.
- an LLO protein for use in the compositions and methods disclosed herein.
- a fragment of an LLO protein is used in the compositions and methods disclosed herein.
- the fragment is a functional fragment.
- the fragment is an immunogenic fragment.
- the LLO protein utilized to construct vaccines of the present disclosure has, in another embodiment, the sequence:
- the LLO protein has a sequence set forth in GenBank Accession No. DQ054589.1, which refers to the hly gene from Listeria 10403S.
- the first 25 AA of the proprotein corresponding to this sequence are the signal sequence and are cleaved from LLO when it is secreted by the bacterium.
- the full length active LLO protein is 504 residues long.
- the above LLO fragment is used as the source of the LLO fragment incorporated in a vaccine of the present invention.
- N-terminal fragment of an LLO protein utilized in compositions and methods of the present disclosure has the sequence:
- the LLO fragment corresponds to about AA 20-442 of an LLO protein utilized herein.
- the LLO fragment has the sequence:
- the LLO signal peptide or signal sequence comprises the following amino acids: MKKTMLVFITLILVSLPIAQQTEAK (SEQ ID NO: 4).
- truncated LLO refers to a fragment of LLO that comprises the PEST-like domain.
- the term refers to an LLO fragment that comprises a PEST sequence.
- ALLO refers to 416AA LLO fragment as defined above.
- the terms truncated LLO, tLLO, or ALLO refer to an LLO fragment that does not contain the activation domain at the amino terminus and does not include cysteine 484.
- the terms refer to an LLO fragment that is not hemolytic.
- the LLO fragment is rendered non-hemolytic by deletion or mutation of the activation domain.
- the LLO fragment is rendered non-hemolytic by deletion or mutation of cysteine 484.
- the LLO fragment is rendered non-hemolytic by deletion or mutation at another location.
- the LLO is rendered non- hemolytic by a deletion or mutation of the cholesterol binding domain (CBD) as detailed in US Patent No. 8,771,702, which is incorporated by reference herein.
- CBD cholesterol binding domain
- the LLO fragment consists of about the first 441 AA of the LLO protein. In another embodiment, the LLO fragment consists of about the first 420 AA of LLO. In another embodiment, the LLO fragment is a non-hemolytic form of the LLO protein.
- the LLO fragment consists of about residues 1-25. In another embodiment, the LLO fragment consists of about residues 1-50. In another embodiment, the LLO fragment consists of about residues 1-75. In another embodiment, the LLO fragment consists of about residues 1-100. In another embodiment, the LLO fragment consists of about residues 1-125. In another embodiment, the LLO fragment consists of about residues 1-150. In another embodiment, the LLO fragment consists of about residues 1175. In another embodiment, the LLO fragment consists of about residues 1-200. In another embodiment, the LLO fragment consists of about residues 1-225. In another embodiment, the LLO fragment consists of about residues 1-250.
- the LLO fragment consists of about residues 1-275. In another embodiment, the LLO fragment consists of about residues 1-300. In another embodiment, the LLO fragment consists of about residues 1-325. In another embodiment, the LLO fragment consists of about residues 1-350. In another embodiment, the LLO fragment consists of about residues 1-375. In another embodiment, the LLO fragment consists of about residues 1-400. In another embodiment, the LLO fragment consists of about residues 1-425.
- the LLO fragment contains residues of a homologous LLO protein that correspond to one of the above AA ranges.
- the residue numbers need not, in another embodiment, correspond exactly with the residue numbers enumerated above; e.g. if the homologous LLO protein has an insertion or deletion, relative to an LLO protein utilized herein, then the residue numbers can be adjusted accordingly.
- Other LLO fragments are known in the art.
- the LLO fragment consists of about the first 441 AA of the LLO protein. In another embodiment, the LLO fragment consists of about the first 420 AA of LLO. In another embodiment, the LLO fragment is a non-hemolytic form of the LLO protein.
- the LLO fragment consists of about residues 1-25. In another embodiment, the LLO fragment consists of about residues 1-50. In another embodiment, the LLO fragment consists of about residues 1-75. In another embodiment, the LLO fragment consists of about residues 1-100. In another embodiment, the LLO fragment consists of about residues 1-125. In another embodiment, the LLO fragment consists of about residues 1-150. In another embodiment, the LLO fragment consists of about residues 1175. In another embodiment, the LLO fragment consists of about residues 1-200. In another embodiment, the LLO fragment consists of about residues 1-225. In another embodiment, the LLO fragment consists of about residues 1-250.
- the LLO fragment consists of about residues 1-275. In another embodiment, the LLO fragment consists of about residues 1-300. In another embodiment, the LLO fragment consists of about residues 1-325. In another embodiment, the LLO fragment consists of about residues 1-350. In another embodiment, the LLO fragment consists of about residues 1-375. In another embodiment, the LLO fragment consists of about residues 1-400. In another embodiment, the LLO fragment consists of about residues 1-425.
- the LLO fragment contains residues of a homologous LLO protein that correspond to one of the above AA ranges.
- the residue numbers need not, in another embodiment, correspond exactly with the residue numbers enumerated above; e.g. if the homologous LLO protein has an insertion or deletion, relative to an LLO protein utilized herein, then the residue numbers can be adjusted accordingly
- Other LLO fragments are known in the art.
- a homologous LLO refers to identity to an LLO sequence (e.g. to one of SEQ ID No: 1-3) of greater than 70%.
- a homologous LLO refers to identity to one of SEQ ID No: 1-3 of greater than 72%.
- a homologous refers to identity to one of SEQ ID No: l-3of greater than 75%.
- a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 78%.
- a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 80%.
- a homologous refers to identity to one of SEQ ID No: 1-34 of greater than 82%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 83%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 85%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 87%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 88%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 90%.
- a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 92%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 93%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 95%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 96%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 97%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 98%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of greater than 99%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 1-3 of 100%.
- an ActA protein is encoded by a sequence set forth in SEQ ID NO: 5 MGLNRFMRAMMVVFITANCITINPDIIFAATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYE TAREVSSRDIKELEKSNKVRNTNKADLIAMLKEKAEKGPNINNNNSEQTENAAINEEASGA DRPAIQVERRHPGLPSDS AAEIKKRRKAIAS S DS ELES LT YPDKPTKVNKKKVAKES VAD A SESDLDSSMQSADESSPQPLKANQQPFFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSA GLIDQLLTKKKSEEVNASDFPPPPTDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTDEEL RLALPETPMLLGFN APATSEPSSFEFPPPPTDEEL RLALPETPMLLGFN APATSEPSSFEFPPPPTDEEL RLALPETPMLLGFN AP ATSEPSSFEFPPPPTDEEL RL
- an ActA protein comprises SEQ ID NO: 5.
- the first 29 AA of the proprotein corresponding to this sequence are the signal sequence and are cleaved from ActA protein when it is secreted by the bacterium.
- an ActA polypeptide or peptide comprises the signal sequence, AA 1-29 of SEQ ID NO: 5 above.
- an ActA polypeptide or peptide does not include the signal sequence, AA 1-29 of SEQ ID NO: 5 above.
- a recombinant nucleotide encoding a truncated ActA protein disclosed herein comprises the sequence set forth in SEQ ID NO: 6
- an ActA protein comprises the sequence set forth in SEQ ID NO: 7 [0091] MGLNRFM R A M M V V F I T A N C I T I N P D I I F A A T D S E D S S L N T D E W E E E K T E E Q P S E V N T G P R Y E T A R E V S S R D I E E L E K S N K V K N T N K A D L I A M L K A K A E K G P N N N N N N G E Q T G N V A I N E E A S G V D R P T L Q V E R R H P G L S S D S A A E I K K R R K A I A S S D S E L E S L T Y P D K P T K A N K R K V A K E S V V V D A S E S D L D S M Q S A D E S T P Q P L K A N Q K P F F P K V F K I K D A G K W V R D
- the first 29 AA of the proprotein corresponding to this sequence are the signal sequence and are cleaved from ActA protein when it is secreted by the bacterium.
- an ActA polypeptide or peptide comprises the signal sequence, AA 1-29 of SEQ ID NO: 7. In another embodiment, an ActA polypeptide or peptide does not include the signal sequence, AA 1-29 of SEQ ID NO: 7. In one embodiment, a truncated ActA protein comprises an N-terminal fragment of an ActA protein. In another embodiment, a truncated ActA protein is an N-terminal fragment of an ActA protein.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 8
- the ActA fragment comprises the sequence set forth in SEQ ID NO: 8.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 9:
- the ActA fragment is any other ActA fragment known in the art.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 10
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 11:
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 12
- a truncated ActA as set forth in SEQ ID NO: 12 is referred to as ActA/PESTl.
- a truncated ActA comprises from the first 30 to amino acid 122 of the full length ActA sequence.
- SEQ ID NO: 12 comprises from the first 30 to amino acid 122 of the full length ActA sequence.
- a truncated ActA comprises from the first 30 to amino acid 122 of SEQ ID NO: 7.
- SEQ ID NO: 12 comprises from the first 30 to amino acid 122 of SEQ ID NO: 7.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 13
- a truncated ActA as set forth in SEQ ID NO: 12 is referred to as ActA/PESTl.
- a truncated ActA comprises from the first 1 to amino acid 130 of the full length ActA sequence.
- SEQ ID NO: 13 comprises from the first 1 to amino acid 130 of the full length ActA sequence.
- a truncated ActA comprises from the first 1 to amino acid 130 of SEQ ID NO: 7.
- SEQ ID NO: 13 comprises from the first 30 to amino acid 122 of SEQ ID NO: 7.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 14
- a truncated ActA as set forth in SEQ ID NO: 14 is referred to as ActA/PESTl.
- a truncated ActA comprises from the first 30 to amino acid 122 of the full length ActA sequence.
- SEQ ID NO: 14 comprises from the first 30 to amino acid 122 of the full length ActA sequence.
- a truncated ActA comprises from the first 30 to amino acid 122 of SEQ ID NO: 7.
- SEQ ID NO: 14 comprises from the first 30 to amino acid 122 of SEQ ID NO: 7.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 1
- a truncated ActA as set forth in SEQ ID NO: 15 is referred to as ActA/PEST2.
- a truncated ActA comprises from amino acid 30 to amino acid 229 of the full length ActA sequence.
- SEQ ID NO: 15 comprises from about amino acid 30 to about amino acid 229 of the full length ActA sequence.
- a truncated ActA comprises from about amino acid 30 to amino acid 229 of SEQ ID NO: 7.
- SEQ ID NO: 15 comprises from amino acid 30 to amino acid 229 of SEQ ID NO: 7.
- a truncated ActA protein comprises the sequence set forth in
- a truncated ActA as set forth in SEQ ID NO: 16 is referred to as ActA/PEST3.
- this truncated ActA comprises from the first 30 to amino acid 332 of the full length ActA sequence.
- SEQ ID NO: 16 comprises from the first 30 to amino acid 332 of the full length ActA sequence.
- a truncated ActA comprises from about the first 30 to amino acid 332 of SEQ ID NO: 7.
- SEQ ID NO: 16 comprises from the first 30 to amino acid 332 of SEQ ID NO: 7.
- a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 17
- a truncated ActA as set forth in SEQ ID NO: 17 is referred to as ActA/PEST4.
- this truncated ActA comprises from the first 30 to amino acid 399 of the full length ActA sequence.
- SEQ ID NO: 25 comprises from the first 30 to amino acid 399 of the full length ActA sequence.
- a truncated ActA comprises from the first 30 to amino acid 399 of SEQ ID NO: 7.
- SEQ ID NO: 17 comprises from the first 30 to amino acid 399 of SEQ ID NO: 7.
- a truncated ActA sequence disclosed herein is further fused to an hly signal peptide at the N-terminus.
- the truncated ActA fused to hly signal peptide comprises SEQ ID NO: 18
- LA229 a truncated ActA as set forth in SEQ ID NO: 18 is referred to as "LA229".
- a truncated ActA fused to hly signal peptide is encoded by a sequence comprising SEQ ID NO: 19
- SEQ ID NO: 19 comprises a sequence encoding a linker region (see bold, italic text) that is used to create a unique restriction enzyme site for Xbal so that different polypeptides, heterologous antigens, etc. can be cloned after the signal sequence.
- linker region see bold, italic text
- signal peptidases act on the sequences before the linker region to cleave signal peptide.
- the recombinant nucleotide encoding a truncated ActA protein comprises the sequence set forth in SEQ ID NO: 20 atgcgtgcgatgatggtggttttcattactgccaattgcattacgattaaccccgacataatatttgcagcgacagatagcgaagattctagtctaaac acagatgaatgggaagaagaaaaaacagaagagcaaccaagcgaggtaaatacgggaccaagatacgaaactgcacgtgaagtaagttcac gtgatattaaagaactagaaaaatcgaataaagtgagaaatacgaacaaagcagacctaatagcaatgttgaaagaaaaaaaggtcc aaatatcaataatcaataataatacaacagttgtgaaaga
- the recombinant nucleotide has the sequence set forth in SEQ ID NO: 18. In another embodiment, the recombinant nucleotide comprises other sequences that encode a fragment of an ActA protein.
- truncated ActA “N-terminal ActA fragment” or “AActA” are used interchangeably herein and refer to a fragment of ActA that comprises a PEST domain.
- the terms refer to an ActA fragment that comprises a PEST sequence.
- the terms refer to an immunogenic fragment of the ActA protein.
- the terms refer to a truncated ActA fragment encoded by SEQ ID NO: 8-18 disclosed herein.
- the N-terminal ActA protein fragment of methods and compositions of the present invention comprises, in one embodiment, a sequence selected from SEQ ID No: 8-18.
- the ActA fragment comprises an ActA signal peptide.
- the ActA fragment consists approximately of a sequence selected from SEQ ID NO: 8-18.
- the ActA fragment consists essentially of a sequence selected from SEQ ID NO: 8-18.
- the ActA fragment corresponds to a sequence selected from SEQ ID NO: 8-18.
- the ActA fragment is homologous to a sequence selected from SEQ ID NO: 8-18.
- the PEST sequence is another PEST AA sequence derived from a prokaryotic organism.
- the PEST AA sequence may be other PEST sequences known in the art.
- the ActA fragment consists of about the first 100 AA of the ActA protein.
- the ActA fragment consists of about residues 1-25. In another embodiment, the ActA fragment consists of about residues 1-29. In another embodiment, the ActA fragment consists of about residues 1-50. In another embodiment, the ActA fragment consists of about residues 1-75. In another embodiment, the ActA fragment consists of about residues 1-100. In another embodiment, the ActA fragment consists of about residues 1-125. In another embodiment, the ActA fragment consists of about residues 1-150. In another embodiment, the ActA fragment consists of about residues 1-175. In another embodiment, the ActA fragment consists of about residues 1-200. In another embodiment, the ActA fragment consists of about residues 1-225. In another embodiment, the ActA fragment consists of about residues 1-250.
- the ActA fragment consists of about residues 1-275. In another embodiment, the ActA fragment consists of about residues 1-300. In another embodiment, the ActA fragment consists of about residues 1-325. In another embodiment, the ActA fragment consists of about residues 1-338. In another embodiment, the ActA fragment consists of about residues 1-350. In another embodiment, the ActA fragment consists of about residues 1-375. In another embodiment, the ActA fragment consists of about residues 1-400. In another embodiment, the ActA fragment consists of about residues 1-450. In another embodiment, the ActA fragment consists of about residues 1-500. In another embodiment, the ActA fragment consists of about residues 1-550. In another embodiment, the ActA fragment consists of about residues 1-600.
- the ActA fragment consists of about residues 1-639. In another embodiment, the ActA fragment consists of about residues 30-100. In another embodiment, the ActA fragment consists of about residues 30-125. In another embodiment, the ActA fragment consists of about residues 30-150. In another embodiment, the ActA fragment consists of about residues 30-175. In another embodiment, the ActA fragment consists of about residues 30-200. In another embodiment, the ActA fragment consists of about residues 30-225. In another embodiment, the ActA fragment consists of about residues 30-250. In another embodiment, the ActA fragment consists of about residues 30-275. In another embodiment, the ActA fragment consists of about residues 30-300. In another embodiment, the ActA fragment consists of about residues 30-325.
- the ActA fragment consists of about residues 30-338. In another embodiment, the ActA fragment consists of about residues 30-350. In another embodiment, the ActA fragment consists of about residues 30-375. In another embodiment, the ActA fragment consists of about residues 30-400. In another embodiment, the ActA fragment consists of about residues 30-450. In another embodiment, the ActA fragment consists of about residues 30-500. In another embodiment, the ActA fragment consists of about residues 30-550. In another embodiment, the ActA fragment consists of about residues 1-600. In another embodiment, the ActA fragment consists of about residues 30-604.
- the ActA fragment contains residues of a homologous ActA protein that correspond to one of the above AA ranges.
- the residue numbers need not, in another embodiment, correspond exactly with the residue numbers enumerated above; e.g. if the homologous ActA protein has an insertion or deletion, relative to an ActA protein utilized herein, then the residue numbers can be adjusted accordingly.
- Other ActA fragments are known in the art.
- a homologous ActA refers to identity to an ActA sequence (e.g. to one of SEQ ID No: 5, 7-18) of greater than 70%.
- a homologous ActA refers to identity to one of SEQ ID No: 5, 7-18 of greater than 72%.
- a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 75%.
- a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 78%.
- a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 80%.
- a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 82%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 83%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 85%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 87%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 88%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 greater than 90%.
- a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 92%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 93%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 95%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 96%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 97%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 98%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of greater than 99%. In another embodiment, a homologous refers to identity to one of SEQ ID No: 5, 7-18 of 100%.
- the term "homology,” when in reference to any nucleic acid sequence disclosed herein refers to a percentage of nucleotides in a candidate sequence that is identical with the nucleotides of a corresponding native nucleic acid sequence .
- Homology may be determined by a computer algorithm for sequence alignment, by methods well described in the art.
- computer algorithm analysis of nucleic acid sequence homology may include the utilization of any number of software packages available, such as, for example, the BLAST, DOMAIN, BEAUTY (BLAST Enhanced Alignment Utility), GENPEPT and TREMBL packages.
- identity refers to identity to a sequence selected from the sequences disclosed herein of greater than 68%. In another embodiment, “homology” refers to identity to a sequence selected from the sequences disclosed herein of greater than 70%. In another embodiment, “homology” refers to identity to a sequence selected from the sequences disclosed herein of greater than 72%. In another embodiment, the identity is greater than 75%. In another embodiment, the identity is greater than 78%. In another embodiment, the identity is greater than 80%. In another embodiment, the identity is greater than 82%. In another embodiment, the identity is greater than 83%. In another embodiment, the identity is greater than 85%. In another embodiment, the identity is greater than 87%. In another embodiment, the identity is greater than 88%.
- the identity is greater than 90%. In another embodiment, the identity is greater than 92%. In another embodiment, the identity is greater than 93%. In another embodiment, the identity is greater than 95%. In another embodiment, the identity is greater than 96%. In another embodiment, the identity is greater than 97%. In another embodiment, the identity is greater than 98%. In another embodiment, the identity is greater than 99%. In another embodiment, the identity is 100%.
- the LLO protein, ActA protein, or fragment thereof of the present disclosure need not be that which is set forth exactly in the sequences set forth herein, but rather that other alterations, modifications, or changes can be made that retain the functional characteristics of an LLO or ActA protein as set forth elsewhere herein.
- the present disclosure utilizes an analog of an LLO protein, ActA protein, or fragment thereof. Analogs differ, in another embodiment, from naturally occurring proteins or peptides by conservative AA sequence differences or by modifications which do not affect sequence, or by both.
- homology is determined via determination of candidate sequence hybridization, methods of which are well described in the art (See, for example, “Nucleic Acid Hybridization” Hames, B. D., and Higgins S. J., Eds. (1985); Sambrook et al., 2001, Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, N.Y.; and Ausubel et al., 1989, Current Protocols in Molecular Biology, Green Publishing Associates and Wiley Interscience, N.Y).
- methods of hybridization may be carried out under moderate to stringent conditions, to the complement of a DNA encoding a native caspase peptide.
- Hybridization conditions being, for example, overnight incubation at 42 °C in a solution comprising: 10-20 % formamide, 5 X SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7. 6), 5 X Denhardt's solution, 10 % dextran sulfate, and 20 ⁇ g/mL denatured, sheared salmon sperm DNA .
- the recombinant Listeria disclosed herein is capable of escaping the phagolysosome.
- a nucleic acid sequence encoding a heterologous antigen or an antigenic portion thereof is integrated in frame in the Listeria chromosome.
- the integrated nucleic acid sequence encoding a heterologous antigen is integrated in frame with ActA at the ActA locus.
- the chromosomal nucleic acid encoding ActA is replaced by a nucleic acid molecule comprising a sequence encoding an antigen.
- the antigen is any antigen disclosed herein and known in the art.
- the second nucleic acid molecule or construct disclosed herein comprises an open reading frame encoding a metabolic enzyme.
- the metabolic enzyme complements an endogenous gene that is mutated in the chromosome of the recombinant Listeria strain.
- the metabolic enzyme complements an endogenous gene that is lacking in the chromosome of the recombinant Listeria strain.
- the metabolic enzyme encoded by the open reading frame is an alanine racemase enzyme (dal).
- the metabolic enzyme encoded by the open reading frame is a D-amino acid transferase enzyme (dat).
- the Listeria strains disclosed herein comprise a mutation in the endogenous dal/dat genes.
- the Listeria lacks the dal/dat genes.
- a nucleic acid molecule of the methods and compositions of the present disclosure is operably linked to a promoter/regulatory sequence.
- an open reading frame of methods and compositions of the present disclosure is operably linked to a promoter/regulatory sequence.
- each of the open reading frames disclosed herein are operably linked to a promoter/regulatory sequence.
- expression of each of the open reading frames disclosed herein is driven from a single promoter/regulatory sequence.
- the hly promoter and hly signal sequence are operably linked so as to drive expression of a chimeric protein disclosed herein.
- an actA promoter and an actA signal sequence are operably linked so as to drive expression of a chimeric protein described herein.
- Metal enzyme refers to an enzyme involved in synthesis of a nutrient required by the host bacteria. In another embodiment, the term refers to an enzyme required for synthesis of a nutrient required by the host bacteria. In another embodiment, the term refers to an enzyme involved in synthesis of a nutrient utilized by the host bacteria. In another embodiment, the term refers to an enzyme involved in synthesis of a nutrient required for sustained growth of the host bacteria. In another embodiment, the enzyme is required for synthesis of the nutrient.
- the recombinant Listeria is an attenuated auxotrophic strain.
- the attenuated strain is Lm dal(-)dat(-) (Lmdd).
- the attenuated strains is Lm dal(-)dat(-)AactA (LmddA).
- LmddA is based on a Listeria vaccine vector which is attenuated due to the deletion of virulence gene actA and retains the plasmid expression in vivo and in vitro by complementation of dal gene.
- the attenuated strain is LmddA. In another embodiment, the attenuated strain is LmAactA. In another embodiment, the attenuated strain is LmAprfA. In another embodiment, the attenuated strain is LmAplcB. In another embodiment, the attenuated strain is LmAplcA. In another embodiment, the strain is the double mutant or triple mutant of any of the above-mentioned strains. In another embodiment, this strain exerts a strong adjuvant effect which is an inherent property of Listeria -based vaccines. In another embodiment, this strain is constructed from the EGD Listeria backbone. In another embodiment, the strain used in the disclosure is a Listeria strain that expresses a genomic hemolytic LLO.
- the Listeria strain is an auxotrophic mutant. In another embodiment, the Listeria strain is deficient in a gene encoding a vitamin synthesis gene. In another embodiment, the Listeria strain is deficient in a gene encoding pantothenic acid synthase.
- the Listeria strain is deficient in an amino acid (AA) metabolism enzyme.
- the generation of auxotrophic strains of Listeria deficient in D-alanine may be accomplished in a number of ways that are well known to those of skill in the art, including deletion mutagenesis, insertion mutagenesis, and mutagenesis which results in the generation of frameshift mutations, mutations which cause premature termination of a protein, or mutation of regulatory sequences which affect gene expression.
- mutagenesis can be accomplished using recombinant DNA techniques or using traditional mutagenesis technology using mutagenic chemicals or radiation and subsequent selection of mutants.
- deletion mutants are preferred because of the accompanying low probability of reversion of the auxotrophic phenotype.
- mutants of D-alanine which are generated according to the protocols presented herein may be tested for the ability to grow in the absence of D-alanine in a simple laboratory culture assay.
- those mutants which are unable to grow in the absence of this compound are selected for further study.
- the metabolic enzyme complements an endogenous metabolic gene that is lacking in the remainder of the chromosome of the recombinant bacterial strain.
- the endogenous metabolic gene is mutated in the chromosome.
- the endogenous metabolic gene is deleted from the chromosome.
- the metabolic enzyme is an amino acid metabolism enzyme.
- the metabolic enzyme catalyzes a formation of an amino acid used for a cell wall synthesis in the recombinant Listeria strain.
- the metabolic enzyme is an alanine racemase enzyme.
- the metabolic enzyme is a D-amino acid transferase enzyme.
- the auxotrophic Listeria strain comprises an episomal expression vector comprising a metabolic enzyme that complements the auxotrophy of the auxotrophic Listeria strain.
- the construct is contained in the Listeria strain in an episomal fashion.
- the foreign antigen or peptide is expressed from a vector harbored by the recombinant Listeria strain.
- the episomal expression vector lacks an antibiotic resistance marker.
- the Listeria strain is deficient in a D-glutamic acid synthase gene.
- the Listeria strain is deficient in the dat gene.
- the Listeria strain is deficient in the dal gene.
- the Listeria strain is deficient in the dga gene. In another embodiment, the Listeria strain is deficient in a gene involved in the synthesis of diaminopimelic acid. CysK. In another embodiment, the gene is vitamin- B 12 independent methionine synthase. In another embodiment, the gene is trpA. In another embodiment, the gene is trpB. In another embodiment, the gene is trpE. In another embodiment, the gene is asnB. In another embodiment, the gene is gltD. In another embodiment, the gene is gltB. In another embodiment, the gene is leuA. In another embodiment, the gene is argG. In another embodiment, the gene is thrC. In another embodiment, the Listeria strain is deficient in one or more of the genes described hereinabove.
- the Listeria strain is deficient in a synthase gene.
- the gene is an AA synthesis gene.
- the gene is folP.
- the gene is dihydrouridine synthase family protein.
- the gene is ispD.
- the gene is ispF.
- the gene is phosphoenolpyruvate synthase.
- the gene is hisF.
- the gene is hisH.
- the gene is flil.
- the gene is ribosomal large subunit pseudouridine synthase.
- the gene ispD.
- the gene is bifunctional GMP synthase/glutamine amidotransferase protein.
- the gene is cobS.
- the gene is cobB.
- the gene is cbiD.
- the gene is uroporphyrin-III C-methyltransferase/ uroporphyrinogen-III synthase.
- the gene is cobQ.
- the gene is uppS.
- the gene is truB.
- the gene is dxs.
- the gene is mvaS.
- the gene is dapA.
- the gene is ispG.
- the gene isfolC. In another embodiment, the gene is citrate synthase. In another embodiment, the gene is argj. In another embodiment, the gene is 3-deoxy-7-phosphoheptulonate synthase. In another embodiment, the gene is indole-3-glycerol- phosphate synthase. In another embodiment, the gene is anthranilate synthase/ glutamine amidotransferase component. In another embodiment, the gene is metiB. In another embodiment, the gene is menaquinone- specific isochorismate synthase. In another embodiment, the gene is phosphoribosylformylglycinamidine synthase I or II.
- the gene is phosphoribosylaminoimidazole-succinocarboxamide synthase.
- the gene is carB. In another embodiment, the gene is car A. In another embodiment, the gene is thy A. In another embodiment, the gene is mgsA. In another embodiment, the gene is aroB. In another embodiment, the gene is hepB. In another embodiment, the gene is rluB. In another embodiment, the gene is ilvB. In another embodiment, the gene is ilvN. In another embodiment, the gene is alsS. In another embodiment, the gene fabF. In another embodiment, the gene isfabH. In another embodiment, the gene is pseudouridine synthase. In another embodiment, the gene is pyrG. In another embodiment, the gene is truA. In another embodiment, the gene is pabB. In another embodiment, the gene is an atp synthase gene (e.g. atpC, atpD-2, aptG, atpA-2, etc).
- the gene is phoP. In another embodiment, the gene is aroA. In another embodiment, the gene is aroC. In another embodiment, the gene is aroD. In another embodiment, the gene is plcB. [00138] In another embodiment, the Listeria strain is deficient in a peptide transporter. In another embodiment, the gene is ABC transporter/ ATP-binding/permease protein. In another embodiment, the gene is oligopeptide ABC transporter/ oligopeptide-binding protein. In another embodiment, the gene is oligopeptide ABC transporter/ permease protein. In another embodiment, the gene is zinc ABC transporter/ zinc -binding protein. In another embodiment, the gene is sugar ABC transporter.
- the gene is phosphate transporter. In another embodiment, the gene is ZIP zinc transporter. In another embodiment, the gene is drug resistance transporter of the EmrB/QacA family. In another embodiment, the gene is sulfate transporter. In another embodiment, the gene is proton-dependent oligopeptide transporter. In another embodiment, the gene is magnesium transporter. In another embodiment, the gene is formate/nitrite transporter. In another embodiment, the gene is spermidine/putrescine ABC transporter. In another embodiment, the gene is Na/Pi- cotransporter. In another embodiment, the gene is sugar phosphate transporter. In another embodiment, the gene is glutamine ABC transporter. In another embodiment, the gene is major facilitator family transporter.
- the gene is glycine betaine/L-proline ABC transporter. In another embodiment, the gene is molybdenum ABC transporter. In another embodiment, the gene is techoic acid ABC transporter. In another embodiment, the gene is cobalt ABC transporter. In another embodiment, the gene is ammonium transporter. In another embodiment, the gene is amino acid ABC transporter. In another embodiment, the gene is cell division ABC transporter. In another embodiment, the gene is manganese ABC transporter. In another embodiment, the gene is iron compound ABC transporter. In another embodiment, the gene is maltose/maltodextrin ABC transporter. In another embodiment, the gene is drug resistance transporter of the Bcr/CflA family. In another embodiment, the gene is a subunit of one of the above proteins.
- nucleic acid molecule that is used to transform the Listeria in order to arrive at a recombinant Listeria.
- the nucleic acid disclosed herein used to transform Listeria lacks a virulence gene.
- the nucleic acid molecule is integrated into the Listeria genome and carries a non-functional virulence gene.
- the virulence gene is mutated in the recombinant Listeria.
- the nucleic acid molecule is used to inactivate the endogenous gene present in the Listeria genome.
- the virulence gene is an actA gene, an inlA gene, and inlB gene, an inlC gene, inlJ gene, a plbC gene, a bsh gene, or a prfA gene. It is to be understood by a skilled artisan, that the virulence gene can be any gene known in the art to be associated with virulence in the recombinant Listeria. [00140] In yet another embodiment the Listeria strain is an inlA mutant, an inlB mutant, an inlC mutant, an inlJ mutant, prfA mutant, actA mutant, a dalldat mutant, a plcB deletion mutant, or a double mutant lacking both plcA and plcB.
- the Listeria comprises a deletion or mutation of these genes individually or in combination.
- the Listeria disclosed herein lack each one of genes.
- the Listeria disclosed herein lack at least one and up to ten of any gene disclosed herein, including the actA, prfA, and dalldat genes.
- the prfA mutant is a D 133V prfA mutant.
- the live attenuated Listeria is a recombinant Listeria.
- the recombinant Listeria comprises a mutation or a deletion of a genomic internalin C (inlC) gene.
- the recombinant Listeria comprises a mutation or a deletion of a genomic actA gene and a genomic internalin C gene.
- translocation of Listeria to adjacent cells is inhibited by the deletion of the actA gene and/or the inlC gene, which are involved in the process, thereby resulting in unexpectedly high levels of attenuation with increased immunogenicity and utility as a vaccine backbone.
- the metabolic gene, the virulence gene, etc. is lacking in a chromosome of the Listeria strain. In another embodiment, the metabolic gene, virulence gene, etc. is lacking in the genome of the Listeria strain. In one embodiment, the virulence gene is mutated in the chromosome. In another embodiment, the virulence gene is deleted from the chromosome. In another embodiment, the virulence gene is inactivated in the chromosome.
- the recombinant Listeria strain disclosed herein is attenuated. In another embodiment, the recombinant Listeria lacks the actA virulence gene. In another embodiment, the recombinant Listeria lacks the prfA virulence gene. In another embodiment, the recombinant Listeria lacks the inlB gene. In another embodiment, the recombinant Listeria lacks both, the actA and inlB genes. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous actA gene. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous inlB gene.
- the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous inlC gene. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous actA and inlB genes. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous actA and inlC genes. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous actA, inlB, and inlC genes. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous actA, MB, and inlC genes.
- the recombinant Listeria strains disclosed herein comprise an inactivating mutation of the endogenous actA, inlB, and inlC genes. In another embodiment, the recombinant Listeria strains disclosed herein comprise an inactivating mutation in any single gene or combination of the following genes: actA, dal, dat, inlB, inlC, prfA, plcA, plcB.
- the term "lacks" when in reference to a genomic virulence gene means that the virulence gene is either deleted (partial or whole deletion) or is otherwise not functionally expressed from the chromosome. Such a term may also encompass a partial deletion or a whole gene deletion of the virulence gene in the chromosome.
- mutants include any type of mutation or modification to the sequence (nucleic acid or amino acid sequence), and includes an amino acid deletion mutation, a substitution, a replacement, a truncation, an inactivation, a disruption, or a translocation. These types of mutations are readily known in the art.
- auxotrophic bacteria comprising a plasmid encoding a metabolic enzyme or a complementing gene disclosed herein
- transformed auxotrophic bacteria are grown on a media that will select for expression of the amino acid metabolism gene or the complementing gene.
- a bacteria auxotrophic for D-glutamic acid synthesis is transformed with a plasmid comprising a gene for D-glutamic acid synthesis, and the auxotrophic bacteria will grow in the absence of D-glutamic acid, whereas auxotrophic bacteria that have not been transformed with the plasmid, or are not expressing the plasmid encoding a protein for D-glutamic acid synthesis, will not grow.
- a bacterium auxotrophic for D- alanine synthesis will grow in the absence of D-alanine when transformed and expressing the plasmid of the present disclosure if the plasmid comprises an isolated nucleic acid encoding an amino acid metabolism enzyme for D-alanine synthesis.
- Such methods for making appropriate media comprising or lacking necessary growth factors, supplements, amino acids, vitamins, antibiotics, and the like are well known in the art, and are available commercially (Becton- Dickinson, Franklin Lakes, NJ).
- the bacteria are propagated in the presence of a selective pressure. Such propagation comprises growing the bacteria in media without the auxotrophic factor.
- the presence of the plasmid expressing an amino acid metabolism enzyme in the auxotrophic bacteria ensures that the plasmid will replicate along with the bacteria, thus continually selecting for bacteria harboring the plasmid.
- the skilled artisan when equipped with the present disclosure and methods herein will be readily able to scale-up the production of the Listeria vaccine vector by adjusting the volume of the media in which the auxotrophic bacteria comprising the plasmid are growing.
- auxotroph strains and complementation systems are adopted for the use with this invention.
- the recombinant Listeria strain disclosed herein expresses the chimeric protein disclosed herein.
- the recombinant Listeria strain comprises a plasmid that encodes the chimeric protein.
- a recombinant nucleic acid disclosed herein is in a plasmid in the recombinant Listeria strain disclosed herein.
- the plasmid is an episomal plasmid that does not integrate into the recombinant Listeria strain's chromosome.
- the plasmid is a multicopy plasmid.
- the plasmid is an integrative plasmid that integrates into the Listeria strain's chromosome.
- the recombinant Listeria strain as disclosed herein comprises a nucleic acid molecule encoding a tumor associated peptide.
- a recombinant Listeria strain of the methods and compositions as disclosed herein comprise a nucleic acid molecule operably integrated into the Listeria genome as an open reading frame with an endogenous ActA sequence.
- a recombinant Listeria strain of the methods and compositions as disclosed herein comprise an episomal expression vector comprising a nucleic acid molecule encoding a chimeric protein comprising an peptide antigen fused on the Amino-terminus to an ubiquitin protein.
- the expression and secretion of the peptide antigen is under the control of an actA promoter and ActA signal sequence and it is expressed as fusion to 1-233 amino acids of ActA (truncated ActA or tActA).
- the expression and secretion of the peptide antigen is under the control of an actA promoter and ActA signal sequence and it is expressed as fusion to 1-100 amino acids of ActA (truncated ActA or tActA).
- the expression and secretion of the peptide antigen is under the control of an actA promoter and ActA signal sequence and it is expressed as fusion to 1-300 amino acids of ActA (truncated ActA or tActA).
- the truncated ActA consists of the first 390 amino acids of the wild type ActA protein as described in US Patent Serial No. 7,655,238, which is incorporated by reference herein in its entirety.
- the truncated ActA is an ActA-NlOO or a modified version thereof (referred to as ActA-NlOO*) in which a PEST motif has been deleted and containing the nonconservative QDNKR substitution as described in US Patent Publication Serial No. 2014/0186387.
- a recombinant Listeria strain of the methods and compositions as disclosed herein comprise a nucleic acid molecule operably integrated into the Listeria genome as an open reading frame with an endogenous LLO sequence.
- a recombinant Listeria strain of the methods and compositions as disclosed herein comprise an episomal expression vector comprising a nucleic acid molecule encoding a chimeric protein comprising an peptide antigen fused on the Amino-terminus to an ubiquitin protein.
- the expression and secretion of the peptide antigen is under the control of an LLO promoter and LLO signal sequence and it is expressed as fusion to 1-50 amino acids of LLO (truncated LLO or tLLO).
- the expression and secretion of the peptide antigen is under the control of an LLO promoter and LLO signal sequence and it is expressed as fusion to 1-100 amino acids of LLO (truncated LLO or tLLO).
- the expression and secretion of the peptide antigen is under the control of an LLO promoter and LLO signal sequence and it is expressed as fusion to 1-300 amino acids of LLO (truncated LLO or tLLO).
- the truncated LLO consists of the first 420 amino acids of the wild type LLO.
- no CTL activity is detected in naive animals or mice injected with an irrelevant Listeria vaccine.
- the attenuated auxotrophic strain expressing a chimeric protein disclosed herein is able to stimulate the secretion of IFN- ⁇ and elicit an anti-tumor immune response.
- Listeria strain exerts strong and antigen specific anti-tumor responses with ability to break tolerance toward a peptide antigen.
- the dal/dat/actA strain is highly attenuated and has a better safety profile than previous Listeria vaccine generation, as it is more rapidly cleared from the spleens of the immunized mice.
- the Listeria strain causes a significant decrease in intratumoral T regulatory cells (Tregs).
- the lower frequency of Tregs in tumors treated with LmddA vaccines result in an increased intratumoral CD8/Tregs ratio, suggesting that a more favorable tumor microenvironment can be obtained after immunization with LmddA vaccines.
- peptide antigen is used interchangeably with the following terms, "antigen,” “antigen fragment,” “antigenic peptide,” or “antigen peptide.” It will be understood by a skilled artisan that the term “peptide antigen” encompasses a heterologous antigen or fragment thereof capable of eliciting an immune response when presented in the context of a major histocompatibility complex (MHC) molecule to an antigen presenting cell (APC).
- MHC major histocompatibility complex
- API antigen presenting cell
- Protein and/or peptide homology for any amino acid sequence listed herein is determined, in one embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of amino acid sequences, utilizing any of a number of software packages available, via established methods. Some of these packages may include the FASTA, BLAST, MPsrch or Scanps packages, and may employ the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example.
- the construct or nucleic acid molecule disclosed herein is integrated into the Listeria chromosome using homologous recombination.
- Techniques for homologous recombination are well known in the art, and are described, for example, in Baloglu S, Boyle SM, et al. (Immune responses of mice to vaccinia virus recombinants expressing either Listeria monocytogenes partial listeriolysin or Brucella abortus ribosomal L7/L12 protein. Vet Microbiol 2005, 109(1-2): 11-7); and Jiang LL, Song HH, et al., (Characterization of a mutant Listeria monocytogenes strain expressing green fluorescent protein.
- homologous recombination is performed as described in United States Patent No. 6,855,320.
- a recombinant Lm strain that expresses E7 was made by chromosomal integration of the E7 gene under the control of the hly promoter and with the inclusion of the hly signal sequence to ensure secretion of the gene product, yielding the recombinant referred to as Lm-AZ/E7.
- a temperature sensitive plasmid is used to select the recombinants.
- the construct or nucleic acid molecule is integrated into the Listerial chromosome using transposon insertion.
- Techniques for transposon insertion are well known in the art, and are described, inter alia, by Sun et al. (Infection and Immunity 1990, 58: 3770- 3778) in the construction of DP-L967.
- Transposon mutagenesis has the advantage, in another embodiment, that a stable genomic insertion mutant can be formed but the disadvantage that the position in the genome where the foreign gene has been inserted is unknown.
- the construct or nucleic acid molecule is integrated into the Listerial chromosome using phage integration sites (Lauer P, Chow MY et al, Construction, characterization, and use of two Listeria monocytogenes site-specific phage integration vectors. J Bacterid 2002; 184(15): 4177-86).
- an integrase gene and attachment site of a bacteriophage e.g. U153 or PSA listeriophage
- the heterologous gene into the corresponding attachment site, which may be any appropriate site in the genome (e.g. comK or the 3' end of the arg tRNA gene).
- the present disclosure further comprises a phage based chromosomal integration system for clinical applications, where a host strain that is auxotrophic for essential enzymes, including, but not limited to, d-alanine racemase can be used, for example Lmdal(-)dat(-).
- a phage integration system based on PSA is used. This requires, in another embodiment, continuous selection by antibiotics to maintain the integrated gene.
- the current disclosure enables the establishment of a phage based chromosomal integration system that does not require selection with antibiotics. Instead, an auxotrophic host strain can be complemented.
- the term "recombination site” or “site- specific recombination site” refers to a sequence of bases in a nucleic acid molecule that is recognized by a recombinase (along with associated proteins, in some cases) that mediates exchange or excision of the nucleic acid segments flanking the recombination sites.
- the recombinases and associated proteins are collectively referred to as “recombination proteins” see, e.g., Landy, A., (Current Opinion in Genetics & Development) 3:699-707; 1993).
- the term "vector” may encompass plasmids.
- the term refers to an integration vector capable of being transformed into the Listeria host and being incorporated in the Listeria's chromosome in a manner that allows expression of the genes comprised by said vector.
- the term refers to a non-integration vector that does not integrate in the Listeria's chromosome but instead is present in the cytoplasm of said Listeria.
- the term refers to a plasmid comprising an integration vector.
- the integration vector is a site- specific integration vector.
- transcriptional promoters e.g. those in commercially available cloning vectors
- these functionalities are provided in, for example, the commercially available vectors known as the pUC series.
- non-essential DNA sequences e.g. antibiotic resistance genes
- a commercially available plasmid is used in the present invention.
- Such plasmids are available from a variety of sources, for example, Invitrogen (La Jolla, CA), Stratagene (La Jolla, CA), Clontech (Palo Alto, CA), or can be constructed using methods well known in the art.
- plasmid such as pCR2.1 (Invitrogen, La Jolla, CA), which is a prokaryotic expression vector with a prokaryotic origin of replication and promoter/regulatory elements to facilitate expression in a prokaryotic organism.
- extraneous nucleotide sequences are removed to decrease the size of the plasmid and increase the size of the cassette that can be placed therein.
- Antibiotic resistance genes are used in the conventional selection and cloning processes commonly employed in molecular biology and vaccine preparation.
- Antibiotic resistance genes contemplated in the present disclosure include, but are not limited to, gene products that confer resistance to ampicillin, penicillin, methicillin, streptomycin, erythromycin, kanamycin, tetracycline, cloramphenicol (CAT), neomycin, hygromycin, gentamicin and others well known in the art.
- Plasmids and other expression vectors useful in the present disclosure are described elsewhere herein, and can include such features as a promoter/regulatory sequence, an origin of replication for gram negative and gram positive bacteria, an isolated nucleic acid encoding a fusion protein and an isolated nucleic acid encoding an amino acid metabolism gene. Further, an isolated nucleic acid encoding a fusion protein and an amino acid metabolism gene will have a promoter suitable for driving expression of such an isolated nucleic acid.
- Promoters useful for driving expression in a bacterial system include bacteriophage lambda, the bla promoter of the beta-lactamase gene of pBR322, and the CAT promoter of the chloramphenicol acetyl transferase gene of pBR325.
- prokaryotic promoters include the major right and left promoters of 5 bacteriophage lambda (PL and PR), the trp, recA, lacZ, lad, and gal promoters of E. coli, the alpha-amylase (Ulmanen et al, 1985. J. Bacterid. 162:176-182) and the S28-specific promoters of B.
- subtilis (Gilman et al, 1984 Gene 32: 11- 20), the promoters of the bacteriophages of Bacillus (Gryczan, 1982, In: The Molecular Biology of the Bacilli, Academic Press, Inc., New York), and Streptomyces promoters (Ward et al, 1986, Mol. Gen. Genet. 203:468- 478). Additional prokaryotic promoters contemplated in the present disclosure are reviewed in, for example, Glick (1987, J. Ind. Microbiol. 1:277-282); Cenatiempo, (1986, Biochimie, 68:505-516); and Gottesman, (1984, Ann. Rev. Genet. 18:415-442).
- promoter/regulatory elements contemplated in the present disclosure include, but are not limited to the Listerial prfA promoter, the Listerial hly promoter, the Listerial p60 promoter and the Listerial ActA promoter (GenBank Acc. No. NC_003210) or fragments thereof.
- a plasmid of methods and compositions of the comprise subsequences that are cleaved and the appropriate subsequences cloned using appropriate restriction enzymes. The fragments are then, in another embodiment, ligated to produce the desired DNA sequence.
- DNA encoding the antigen is produced using DNA amplification methods, for example polymerase chain reaction (PCR), a technique that is well known in the art.
- PCR polymerase chain reaction
- a "phage expression vector” or “phagemid” refers to any phage-based recombinant expression system for the purpose of expressing a nucleic acid sequence of the methods and compositions as disclosed herein in vitro or in vivo, constitutively or inducibly, in any cell, including prokaryotic, yeast, fungal, plant, insect or mammalian cell.
- a phage expression vector typically can both reproduce in a bacterial cell and, under proper conditions, produce phage particles.
- the term includes linear or circular expression systems and encompasses both phage-based expression vectors that remain episomal or integrate into the host cell genome.
- the present disclosure further comprises a phage based chromosomal integration system for clinical applications.
- a host strain that is auxotrophic for essential enzymes including, but not limited to, d-alanine racemase will be used, for example Lmdal(-)dat(-).
- a phage integration system based on PSA is used (Lauer, et al., 2002 J Bacterid, 184:4177-4186). This requires, in another embodiment, continuous selection by antibiotics to maintain the integrated gene.
- the current disclosure enables the establishment of a phage based chromosomal integration system that does not require selection with antibiotics. Instead, an auxotrophic host strain will be complemented.
- the chimeric proteins of the present disclosure are synthesized, in another embodiment, using recombinant DNA methodology. This involves, in one embodiment, creating a DNA sequence that encodes the chimeric protein, placing the DNA in an expression cassette, such as the plasmid of the present invention, under the control of a particular promoter/regulatory element, and expressing the protein.
- DNA encoding the chimeric protein (e.g. SS-Ub-peptide) of the present disclosure is prepared, in another embodiment, by any suitable method, including, for example, cloning and restriction of appropriate sequences or direct chemical synthesis by methods such as the phosphotriester method of Narang et al. (1979, Meth. Enzymol.
- DNA encoding the chimeric protein or the recombinant protein of the present disclosure is cloned using DNA amplification methods such as polymerase chain reaction (PCR).
- DNA amplification methods such as polymerase chain reaction (PCR).
- chemical synthesis is used to produce a single stranded oligonucleotide. This single stranded oligonucleotide is converted, in various embodiments, into double stranded DNA by hybridization with a complementary sequence, or by polymerization with a DNA polymerase using the single strand as a template.
- PCR polymerase chain reaction
- nucleic acid sequences encoding chimeric proteins disclosed herein are transformed into a variety of host cells, including E. coli, other bacterial hosts, such as Listeria, yeast, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines. Nucleic acid sequences encoding a chimeric protein disclosed herein are operably linked to appropriate expression control sequences for each host. Promoter/ regulatory sequences are described in detail elsewhere herein.
- the plasmid encoding a chimeric protein disclosed herein further comprises additional promoter regulatory elements, as well as a ribosome binding site and a transcription termination signal.
- control sequences will include a promoter and an enhancer derived from e.g. immunoglobulin genes, SV40, cytomegalovirus, etc., and a polyadenylation sequence.
- sequences include splice donor and acceptor sequences.
- a plasmid disclosed herein comprises at least one ribosome binding site and at least one transcription termination signals that allow encoding of at least one chimeric protein as disclosed herein, each comprising a different peptide antigen.
- the plasmid disclosed herein comprises 1 to 4 ribosome binding ribosome binding sites and 1 to 4 transcription termination signals that allow encoding of 1 to 4 chimeric proteins as disclosed herein, each comprising a different peptide antigen.
- the plasmid disclosed herein comprises 5 to 10 ribosome binding ribosome binding sites and 5 to 10 transcription termination signals that allow encoding of 5 to 10 chimeric proteins as disclosed herein, each comprising a different peptide antigen.
- the plasmid disclosed herein comprises 11 to 20 ribosome binding ribosome binding sites and 11 to 20 transcription termination signals that allow encoding of 11 to 20 chimeric proteins as disclosed herein, each comprising a different peptide antigen.
- the plasmid disclosed herein comprises 21 to 30 ribosome binding ribosome binding sites and 21 to 30 transcription termination signals that allow encoding of 21 to 30 chimeric proteins as disclosed herein, each comprising a different peptide antigen.
- the ribosome binding sites are shine dalgarno ribosome binding sites.
- the term "operably linked” means that the transcriptional and translational regulatory nucleic acid, is positioned relative to any coding sequences in such a manner that transcription is initiated. Generally, this will mean that the promoter and transcriptional initiation or start sequences are positioned 5' to the coding region.
- the term “operably linked” refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. A control sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
- the term “operably linked” refers to the joining of several open reading frames in a transcription unit each encoding a protein or peptide so as to result in expression of a chimeric protein or polypeptide that functions as intended.
- an "open reading frame” or “ORF” is a portion of an organism's genome which contains a sequence of bases that could potentially encode a protein.
- the start and stop ends of the ORF are not equivalent to the ends of the mRNA, but they are usually contained within the mRNA.
- ORFs are located between the start-code sequence (initiation codon) and the stop-codon sequence (termination codon) of a gene.
- a nucleic acid molecule operably integrated into a genome as an open reading frame with an endogenous polypeptide is a nucleic acid molecule that has integrated into a genome in the same open reading frame as an endogenous polypeptide.
- the present disclosure provides a fusion polypeptide comprising a linker sequence.
- a linker sequence may encompass an amino acid sequence that joins two heterologous polypeptides, or fragments or domains thereof.
- a linker is an amino acid sequence that covalently links the polypeptides to form a fusion polypeptide.
- a linker typically includes the amino acids translated from the remaining recombination signal after removal of a reporter gene from a display vector to create a fusion protein comprising an amino acid sequence encoded by an open reading frame and the display protein.
- the linker can comprise additional amino acids, such as glycine and other small neutral amino acids.
- endogenous describes an item that has developed or originated within the reference organism or arisen from causes within the reference organism.
- endogenous refers to native.
- Recombinant or chimeric proteins disclosed herein may be prepared by any suitable method, including, for example, cloning and restriction of appropriate sequences or direct chemical synthesis by methods discussed below. Alternatively, subsequences may be cloned and the appropriate subsequences cleaved using appropriate restriction enzymes. The fragments may then be ligated to produce the desired DNA sequence.
- DNA encoding the antigen can be produced using DNA amplification methods, for example polymerase chain reaction (PCR). First, the segments of the native DNA on either side of the new terminus are amplified separately.
- the 5' end of the one amplified sequence encodes the peptide linker, while the 3' end of the other amplified sequence also encodes the peptide linker. Since the 5' end of the first fragment is complementary to the 3' end of the second fragment, the two fragments (after partial purification, e.g. on LMP agarose) can be used as an overlapping template in a third PCR reaction.
- the amplified sequence will contain codons, the segment on the carboxy side of the opening site (now forming the amino sequence), the linker, and the sequence on the amino side of the opening site (now forming the carboxyl sequence).
- the antigen is ligated into a plasmid.
- “Stably maintained” refers to maintenance of a nucleic acid molecule or plasmid in the absence of selection (e.g. antibiotic selection) for 10 generations, without detectable loss.
- the period is 15 generations.
- the period is 20 generations.
- the period is 25 generations.
- the period is 30 generations.
- the period is 40 generations.
- the period is 50 generations.
- the period is 60 generations.
- the period is 80 generations.
- the period is 100 generations.
- the period is 150 generations.
- the period is 200 generations.
- the period is 300 generations.
- the period is 500 generations.
- the period is more than generations.
- the nucleic acid molecule or plasmid is maintained stably in vitro (e.g. in culture). In another embodiment, the nucleic acid molecule or plasmid is maintained stably in vivo. In another embodiment, the nucleic acid molecule or plasmid is maintained stably both in vitro and in vitro.
- a “functional fragment” is an immunogenic fragment and elicits an immune response when administered to a subject alone or in a therapeutic composition disclosed herein.
- a functional fragment has biological activity as will be understood by a skilled artisan and as further disclosed herein.
- the term “functional fragment” is used interchangeably with the term “immunogenic fragment”
- immunogenic or grammatical equivalents thereof may refer to an innate ability of a protein, peptide, nucleic acid, antigen or organism to elicit an immune response in a human or non-human animal when the protein, peptide, nucleic acid, antigen or organism is administered to the animal.
- enhancing the immunogenicity may refer to increasing the ability of a protein, peptide, nucleic acid, antigen or organism to elicit an immune response in an animal when the protein, peptide, nucleic acid, antigen or organism is administered to an animal.
- the increased ability of a protein, peptide, nucleic acid, antigen or organism to elicit an immune response can be measured by, in one embodiment, a greater number of antibodies to a protein, peptide, nucleic acid, antigen or organism, a greater diversity of antibodies to an antigen or organism, a greater number of T-cells specific for a protein, peptide, nucleic acid, antigen or organism, a greater cytotoxic or helper T-cell response to a protein, peptide, nucleic acid, antigen or organism, and the like.
- the recombinant Listeria strain of methods and compositions of the present disclosure is, in another embodiment, a recombinant Listeria monocytogenes strain.
- the Listeria strain is a recombinant Listeria seeligeri strain.
- the Listeria strain is a recombinant Listeria grayi strain.
- the Listeria strain is a recombinant Listeria ivanovii strain.
- the Listeria strain is a recombinant Listeria murrayi strain.
- the Listeria strain is a recombinant Listeria welshimeri strain.
- the Listeria strain is a recombinant strain of another Listeria species.
- Attenuated Listeria strains such as LM delta-actA mutant (Brundage et al, 1993, Proc. Natl. Acad. Sci., USA, 90:11890-11894), L. monocytogenes delta-plcA (CamiUi et al, 1991, J. Exp. Med., 173:751-754), or delta-ActA, delta INL-b (Brockstedt et 5 al, 2004, PNAS, 101:13832-13837) are used in the present invention.
- attenuated Listeria strains are constructed by introducing one or more attenuating mutations, as will be understood by one of average skill in the art when equipped with the disclosure herein.
- strains include, but are not limited to Listeria strains auxotrophic for aromatic amino acids (Alexander et al, 1993, Infection and Immunity 10 61:2245-2248) and mutant for the formation of lipoteichoic acids (Abachin et al, 2002, Mol. Microbiol. 43:1-14) and those attenuated by a lack of a virulence gene (see examples herein).
- a recombinant Listeria strain of the present disclosure has been passaged through an animal host.
- the passaging maximizes efficacy of the strain as a vaccine vector.
- the passaging stabilizes the immunogenicity of the Listeria strain.
- the passaging stabilizes the virulence of the Listeria strain.
- the passaging increases the immunogenicity of the Listeria strain.
- the passaging increases the virulence of the Listeria strain.
- the passaging removes unstable sub-strains of the Listeria strain.
- the passaging reduces the prevalence of unstable sub-strains of the Listeria strain.
- the passaging is performed as described herein. In another embodiment, the passaging is performed by other methods known in the art.
- a Listeria strain contains a genomic insertion of a minigene nucleic acid construct disclosed herein.
- a Listeria strain carries a plasmid comprising a minigene nucleic acid construct disclosed herein.
- a recombinant nucleic acid of the present disclosure is operably linked to a promoter/regulatory sequence that drives expression of the encoded peptide in the Listeria strain.
- Promoter/regulatory sequences useful for driving constitutive expression of a gene are well known in the art and include, but are not limited to, for example, the Phi y A, PActA, and p60 promoters of Listeria, the Streptococcus bac promoter, the Streptomyces griseus sgiA promoter, and the B. thuringiensis phaZ promoter.
- inducible and tissue specific expression of the nucleic acid encoding a peptide of the present disclosure is accomplished by placing the nucleic acid encoding the peptide under the control of an inducible or tissue specific promoter/regulatory sequence.
- tissue specific or inducible promoter/regulatory sequences which are useful for his purpose include, but are not limited to the MMTV LTR inducible promoter, and the SV40 late enhancer/promoter.
- a promoter that is induced in response to inducing agents such as metals, glucocorticoids, and the like, is utilized.
- the disclosure includes the use of any promoter/regulatory sequence, which is either known or unknown, and which is capable of driving expression of the desired protein operably linked thereto.
- heterologous encompasses a nucleic acid, amino acid, peptide, polypeptide, peptide or protein derived from a different species than the reference species.
- a Listeria strain expressing a heterologous polypeptide in one embodiment, would express a polypeptide that is not native or endogenous to the Listeria strain, or in another embodiment, a polypeptide that is not normally expressed by the Listeria strain, or in another embodiment, a polypeptide from a source other than the Listeria strain.
- heterologous may be used to describe something derived from a different organism within the same species.
- an episomal expression vector encompasses a nucleic acid vector which may be linear or circular, and which is usually double- stranded in form and is extrachromosomal in that it is present in the cytoplasm of a host bacteria or cell as opposed to being integrated into the bacteria's or cell's genome.
- an episomal expression vector comprises a gene of interest.
- episomal vectors persist in multiple copies in the bacterial cytoplasm, resulting in amplification of the gene of interest, which in one embodiment is a nucleic acid molecule or construct disclosed herein.
- viral trans-acting factors are supplied when necessary.
- An episomal expression vector may be referred to as a plasmid herein.
- An "integrative plasmid" comprises sequences that target its insertion or the insertion of the gene of interest carried within into a host genome.
- an inserted gene of interest is not interrupted or subjected to regulatory constraints which often occur from integration into cellular DNA.
- the presence of the inserted heterologous gene does not lead to rearrangement or interruption of the cell's own important regions.
- the episomal expression vectors of the methods and compositions as disclosed herein may be delivered to cells in vivo, ex vivo, or in vitro by any of a variety of the methods employed to deliver DNA molecules to cells.
- the vectors may also be delivered alone or in the form of a pharmaceutical composition that enhances delivery to cells of a subject.
- fused may encompass operable linkage by covalent bonding.
- the term encompasses recombinant fusion (of nucleic acid sequences or open reading frames thereof).
- the term encompasses chemical conjugation.
- Transforming may encompass engineering a bacterial cell to take up a plasmid or other heterologous DNA molecule. “Transforming” may also refer to engineering a bacterial cell to express a gene of a plasmid or other heterologous DNA molecule.
- Methods for transforming bacteria are well known in the art, and include calcium-chloride competent cell-based methods, electroporation methods, bacteriophage-mediated transduction, chemical, and physical transformation techniques (de Boer et al, 1989, Cell 56:641-649; Miller et al, 1995, FASEB J., 9: 190-199; Sambrook et al.
- the Listeria vaccine strain of the present disclosure is transformed by electroporation.
- conjugation is used to introduce genetic material and/or plasmids into bacteria.
- Methods for conjugation are well known in the art, and are described, for example, in Nikodinovic J. et al (A second generation snp-derived Escherichia coli-Streptomyces shuttle expression vector that is generally transferable by conjugation. Plasmid. 2006 Nov;56(3):223-7) and Auchtung JM et al (Regulation of a Bacillus subtilis mobile genetic element by intercellular signaling and the global DNA damage response. Proc Natl Acad Sci U S A. 2005 Aug 30; 102(35): 12554-9).
- Attenuation may encompass a diminution in the ability of the bacterium to cause disease in an animal.
- pathogenic characteristics of the attenuated Listeria strain have been lessened compared with wild- type Listeria, although the attenuated Listeria is capable of growth and maintenance in culture.
- the lethal dose at which 50% of inoculated animals survive is preferably increased above the LD 50 of wild-type Listeria by at least about 10-fold, more preferably by at least about 100-fold, more preferably at least about 1,000 fold, even more preferably at least about 10,000 fold, and most preferably at least about 100,000-fold.
- An attenuated strain of Listeria is thus one which does not kill an animal to which it is administered, or is one which kills the animal only when the number of bacteria administered is vastly greater than the number of wild type non-attenuated bacteria which would be required to kill the same animal.
- An attenuated bacterium should also be construed to mean one which is incapable of replication in the general environment because the nutrient required for its growth is not present therein. Thus, the bacterium is limited to replication in a controlled environment wherein the required nutrient is provided.
- the attenuated strains of the present disclosure are therefore environmentally safe in that they are incapable of uncontrolled replication.
- a pharmaceutical composition comprising a recombinant Listeria comprising a minigene nucleic acid construct encoding achimeric protein disclosed hereinand wherein administering the pharmaceutical composition to a subject having a disease, including a cancer, treats, ameliorates, said disease or said cancer.
- a pharmaceutical composition comprising the minigene nucleic acid construct encoding the chimeric protein disclosed herein.
- the pharmaceutical composition is administered with an adjuvant.
- compositions of the present disclosure are immunogenic compositions.
- compositions of the present disclosure induce a strong innate stimulation of interferon-gamma, which in one embodiment, has anti-angiogenic properties.
- a Listeria of the present disclosure induces a strong innate stimulation of interferon- gamma, which in one embodiment, has anti-angiogenic properties (Dominiecki et al., Cancer Immunol Immunother. 2005 May;54(5):477-88. Epub 2004 Oct 6, incorporated herein by reference in its entirety; Beatty and Paterson, J. Immunol. 2001 Feb 15;166(4):2276-82, incorporated herein by reference in its entirety).
- anti-angiogenic properties of Listeria are mediated by CD4 + T cells (Beatty and Paterson, 2001). In another embodiment, anti-angiogenic properties of Listeria are mediated by CD8 + T cells. In another embodiment, IFN-gamma secretion as a result of Listeria vaccination is mediated by NK cells, NKT cells, Thl CD4 + T cells, TCI CD8 + T cells, or a combination thereof.
- compositions of the present disclosure induces production of one or more anti-angiogenic proteins or factors.
- the anti- angiogenic protein is IFN-gamma.
- the anti-angiogenic protein is pigment epithelium-derived factor (PEDF); angiostatin; endostatin; fms-like tyrosine kinase (sFlt)-l; or soluble endoglin (sEng).
- PEDF pigment epithelium-derived factor
- angiostatin angiostatin
- endostatin endostatin
- sFlt fms-like tyrosine kinase
- sEng soluble endoglin
- a Listeria of the present disclosure is involved in the release of anti-angiogenic factors, and, therefore, in one embodiment, has a therapeutic role in addition to its role as a vector for introducing an antigen to a subject.
- administration of the compositions of the present disclosure stimulates a Stimulator of Interfer
- the immune response induced by methods and compositions as disclosed herein is, in another embodiment, a T cell response.
- the immune response comprises a T cell response.
- the response is a CD8+ T cell response.
- the response comprises a CD8 + T cell response.
- the immune response elicited by methods and compositions of the present disclosure comprises a CD8 + T cell-mediated response.
- the immune response consists primarily of a CD8 + T cell-mediated response.
- the only detectable component of the immune response is a CD8 + T cell-mediated response.
- the immune response elicited by methods and compositions disclosed herein comprises a CD4 + T cell-mediated response.
- the immune response consists primarily of a CD4 + T cell-mediated response.
- the only detectable component of the immune response is a CD4 + T cell-mediated response.
- the CD4 + T cell-mediated response is accompanied by a measurable antibody response against the antigen.
- the CD4 + T cell-mediated response is not accompanied by a measurable antibody response against the antigen.
- the present disclosure provides a method of inducing a CD8 + T cell-mediated immune response in a subject against a subdominant CD8 + T cell epitope of an antigen.
- a method of increasing intratumoral ratio of CD8+/T regulatory cells comprising the step of administering to the subject a composition comprising the chimeric protein, recombinant Listeria, or recombinant vector of the present invention.
- a method of increasing intratumoral ratio of CD8+/T regulatory cells comprising the step of administering to the subject a composition comprising the chimeric protein, recombinant Listeria, or recombinant vector of the present invention.
- the immune response elicited by the methods and compositions disclosed herein comprises an immune response to at least one subdominant epitope of the native antigen.
- the immune response does not comprise an immune response to a subdominant epitope.
- the immune response consists primarily of an immune response to at least one subdominant epitope.
- the only measurable component of the immune response is an immune response to at least one subdominant epitope.
- compositions of the present disclosure increase the number of antigen-specific T cells.
- administration of compositions activates co-stimulatory receptors on T cells.
- administration of compositions induces proliferation of memory and/or effector T cells.
- administration of compositions increases proliferation of T cells.
- compositions of this disclosure may be used in methods of this disclosure in order to elicit an enhanced anti-tumor T cell response in a subject, in order to inhibit tumor-mediated immunosuppression in a subject, or for increasing the ratio or T effector cells to regulatory T cells (T regs ) in the spleen and tumor of a subject, or any combination thereof.
- T regs regulatory T cells
- a composition comprising a Listeria strain of the present invention further comprises an adjuvant.
- a composition of the present disclosure further comprises an adjuvant.
- the adjuvant utilized in methods and compositions of the present disclosure is, in another embodiment, a granulocyte/macrophage colony- stimulating factor (GM-CSF) protein.
- the adjuvant comprises a GM-CSF protein.
- the adjuvant is a nucleotide molecule encoding GM-CSF.
- the adjuvant comprises a nucleotide molecule encoding GM-CSF.
- the adjuvant is saponin QS21.
- the adjuvant comprises saponin QS21. In another embodiment, the adjuvant is monophosphoryl lipid A. In another embodiment, the adjuvant comprises monophosphoryl lipid A. In another embodiment, the adjuvant is SBAS2. In another embodiment, the adjuvant comprises SBAS2. In another embodiment, the adjuvant is an unmethylated CpG-containing oligonucleotide. In another embodiment, the adjuvant comprises an unmethylated CpG-containing oligonucleotide. In another embodiment, the adjuvant is an immune- stimulating cytokine. In another embodiment, the adjuvant comprises an immune- stimulating cytokine. In another embodiment, the adjuvant is a nucleotide molecule encoding an immune- stimulating cytokine.
- the adjuvant comprises a nucleotide molecule encoding an immune- stimulating cytokine. In another embodiment, the adjuvant is or comprises a quill glycoside. In another embodiment, the adjuvant is or comprises a bacterial mitogen. In another embodiment, the adjuvant is or comprises a bacterial toxin. Other adjuvants are known in the art.
- the present disclosure provides a recombinant Listeria strain expressing the peptide antigen.
- the present disclosure provides vaccines and immunogenic compositions comprising the recombinant Listeria disclosed herein.
- the present disclosure provides pharmaceutical compositions comprising the recombinant Listeria disclosed herein.
- an immunogenic composition of this disclosure comprises a recombinant Listeria strain comprising a nucleic acid molecule encoding the chimeric protein disclosed herein.
- an additional polypeptide or an additional adjuvant polypeptide augments antigen presentation and immunity in a similar fashion to LLO.
- the pharmaceutical compositions disclosed herein are coadministered with an additional therapy.
- the additional therapy is surgery, chemotherapy, radiotherapy, an immunotherapy or a combination thereof.
- the additional therapy precedes administration of the pharmaceutical composition comprising the recombinant Listeria.
- the additional therapy follows administration of the pharmaceutical composition comprising the recombinant Listeria.
- the additional therapy is an antibody therapy.
- the antibody therapy is an anti- PD1, anti-CTLA4.
- the pharmaceutical composition comprising the recombinant Listeria is administered in increasing doses in order to increase the T-effector cell to regulatory T cell ration and generate a more potent anti-tumor immune response.
- the anti-tumor immune response can be further strengthened by providing the subject having a tumor with cytokines including, but not limited to IFN- ⁇ , TNF-a, and other cytokines known in the art to enhance cellular immune response, some of which can be found in US Patent Serial No. 6,991,785, incorporated by reference herein.
- cytokines including, but not limited to IFN- ⁇ , TNF-a, and other cytokines known in the art to enhance cellular immune response, some of which can be found in US Patent Serial No. 6,991,785, incorporated by reference herein.
- a vaccine comprising a recombinant Listeria of the present invention.
- a vaccine comprising a recombinant attenuated Listeria expressing a minigene construct of the present invention.
- a pharmaceutical composition comprising a recombinant Listeria of the present invention.
- a pharmaceutical composition comprising a recombinant attenuated Listeria expressing a minigene construct of the present invention.
- an immunogenic composition comprising a recombinant polypeptide or a nucleic acid construct encoding the same or a recombinant Listeria encoding the nucleic acid construct of the present invention.
- composition comprising a nucleotide molecule or recombinant polypeptide of the present invention.
- a vector comprising a nucleotide molecule or recombinant polypeptide of the present invention.
- a vaccine comprising a recombinant form of Listeria of the present invention.
- a pharmaceutical composition comprising a recombinant form of Listeria of the present invention.
- the Listeria of methods and compositions of the present disclosure is Listeria monocytogenes.
- the Listeria is Listeria ivanovii.
- the Listeria is Listeria welshimeri.
- the Listeria is Listeria seeligeri.
- Antigens are used interchangeably herein and, as will be appreciated by a skilled artisan, may encompass polypeptides, or peptides (including recombinant peptides) that are loaded onto and presented on MHC class I and/or class ⁇ molecules on a host's cell's surface and can be recognized or detected by an immune cell of the host, thereby leading to the mounting of an immune response against the polypeptide, peptide or cell presenting the same.
- the immune response may also extend to other cells within the host, including diseased cells such as tumor or cancer cells that express the same polypeptides or peptides.
- antigenic portion thereof, a fragment thereof and “immunogenic portion thereof in regard to a protein, peptide or polypeptide are used interchangeably herein and may encompass a protein, polypeptide, peptide, including recombinant forms thereof comprising a domain or segment that leads to the mounting of an immune response when present in, or, in some embodiments, detected by, a host, either alone, or in the context of a fusion protein, as described herein.
- heterologous encompasses a nucleic acid, amino acid, peptide, polypeptide, or protein derived from a different species than the reference species.
- a Listeria strain expressing a heterologous polypeptide in one embodiment, would express a polypeptide that is not native or endogenous to the Listeria strain, or in another embodiment, a polypeptide that is not normally expressed by the Listeria strain, or in another embodiment, a polypeptide from a source other than the Listeria strain.
- heterologous may be used to describe something derived from a different organism within the same species.
- the heterologous antigen is expressed by a recombinant strain of Listeria, and is processed and presented to cytotoxic T-cells upon infection of mammalian cells by the recombinant strain.
- the heterologous antigen expressed by Listeria species need not precisely match the corresponding unmodified antigen or protein in the tumor cell or infectious agent so long as it results in a T-cell response that recognizes the unmodified antigen or protein which is naturally expressed in the mammal.
- the term "antigenic polypeptide", “protein antigen”, “antigen”, are used interchangeably herein.
- an antigen may be foreign, that is, heterologous to the host and is referred to as a "heretologous antigen" herein.
- the antigen is a self-antigen, which is an antigen that is present in the host but the host does not elicit an immune response against it because of immunologic tolerance. It will be appreciated by a skilled artisan that a heterologous antigen as well as a self-antigen may encompass a tumor antigen, a tumor-associated antigen or an angiogenic antigen.
- a heterologous antigen may encompass an infectious disease antigen.
- the antigen is an angiogenic antigen.
- a peptide disclosed herein is derived from a tumor-associated antigen.
- the tumor-associated antigen is selected from HPV-E7, HPV-E6, Her- 2, NY-ESO-1, a high molecular weight melanoma-associated (HMW-MAA) antigen or fragment thereof, hepsin, survivin, PSG4, a VEGFR-2 fragment, survivin, a B-cell receptor antigen, Tyrosinase related protein 2, or a PSA (prostate-specific antigen) or a combination thereof.
- HMW-MAA high molecular weight melanoma-associated
- the antigen is an infectious disease antigen such as is HTV-1 Gag, a MAGE (Melanoma-Associated Antigen E) protein, e.g. MAGE 1, MAGE 2, MAGE 3, MAGE 4, a tyrosinase; a mutant ras protein; a mutant p53 protein; p97 melanoma antigen, a ras peptide or p53 peptide associated with advanced cancers; the HPV 16/18 antigens associated with cervical cancers, KLH antigen associated with breast carcinoma, carcinoembryonic antigen (CEA), gplOO, a MARTI antigen associated with melanoma, interleukin-13 receptor alpha (IR13-R alpha), a telomerase (TERT), stratum corneum chymotryptic enzyme (SCCE) antigen, CEA, LMP-1, p53, proteinase 3, synovial sarcoma, carbonic anhydrase IX (MAGE (
- the disease disclosed herein is an infectious disease.
- the infectious disease is one caused by, but not limited to, any one of the following pathogens: leishmania, Entamoeba histolytica (which causes amebiasis), trichuris, BCG/Tuberculosis, Malaria, Plasmodium falciparum, Plasmodium malariae, Plasmodium vivax, Rotavirus, Cholera, Diptheria-Tetanus, Pertussis, Haemophilus influenzae, Hepatitis B, Human papilloma virus, Influenza seasonal), Influenza A (H1N1) Pandemic, Measles and Rubella, Mumps, Meningococcus A+C, Oral Polio Vaccines, mono, bi and trivalent, Pneumococcal, Rabies, Tetanus Toxoid, Yellow Fever, Bacillus anthracis (anthrax), Clostridium botulinum
- pathogenic protozoans and helminths infections include: amebiasis; malaria; leishmaniasis; trypanosomiasis; toxoplasmosis; Pneumocystis carinii; babesiosis; giardiasis; trichinosis; filariasis; schistosomiasis; nematodes; trematodes or flukes; and cestode (tapeworm) infections.
- an HPV antigen such as an E6 or E7 antigen disclosed herein is selected from an HPV 6 strain, and HPV 11 strain, HPV 16 strain, an HPV- 18 strain, an HPV-31 strain, an HPV-35 strain, an HPV-39 strain, an HPV-45 strain, an HPV-51 strain an HPV-52 strain, an HPV-58 strain or an HPV-59 strain.
- the HPV antigen is selected from a high-risk HPV strain.
- the HPV strain is a mucosal HPV type.
- HPV antigens can be selected from all HPV strains, including non oncogenic HPVs such as type 6, 11, etc. that cause warts and dysplasia.
- an HPV- 16 E6 and E7 is utilized instead of or in combination with an HPV-18 E6 and E7.
- the recombinant Listeria may express the HPV-16 E6 and E7 from the chromosome and the HPV-18 E6 and E7 from a plasmid, or vice versa.
- the HPV-16 E6 and E7 antigens and the HPV-18 E6 and E7 antigens are expressed from a plasmid present in a recombinant Listeria disclosed herein.
- the HPV- 16 E6 and E7 antigens and the HPV-18 E6 and E7 antigens are expressed from the chromosome of a recombinant Listeria disclosed herein.
- the HPV-16 E6 and E7 antigens and the HPV-18 E6 and E7 antigens are expressed in any combination of the above embodiments, including where each E6 and E7 antigen from each HPV strain is expressed from either the plasmid or the chromosome.
- the antigen is a chimeric Her2 antigen described in US patent application serial no. 12/945,386, which is hereby incorporated by reference herein in its entirety.
- the antigen is associated with one of the following diseases; cholera, diphtheria, Haemophilus, hepatitis A, hepatitis B, influenza, measles, meningitis, mumps, pertussis, small pox, pneumococcal pneumonia, polio, rabies, rubella, tetanus, tuberculosis, typhoid, Varicella-zoster, whooping cough, yellow fever, the immunogens and antigens from Addison's disease, allergies, anaphylaxis, Bruton's syndrome, cancer, including solid and blood borne tumors, eczema, Hashimoto's thyroiditis, polymyositis, dermatomyositis, type 1 diabetes mellitus, acquired immune deficiency syndrome, transplant rejection, such as kidney, heart, pancreas, lung, bone, and liver transplants, Graves' disease, polyendoc
- the condition disclosed herein is a dysplasia.
- the disease is a neoplasia.
- the disease is anal intraepithelial neoplasia (AIN).
- the disease is vaginal intraepithelial neoplasia (VIN).
- the disease is a cervical intraepithelial neoplasia (CIN).
- a condition disclosed herein is a pre-malignant condition or a condition that proceeds to develop into a disease, chronic or acute, if left untreated.
- a tumor-associated antigen disclosed herein is an angiogenic antigen which is expressed on both activated pericytes and pericytes in tumor angiogeneic vasculature, which is associated with neovascularization in vivo.
- Angiogenic antigens are known in the art see for example WO2010/102140, which is incorporated by reference herein.
- an angiogenic factor may be selected from; Angiopoietin-1 (Angl), Angiopoietin 3, Angiopoietin 4, Angiopoietin 6; Del-1; Fibroblast growth factors: acidic (aFGF) and basic (bFGF); Follistatin; Granulocyte colony- stimulating factor (G-CSF); Hepatocyte growth factor (HGF) /scatter factor (SF); Interleukin-8 (IL-8); Leptin; Midkine; Placental growth factor; Platelet-derived endothelial cell growth factor (PD-ECGF); Platelet-derived growth factor-BB (PDGF-BB); Pleiotrophin (PTN); Progranulin; Proliferin; survivin; Transforming growth factor-alpha (TGF-alpha); Transforming growth factor-beta (TGF-beta); Tumor necrosis factor-alpha (TNF-alpha); Vascular endothelial growth factor (VEGF)/vascular endot
- an angiogenic factor is an angiogenic protein.
- a growth factor is an angiogenic protein.
- an angiogenic protein for use in the compositions and methods of the present invention is Fibroblast growth factors (FGF); VEGF; VEGFR and Neuropilin 1 (NRP-1); Tie2; Platelet- derived growth factor (PDGF; BB-homodimer) and PDGFR; Transforming growth factor-beta (TGF- ⁇ ), endoglin and TGF- ⁇ receptors; monocyte chemotactic protein-1 (MCP-1); Integrins ⁇ 3, ⁇ 5 and ⁇ 5 ⁇ 1; VE-cadherin and CD31; ephrin; plasminogen activators; plasminogen activator inhibitor-1; Nitric oxide synthase (NOS) and COX-2; AC133; or Idl/Id3, a TGFbeta co-receptor or endoglin (which is also known as CD105
- FGF Fibroblast
- neoepitopes are generated and obtained as disclosed in any one of the following US applications (USSN 62/166,591; USSN 62/174,692; USSN 62/218,936; USSN 62/184,125, which are all incorporated by reference herein in their entirety.
- a method of preventing persistence of a Listeria strain on a tissue within a subject following administration of a Listeria-based immunotherapy regimen comprising the step of administering an effective amount of a regimen of antibiotics following administration of said recombinant Listeria-based immunotherapy, thereby preventing said persistence of said Listeria strain within said subject.
- the Listeria strain comprises a nucleic acid molecule comprising an open reading frame encoding one or more peptides encoding one or more neoepitopes, wherein said one or more peptides are fused to an immunogenic protein or peptide.
- an immunogenic protein or peptide comprises a truncated LLO (tLLO), truncated ActA (tActA), or PEST amino acid sequence peptide.
- a recombinant attenuated Listeria strain comprising a nucleic acid sequence comprising one or more open reading frames encoding one or more peptides comprising one or more personalized neo-epitopes, wherein the neo- epitope(s) comprises immunogenic epitopes present in a disease or condition-bearing tissue or cell of a subject having the disease or condition.
- one or more neoepitopes are present in a disease or condition-bearing tissue or cell of a subject having the disease or condition.
- administrating the Listeria strain to a subject having said disease or condition generates an immune response targeted to the subject's disease or condition.
- the strain is a personalized immunotherapy vector for said subject targeted to said subject's disease or condition.
- the peptides comprise at least two different neo-epitopes amino acid sequences.
- the peptides comprise one or more neo-epitopes repeats of the same amino acid sequence.
- the Listeria strain comprises one neo-epitope.
- the Listeria strain comprises the neo-epitopes in the range of about 1-100.
- the Listeria strain comprises the neo-epitopes in the range of about 1-5, 5-10, 10-15, 15-20, 10-20, 20-30, 30-40,40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 5-15, 5-20, 5-25, 15-20, 15- 25, 15-30, 15-35, 20-25, 20-35, 20-45, 30-45, 30-55 ,40-55, 40-65, 50-65, 50-75, 60-75, 60-85, 70- 85, 70-95, 80-95, 80-105 or 95-105.
- the Listeria strain comprises the neo-epitopes in the range of about 50-100.
- the Listeria strain comprises up to about 100 the neo- epitopes.
- the Listeria strain comprises above about 100 the neo-epitopes. In another embodiment, the Listeria strain comprises up to about 10 the neo-epitopes. In another embodiment, the Listeria strain comprises up to about 20 the neo-epitopes. In another embodiment, the Listeria strain comprises up to about 50 the neo-epitopes.
- the Listeria strain comprises about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100 the neo-epitopes.
- incorporation of amino acids in the range of about 5-30 amino acids flanking on each side of the detected mutation are generated. Additionally or alternatively, varying sizes of neo-epitope inserts are inserted in the range of about 8-27 amino acid sequence long. Additionally or alternatively, varying sizes of neo-epitope inserts are inserted in the range of about 5-50 amino acid sequence long.
- the neo-epitope sequences are tumor specific, metastases specific, bacterial infection specific, viral infection specific, and any combination thereof. Additionally or alternatively, the neo-epitope sequences are inflammation specific, immune regulation molecule epitope specific, T-cell specific, an autoimmune disease specific, Graft-versus- host disease (GvHDJ specific, and any combination thereof.
- one or more neo-epitopes comprise linear neo-epitopes. Additionally or alternatively, one or more neo-epitopes comprise a solvent-exposed epitope.
- one or more neo-epitopes comprise a T-cell epitope.
- an immunogenic composition as described above, for treating a disease or condition, including a tumor or cancer.
- an immunogenic composition used in a method of this disclosure comprises a Listeria strain expressing a minigene nucleic acid construct as described herein.
- the condition disclosed herein is a dysplasia.
- the disease is a neoplasia.
- the disease is anal intraepithelial neoplasia (AIN).
- the disease is vaginal intraepithelial neoplasia (VTN).
- the disease is a cervical intraepithelial neoplasia (CIN).
- a condition disclosed herein is a pre-malignant condition or a condition that proceeds to develop into a disease, chronic or acute, if left untreated.
- the cancer disclosed herein is a breast cancer, a central nervous system (CNS) cancer, a head and neck cancer, an osteosarcoma (OSA), a canine osteosarcoma (OS A), a colorectal cancer, a renal cell carcinoma, a pancreatic ductal adenocarcinoma, Ewing's sarcoma (ES), a pancreatic cancer, an ovarian cancer, a gastric cancer, a carcinomatous lesion of the pancreas, a pulmonary adenocarcinoma, a colorectal adenocarcinoma, a pulmonary squamous adenocarcinoma, a gastric adenocarcinoma, an ovarian surface epithelial neoplasm (e.g.
- the cancer is lymphoma, leukemia, or myeloma.
- the lymphoma is a Hodgkin's Lymphoma.
- the lymphoma is non-Hodgkin's Lymphoma.
- the cancer is a multiple melanoma.
- the cancer is acute lymphocytic leukemia (ALL). In another embodiment, the cancer is acute myeloid leukemia (AML). In another embodiment, the cancer is chronic lymphocytic leukemia (CLL). In another embodiment, the cancer is hairy cell leukemia (HCL). In another embodiment, the cancer is T-cell prolymphocytic leukemia (T-PLL). In another embodiment, the cancer is large granular lymphocytic leukemia. In another embodiment, the cancer is Adult T-cell leukemia. In another embodiment, the cancer is chronic myeloid leukemia (CML). In another embodiment, the cancer is chronic myelomonocytic leukemia (CMML).
- ALL acute lymphocytic leukemia
- AML acute myeloid leukemia
- CLL chronic lymphocytic leukemia
- HCL hairy cell leukemia
- T-PLL T-cell prolymphocytic leukemia
- the cancer is large granular lymphocytic leukemia.
- the cancer is a lymphoma. In another embodiment, the cancer is cutaneous lymphoma. In another embodiment, the cancer is Hodgkin Disease. In another embodiment, the cancer is Non- Hodgkin Lymphoma (NHL). In another embodiment, the cancer is a low-grade NHL. In another embodiment, the cancer is diffuse large B cell lymphoma. In another embodiment, the cancer is low- grade NHL. In another embodiment, the cancer is precursor T cell lymphoma. In another embodiment, the cancer is peripheral T cell lymphoma. In another embodiment, the cancer is peripheral mantle cell lymphoma. In another embodiment, the cancer is multiple myeloma. In another embodiment, the cancer is follicular lymphoma.
- NHL Non- Hodgkin Lymphoma
- the cancer is an immunoproliferative disease.
- the cancer is B cell chronic lymphocytic leukemia.
- the cancer is Burkitt lymphoma.
- the cancer is MALT lymphoma.
- the cancer is mycosis fungoides.
- the cancer is nodular sclerosis.
- the cancer is a low-grade lymphoma.
- the cancer is residual disease from one of the above types of lymphoma or leukemia.
- the cancer is any other type of lymphoma or leukemia known in the art.
- the cancer is any other known type of lymphoma that expresses survivin.
- the cancer is Myelodysplastic Syndrome. In another embodiment, the cancer is any survivin-expressing blood cancer. In another embodiment, said cancer or solid tumor is a result of relapse or metastatic disease. In another embodiment, the cancer is refractory. In another embodiment, the cancer is advanced. In another embodiment, the cancer is a metastasis.
- the tumor is an osteosarcoma tumor, a breast tumor, a head and neck tumor or any other tumor that can progress to any cancer disclosed herein and known in the art.
- cells of the tumor that is targeted by methods and compositions of the present disclosure express an antigen associated with a peptide expressed by the recombinant Listeria strain disclosed herein.
- the peptide antigen is associated with an angiogenic tumor antigen (for example HMW-MAA).
- HMW-MAA angiogenic tumor antigen
- the methods disclosed herein induce the expansion of T effector cells in peripheral lymphoid organs leading to an enhanced presence of T effector cells at the tumor site.
- the methods disclosed herein induce the expansion of T effector cells in peripheral lymphoid organs leading to an enhanced presence of T effector cells at the periphery.
- T effector cells leads to an increased ratio of T effector cells to regulatory T cells in the periphery and at the tumor site without affecting the number of Tregs.
- peripheral lymphoid organs include, but are not limited to, the spleen, peyer's patches, the lymph nodes, the adenoids, etc.
- the increased ratio of T effector cells to regulatory T cells occurs in the periphery without affecting the number of Tregs.
- the increased ratio of T effector cells to regulatory T cells occurs in the periphery, the lymphoid organs and at the tumor site without affecting the number of Tregs at these sites.
- the increased ratio of T effector cells decreases the frequency of Tregs, but not the total number of Tregs at these sites.
- a method of preventing a cancer in a subject comprising the step of administering a recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a tumor antigen-associated peptide.
- a method of preventing a tumor growth in a subject comprising the step of administering a composition comprising recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a tumor antigen-associated peptide.
- a method of treating a cancer in a subject comprising the step of administering a composition comprising a recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a tumor antigen-associated peptide.
- a method of treating a tumor growth in a subject comprising the step of administering a recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a tumor antigen-associated peptide.
- a method of prolonging the survival of a subject having a cancer comprising the step of administering a composition comprising a recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a tumor antigen-associated peptide.
- a method of prolonging the survival of a subject having a tumor growth comprising the step of administering a composition comprising a recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a tumor antigen-associated peptide.
- a method of inhibiting, impeding, or delaying metastatic disease in a subject having a disease comprising the step of administering a composition comprising a recombinant Listeria comprising a minigene nucleic acid construct encoding a chimeric protein, wherein said chimeric protein comprises a peptide associated with said disease.
- the present disclosure provides a method of inducing an anti-tumor or anti-cancer immune response in a subject, the method comprising administering to the subject a composition of the present invention.
- a method of inducing regression of a tumor or cancer in a subject comprising the step of administering to the subject a composition comprising a recombinant Listeria strain disclosed herein.
- a method of decreasing the frequency of intra- tumoral T regulatory cells comprising the step of administering to the subject a composition comprising a recombinant Listeria strain disclosed herein.
- a method of decreasing the frequency of intra- tumoral myeloid derived suppressor cells comprises the step of administering to the subject a composition comprising a recombinant Listeria strain disclosed herein.
- a method of decreasing the frequency of myeloid derived suppressor cells comprises the step of administering to the subject a composition comprising a recombinant Listeria vaccine strain disclosed herein.
- a method of treating a metastatic tumor or cancer in a subject comprising the step of administering to the subject a composition comprising a recombinant Listeria strain disclosed herein.
- methods of this disclosure break tolerance in a subject to a tumor or cancer in said subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain disclosed herein.
- the present disclosure provides a method of impeding a growth of a tumor or cancer in a subject, the method comprises administering to the subject a subject a composition comprising the recombinant Listeria strain disclosed herein, thereby impeding a growth of a tumor or cancer in a subject.
- the present disclosure provides a method of reducing an incidence of cancer, comprising the step of administering a composition comprising a recombinant Listeria of the present invention.
- the present disclosure provides a method of ameliorating cancer, comprising the step of administering a composition comprising a recombinant Listeria of the present invention.
- any composition disclosed herein comprising a Listeria strain described herein may be used in the methods of this invention.
- a method of administering a composition of the present invention in another embodiment, disclosed herein is a method of administering a vaccine comprising the recombinant Listeria of the present invention.
- a method of administering a recombinant polypeptide of the present invention in another embodiment, disclosed herein is a method of administering a nucleic acid construct encoding a recombinant polypeptide of the present invention.
- the administering is performed with a different attenuated bacterial vector.
- the administering is performed with a different attenuated Listeria monocytogenes vector.
- the administering is performed with a DNA vaccine (e.g. a naked DNA vaccine).
- administration of a recombinant polypeptide of the present disclosure is performed by producing the protein recombinantly, then administering the recombinant protein to a subject.
- the present disclosure provides a method for "epitope spreading" of a tumor.
- the immunization using the compositions and methods disclosed herein induce epitope spreading onto other tumors bearing antigens other than the antigen carried in the vaccine of the present invention. This results in an extension of the anti-tumor response onto the other tumors.
- the dominant epitope or subdominant epitope is dominant or subdominant, respectively, in the subject being treated. In another embodiment, the dominant epitope or subdominant epitope is dominant or subdominant in a population being treated.
- a method of treating, suppressing, or inhibiting a cancer or a tumor growth in a subject by epitope spreading wherein and in another embodiment, said cancer is associated with expression of an antigen or fragment thereof comprised in the composition of the present invention.
- the method comprises administering to said subject a composition comprising the recombinant polypeptide, recombinant Listeria, or recombinant vector of the present invention.
- the subject mounts an immune response against the antigen-expressing cancer or the antigen-expressing tumor, thereby treating, suppressing, or inhibiting a cancer or a tumor growth in a subject.
- the term "Dominant CD8 + T cell epitope” or “Dominant epitope” refers to an epitope that is recognized by over 30% of the antigen- specific CD8 + T cells that are elicited by vaccination, infection, or a malignant growth with a protein or a pathogen or cancer cell containing the protein. In another embodiment, the term refers to an epitope recognized by over 35% of the antigen- specific CD8 + T cells that are elicited thereby. In another embodiment, the term refers to an epitope recognized by over 40% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 45% of the antigen- specific CD8 + T cells.
- the term refers to an epitope recognized by over 50% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 55% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by 5 over 60% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 65% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 70% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 75% of the antigen- specific CD8 + T cells.
- the term refers to an epitope recognized by over 80% of the antigenic) specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 85% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 90% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 95% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 96% of the antigen- specific CD8 + T 15 cells. In another embodiment, the term refers to an epitope recognized by over 97% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 98% of the antigen- specific CD8 + T cells.
- the term "Subdominant CD8 + T cell epitope” or “subdominant epitope” refers to an epitope recognized by fewer than 30% of the antigen- specific CD8 + T cells that
- the term refers to an epitope recognized by fewer than 28% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 26% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 24% of the antigen- specific CD8 + T cells. In
- the term refers to an epitope recognized by over 22% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 20% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 18% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 16% of the antigen- specific CD8 + T cells. In another embodiment,
- the term refers to an epitope recognized by over 14% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 12% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 10% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by over 8% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 6% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 5% of the antigen- specific CD8 + T cells.
- the term refers to an epitope recognized by over 4% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 3% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 2% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 1% of the antigen- specific CD8 + T cells. In another embodiment, the term refers to an epitope recognized by fewer than 0.5% of the antigen- specific CD8 + T cells.
- the antigen comprising the peptide in methods and compositions of the present disclosure is, in one embodiment, expressed at a detectable level on a non-tumor cell of the subject. In another embodiment, the antigen is expressed at a detectable level on at least a certain percentage (e.g. 0.01%, 0.03%, 0.1%, 0.3%, 1%, 2%, 3%, or 5%) of non-tumor cells of the subject.
- “non- tumor cell” refers to a cell outside the body of the tumor.
- non-tumor cell refers to a non-malignant cell.
- non-tumor cell refers to a non-transformed cell.
- the non-tumor cell is a somatic cell.
- the non-tumor cell is a germ cell.
- Detectable level refers to a level that is detectable when using a standard assay.
- the assay is an immunological assay.
- the assay is enzyme-linked immunoassay (ELISA).
- the assay is Western blot.
- the assay is FACS.
- the assay is a gene-expression assay. It is to be understood by a skilled artisan that other assays available in the art can be used in the methods disclosed herein.
- a detectable level is determined relative to the background level of a particular assay. Methods for performing each of these techniques are well known to those skilled in the art.
- vaccination with recombinant antigen-expressing LM induces epitope spreading.
- the present disclosure provides a method for "epitope spreading" of an anti-tumor response.
- the immunization using the compositions and methods disclosed herein induce epitope spreading onto other tumors.
- the dominant epitope or subdominant epitope is dominant or subdominant, respectively, in the subject being treated. In another embodiment, the dominant epitope or subdominant epitope is dominant or subdominant in a population being treated.
- disclosed herein is a method of treating, suppressing, or inhibiting a cancer or a tumor growth in a subject by epitope spreading wherein and in another embodiment, said cancer is associated with expression of an antigen or fragment thereof comprised in the composition of the present invention.
- the method comprises administering to said subject a composition comprising the recombinant polypeptide, recombinant Listeria, or recombinant vector of the present invention.
- the subject mounts an immune response against the antigen-expressing cancer or the antigen-expressing tumor, thereby treating, suppressing, or inhibiting a cancer or a tumor growth in a subject.
- the present disclosure provides a method for inducing formation of cytotoxic T cells in a host having cancer, comprising administering to the host a composition of the present invention, thereby inducing formation of cytotoxic T cells in a host having cancer.
- the composition is administered to the cells of the subject ex vivo; in another embodiment, the composition is administered to the cells of a donor ex vivo; in another embodiment, the composition is administered to the cells of a donor in vivo, and then is transferred to the subject.
- the subject mounts an immune response against the antigen-expressing tumor or target antigen, thereby mediating the antitumor effects.
- repeat administrations (booster doses) of compositions of this disclosure may be undertaken immediately following the first course of treatment or after an interval of days, weeks or months to achieve tumor regression.
- repeat doses may be undertaken immediately following the first course of treatment or after an interval of days, weeks or months to achieve suppression of tumor growth.
- Assessment may be determined by any of the techniques known in the art, including diagnostic methods such as imaging techniques, analysis of serum tumor markers, biopsy, or the presence, absence or amelioration of tumor associated symptoms.
- a method of increasing a ratio of T effector cells to regulatory T cells (Tregs) in the spleen and tumor microenvironments of a subject comprising administering the immunogenic composition disclosed herein.
- increasing a ratio of T effector cells to regulatory T cells (Tregs) in the spleen and tumor microenvironments in a subject allows for a more profound anti-tumor response in the subject.
- a regulatory T cells is a CD4+FoxP3+ T cell.
- the T effector cells comprise CD4+FoxP3- T cells. In another embodiment, the T effector cells are CD4+FoxP3- T cells. In another embodiment, the T effector cells comprise CD4+FoxP3- T cells and CD8+ T cells. In another embodiment, the T effector cells are CD4+FoxP3- T cells and CD8+ T cells.
- the present disclosure provides methods of treating, protecting against, and inducing an immune response against a tumor or a cancer, comprising the step of administering to a subject the immunogenic composition disclosed herein.
- the present disclosure provides a method of preventing or treating a tumor or cancer in a human subject, comprising the step of administering to the subject the immunogenic composition disclosed herein.
- the immune response is a T- cell response.
- the T-cell response is a CD4+FoxP3- T cell response.
- the T-cell response is a CD8+ T cell response.
- the T- cell response is a CD4+FoxP3- and CD8+ T cell response.
- the present disclosure provides a method of protecting a subject against a tumor or cancer, comprising the step of administering to the subject an immunogenic composition disclosed herein.
- the present disclosure provides a method of inducing regression of a tumor in a subject, comprising the step of administering to the subject an immunogenic composition disclosed herein.
- the present disclosure provides a method of reducing the incidence or relapse of a tumor or cancer, comprising the step of administering to the subject an immunogenic composition disclosed herein.
- the present disclosure provides a method of suppressing the formation of a tumor in a subject, comprising the step of administering to the subject an immunogenic composition disclosed herein.
- the present disclosure provides a method of inducing a remission of a cancer in a subject, comprising the step of administering to the subject an immunogenic composition disclosed herein.
- a minigene nucleic acid construct comprising an open reading frame encoding a chimeric peptide as disclosed herein, is integrated into a Listeria genome.
- the minigene construct is in a plasmid in a recombinant Listeria vaccine strain.
- the minigene construct is in an extrachromosomal plasmid in said Listeria
- the construct is expressed from an extrachromosomal plasmid in said Listeria.
- a method of treating reduces lymph node size. Reduction of lymph node size may be partial or by 100%. In another embodiment, methods of this disclosure reduce lymph node size by 90%. In another embodiment, methods of this disclosure reduce lymph node size by 80%. In another embodiment, methods reduce lymph node size by 70%. In another embodiment, methods reduce lymph node size by 60%. In another embodiment, methods reduce lymph node size by 50%.
- a method of treating increases the time to disease progression.
- the time to disease progression was increased by at least 2 moths as compared to untreated subject.
- the time to disease progression was increased by at least 4 moths as compared to untreated subject.
- the time to disease progression was increased by at least 6 moths as compared to untreated subject.
- the time to disease progression was increased by at least 1 year as compared to untreated subject.
- the time to disease progression was increased by at least 2 years as compared to untreated subject.
- the time to disease progression was increased by at least 3 years as compared to untreated subject.
- the time to disease progression was increased by at least 4 years as compared to untreated subject.
- the time to disease progression was increased by at least 5 years as compared to untreated subject.
- the method comprises the step of co-administering the recombinant Listeria with an additional therapy.
- the additional therapy is surgery, chemotherapy, an immunotherapy, a radiation therapy, antibody based immuno therapy, or a combination thereof.
- the additional therapy precedes administration of the recombinant Listeria.
- the additional therapy follows administration of the recombinant Listeria.
- the additional therapy is an antibody therapy.
- the recombinant Listeria is administered in increasing doses in order to increase the T-effector cell to regulatory T cell ration and generate a more potent anti-tumor immune response.
- the anti-tumor immune response can be further strengthened by providing the subject having a tumor with cytokines including, but not limited to IFN- ⁇ , TNF-a, and other cytokines known in the art to enhance cellular immune response, some of which can be found in US Patent Serial No. 6,991,785, incorporated by reference herein.
- cytokines including, but not limited to IFN- ⁇ , TNF-a, and other cytokines known in the art to enhance cellular immune response, some of which can be found in US Patent Serial No. 6,991,785, incorporated by reference herein.
- the methods disclosed herein further comprise the step of coadministering an immunogenic composition disclosed herein with an antibody or functional fragment thereof that enhances an anti-tumor immune response in said subject.
- a method of increasing survival of a subject suffering from cancer or having a tumor comprising the step of administering to the subject an immunogenic composition comprising a recombinant Listeria vaccine strain, disclosed herein.
- a method of increasing antigen- specific T cells in a subject suffering from cancer or having a tumor comprising the step of administering to the subject an immunogenic composition comprising a recombinant Listeria vaccine, disclosed herein.
- a treatment protocol of the present disclosure is therapeutic.
- the protocol is prophylactic.
- the compositions of the present disclosure are used to protect people at risk for cancer such as breast cancer or other types of tumors because of familial genetics or other circumstances that predispose them to these types of ailments as will be understood by a skilled artisan.
- the compositions are used as a cancer immunotherapy after debulking of tumor growth by surgery, conventional chemotherapy or radiation treatment. Following such treatments, the compositions of the present disclosure are administered so that the cytotoxic T-cell (CTL) response to the tumor antigen of the vaccine destroys remaining metastases and prolongs remission from the cancer.
- CTL cytotoxic T-cell
- compositions are used as a cancer immunotherapy in combination with surgery, conventional chemotherapy or radiation treatment.
- compositions of the present disclosure are used to effect the growth of previously established tumors and to kill existing tumor cells.
- the dosage in the range of 0.4 LDso/dose. In another embodiment, the dosage is from about 0.4-4.9 LDso/dose. In another embodiment the dosage is from about 0.5-0.59 LDso/dose. In another embodiment the dosage is from about 0.6-0.69 LDso/dose. In another embodiment the dosage is from about 0.7-0.79 LDso/dose. In another embodiment the dosage is about 0.8 LDso/dose. In another embodiment, the dosage is 0.4 LDso/dose to 0.8 of the LDso/dose.
- the dosage is 10 bacteria/dose. In another embodiment, the
- the dosage is 1.5 x 10 bacteria dose. In another embodiment, the dosage is 2 x 10 bacteria dose. In another embodiment, the dosage is 3 x 10 bacteria/dose. In another embodiment, the dosage is 4 x
- the dosage is 6 x 10 bacteria/dose. In another embodiment, the dosage is 6 x 10 bacteria/dose. In another
- the dosage is 8 x 10 bacteria/dose. In another embodiment, the dosage is 1 x 10 bacteria dose. In another embodiment, the dosage is 1.5 x 10 bacteria dose. In another embodiment,
- the dosage is 2 x 10 bacteria/dose. In another embodiment, the dosage is 3 x 10 bacteria dose. In another embodiment, the dosage is 4 x 10 bacteria/dose. In another embodiment, the dosage is 6 x
- the dosage is 8 x 10 bacteria/dose. In another embodiment, the dosage is 1 x 10 9 bacteria/dose. In another embodiment, the dosage is 1.5 x 10 9 bacteria/dose. In another embodiment, the dosage is 2 x 10 9 bacteria/dose. In another embodiment, the dosage is 3 x 10 9 bacteria/dose. In another embodiment, the dosage is 5 x 10 9 bacteria/dose. In another embodiment, the dosage is 6 x 10 9 bacteria/dose. In another embodiment, the dosage is 8 x 10 9 bacteria/dose. In another embodiment, the dosage is 1 x 10 10 bacteria/dose. In another embodiment, the dosage is 1.5 x 10 10 bacteria/dose. In another embodiment, the dosage is 2 x 10 10 bacteria/dose.
- the dosage is 3 x 10 10 bacteria/dose. In another embodiment, the dosage is 5 x 10 10 bacteria/dose. In another embodiment, the dosage is 6 x 10 10 bacteria/dose. In another embodiment, the dosage is 8 x 10 10 bacteria/dose. In another embodiment, the dosage is 8 x 10 9 bacteria/dose. In another embodiment, the dosage is 1 x 10 11 bacteria/dose. In another embodiment, the dosage is 1.5 x 10 11 bacteria/dose. In another embodiment, the dosage is 2 x 10 11 bacteria/dose. In another embodiment, the dosage is 3 x 10 11 bacteria/dose. In another embodiment, the dosage is 5 x 10 11 bacteria/dose. In another embodiment, the dosage is 6 x 10 11 bacteria/dose. In another embodiment, the dosage is 8 x 10 11 bacteria/dose.
- the pharmaceutical composition comprising the bacteria as described in this disclosure is administered once. In another embodiment, the composition is administered more than once. In another embodiment, the composition is administered twice with a one week interval between administrations. In another embodiment, the composition is administered twice with a two weeks interval between administrations. In another embodiment, the composition is administered twice with a three weeks interval between administrations. In another embodiment, the composition is administered three times with a one week interval between administrations. In another embodiment, the composition is administered three times with a two weeks interval between administrations. In another embodiment, the composition is administered three times with a three weeks interval between administrations. In another embodiment, any of the above regimens are followed up with further administrations.
- further administrations are prophylactic. In another embodiments further booster administrations are done when the subject experiences cancer relapse. In another embodiments further booster administrations are done when the subject experiences cancer remission. In some embodiments, the booster regimen comprises monthly administration of the composition. In another embodiment, the booster regimen comprises bi-monthly administration of the composition. In yet another embodiment, the booster regimen comprises administration of the composition with an interval of two or more months. In other embodiment, the booster regimen comprises one additional administration. In another embodiment, booster regimen comprises more than one additional administration. In yet another embodiment, the booster regimen comprises two additional administrations. In yet another embodiment, the booster regimen comprises three additional administrations. In another embodiment, the follow up administration regimen comprises more than three additional administrations.
- a method of the present disclosure further comprises boosting the subject with an immunogenic composition comprising an attenuated Listeria strain disclosed herein.
- a method of the present disclosure comprises the step of administering a booster dose of the immunogenic composition comprising an attenuated Listeria strain disclosed herein.
- the methods of the present disclosure further comprise the step of administering to the subject a booster immunogenic composition.
- the booster dose follows a single priming dose of said immunogenic composition.
- a single booster dose is administered after the priming dose.
- two booster doses are administered after the priming dose.
- three booster doses are administered after the priming dose.
- the period between a prime and a boost dose of an immunogenic composition comprising the attenuated Listeria disclosed herein is experimentally determined by the skilled artisan.
- the booster dose is an alternate form of an immunogenic composition comprising a Listeria disclosed herein.
- the booster dose comprises the immunogenic composition disclosed herein and an adjuvant.
- Heterologous "prime boost" strategies have been effective for enhancing immune responses and protection against numerous pathogens.
- Providing antigen in different forms in the prime and the boost injections appears to maximize the immune response to the antigen.
- DNA strain priming followed by boosting with protein in adjuvant or by viral vector delivery of DNA encoding antigen appears to be the most effective way of improving antigen specific antibody and CD4+ T-cell responses or CD8+ T-cell responses respectively.
- the antigens contemplated include, among others, those of Hepatitis (all forms), HSV, HTV, CMV, EBV, RSV, VZV, HPV, polio, influenza, parasites (e.g., from the genus Plasmodium), and pathogenic bacteria (including but not limited to M. tuberculosis, M. leprae, Chlamydia, Shigella, B. burgdorferi, enterotoxigenic E. coli, S. typhosa, H. pylori, V. cholerae, B. pertussis, etc.). All of the above references are herein incorporated by reference in their entireties.
- a vaccine or immunogenic composition of the present disclosure is administered alone to a subject.
- the vaccine or immunogenic composition is administered together with another cancer therapy such as, but not limited to, radiotherapy, chemotherapy or a checkpoint inhibitor such as an anti-PD-1 antibody, an IDO pathway inhibitor, etc., or any combination thereof.
- a treatment protocol of the present disclosure is therapeutic.
- the protocol is prophylactic.
- the compositions of the present disclosure are used to protect people at risk for cancer such as breast cancer or other types of tumors because of familial genetics or other circumstances that predispose them to these types of ailments as will be understood by a skilled artisan.
- the vaccines or immunogenic composition are used as a cancer immunotherapy after debulking of tumor growth by surgery, conventional chemotherapy or radiation treatment. Following such treatments, the vaccines of the present disclosure are administered so that the CTL response to the tumor antigen of the vaccine destroys remaining metastases and prolongs remission from a cancer.
- vaccines of the present disclosure are used to effect the growth of previously established tumors and to kill existing tumor cells.
- range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed sub ranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
- compositions containing vaccines immunogenic compositions, or recombinant Listeriaof the present disclosure are, in another embodiment, administered to a subject by any method known to a person skilled in the art, such as parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intra-dermally, subcutaneously, orally, intra-peritonealy, intra- ventricularly, intra-cranially, intra-vaginally or intra-tumorally.
- a method of treating, suppressing, or inhibiting at least one cancer in a subject comprising administering a recombinant Listeria strain to said subject.
- cancer or tumors may be prevented in specific populations known to be susceptible to a particular cancer or tumor by administering the immunogenic compositions disclosed herein.
- susceptibilty may be due to environmental factors, such as smoking, which in one embodiment, may cause a population to be subject to lung cancer, while in another embodiment, such susceptbility may be due to genetic factors, for example a population with BRCAl/2 mutations may be susceptible, in one embodiment, to breast cancer, and in another embodiment, to ovarian cancer.
- one or more mutations on chromosome 8q24, chromosome 17ql2, and chromosome 17q24.3 may increase susceptibility to prostate cancer, as is known in the art.
- Other genetic and environmental factors contributing to cancer susceptibility are known in the art.
- the vaccines or compositions are administered orally, and are thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation.
- Suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like.
- Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the active ingredient is formulated in a capsule.
- the compositions of the present disclosure comprise, in addition to the active compound and the inert carrier or diluent, a hard gelating capsule.
- the vaccines or compositions are administered by intravenous, intra-arterial, or intra-muscular injection of a liquid preparation.
- suitable liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the pharmaceutical compositions are administered intravenously and are thus formulated in a form suitable for intravenous administration.
- the pharmaceutical compositions are administered intra-arterially and are thus formulated in a form suitable for intra-arterial administration.
- the pharmaceutical compositions are administered intramuscularly and are thus formulated in a form suitable for intra-muscular administration.
- compositions may encompass the recombinant Listeria described herein, and an adjuvant.
- an immunogenic composition comprises a recombinant Listeria disclosed herein.
- an immunogenic composition comprises an adjuvant known in the art or as disclosed herein. It is also to be understood that administration of such compositions enhance an immune response, or increase a T effector cell to regulatory T cell ratio or elicit an anti-tumor immune response, as further disclosed herein.
- composition encompasses a therapeutically effective amount of the active ingredient or ingredients including the Listeria strain together with a pharmaceutically acceptable carrier or diluent.
- administering encompasses bringing a subject in contact with a composition of the present invention.
- administration can be accomplished in vitro, i.e. in a test tube, or in vivo, i.e. in cells or tissues of living organisms, for example humans.
- the present disclosure encompasses administering the Listeria strains and compositions thereof of the present disclosure to a subject.
- the term “treating” refers to curing a disease. In another embodiment, “treating” refers to preventing a disease. In another embodiment, “treating” refers to reducing the incidence of a disease. In another embodiment, “treating” refers to ameliorating symptoms of a disease. In another embodiment, “treating” refers to increasing performance free survival or overall survival of a patient. In another embodiment, “treating” refers to stabilizing the progression of a disease. In another embodiment, “treating” refers to inducing remission. In another embodiment, “treating” refers to slowing the progression of a disease. In another embodiment, “treating” when in reference to a tumor or cancer, refers to inducing the regression of the tumor or cancer. The terms “reducing,” “suppressing,” and “inhibiting” refer to lessening or decreasing.
- treating refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder as described herein.
- treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with the disease, disorder or condition, or a combination thereof.
- "treating" refers inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
- preventing or “impeding” refers, inter alia, to delaying the onset of symptoms, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, or a combination thereof.
- “suppressing” or “inhibiting” refers inter alia to reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, prolonging patient survival, or a combination thereof.
- symptoms are primary, while in another embodiment, symptoms are secondary.
- primary refers to a symptom that is a direct result of a particular disease or disorder
- secondary refers to a symptom that is derived from or consequent to a primary cause.
- the compounds for use in the present disclosure treat primary or secondary symptoms or secondary complications.
- symptoms may be any manifestation of a disease or pathological condition.
- the term “subject” can encompass a mammal including an adult human or a human child, teenager or adolescent in need of therapy for, or susceptible to, a condition or its sequelae, and also may include non-human mammals such as dogs, cats, pigs, cows, sheep, goats, horses, rats, and mice. It will also be appreciated that the term may encompass livestock. The term “subject” does not exclude an individual that is normal in all respects.
- mammal for purposes of treatment refers to any animal classified as a mammal, including, but not limited to, humans, domestic and farm animals, and zoo, sports, or pet animals, such as canines, including dogs, and horses, cats, cattle, pigs, sheep, etc.
- a “therapeutically effective amount”, in reference to the treatment of tumor, refers to an amount capable of invoking one or more of the following effects: (1) inhibition, to some extent, of tumor growth, including, slowing down and complete growth arrest; (2) reduction in the number of tumor cells; (3) reduction in tumor size; (4) inhibition (i.e., reduction, slowing down or complete stopping) of tumor cell infiltration into peripheral organs; (5) inhibition (i.e., reduction, slowing down or complete stopping) of metastasis; (6) enhancement of anti-tumor immune response, which may, but does not have to, result in the regression or rejection of the tumor; and/or (7) relief, to some extent, of one or more symptoms associated with the disorder.
- a “therapeutically effective amount" of a vaccine disclosed herein for purposes of treatment of tumor may be determined empirically and in a routine manner.
- TC-1 provided by T. C. Wu (Johns Hopkins University School of Medicine, Baltimore, MD) is a highly tumorigenic lung epithelial cell expressing low levels of with HPV-16 E6 and E7 and transformed with the c-Ha-ras oncogene.
- TC-1 was grown in RPMI 1640, 10% FCS, 2 mM L-glutamine, 100 U/ml penicillin, 100 ⁇ g/ml streptomycin, 100 ⁇ nonessential amino acids, 1 mM sodium pyruvate, 50 micromolar (mcM) 2-ME, 400 microgram (mcg)/ml G418, and 10% National Collection Type Culture- 109 medium at 37° with 10% C0 2 .
- C3 is a mouse embryo cell from C57BL/6 mice immortalized with the complete genome of HPV 16 and transformed with pEJ-ras.
- EL-4/E7 is the thymoma EL-4 retrovirally transduced with E7.
- Listeria strains used were Lm-LLO-E7 (hly-E7 fusion gene in an episomal expression system; Figure 1A), Lm-E7 (single-copy E7 gene cassette integrated into Listeria genome), Lm- LLO-NP ("DP-L2028"; hly-NP fusion gene in an episomal expression system), and Lm-Gag ("ZY-18"; single-copy HIV-1 Gag gene cassette integrated into the chromosome).
- E7 was amplified by PCR using the primers 5 '-GGCTCGAGC ATGG AG ATAC ACC-3 ' (SEQ ID No: 21; Xhol site is underlined) and 5'-GGGGACTAGTTTATGGTTTCTGAGAACA-3' (SEQ ID No: 21; Spel site is underlined) and ligated into pCR2.1 (Invitrogen, San Diego, CA). E7 was excised from pCR2.1 by XhoIV Spel digestion and ligated into pGG-55.
- the hly-E7 fusion gene and the pluripotential transcription factor prfA were cloned into pAM401, a multicopy shuttle plasmid (Wirth R et al, J Bacteriol, 165: 831, 1986), generating pGG-55.
- the hly promoter drives the expression of the first 441 AA of the hly gene product, (lacking the hemolytic C-terminus, referred to below as "ALLO"), which is joined by the Xhol site to the E7 gene, yielding a hly-E7 fusion gene that is transcribed and secreted as LLO-E7. Transformation of a prfA negative strain of Listeria, XFL-7 (provided by Dr.
- the prfA gene was PCR amplified using primers 5'- GACTACAAGGACGATGACCGACAAGTGATAACCCGGGATCTAAATAAATCCGTTT-3' (SEQ ID No: 25; Xbal site is underlined) and 5'-CCCGTCGACCAGCTCTTCTTGGTGAAG-3' (SEQ ID No: 26; Sail site is underlined).
- Lm-E7 was generated by introducing an expression cassette containing the hly promoter and signal sequence driving the expression and secretion of E7 into the orfZ domain of the LM genome.
- E7 was amplified by PCR using the primers 5'- GCGGATCCCATGGAGATACACCTAC-3' (SEQ ID No: 27; BamHI site is underlined) and 5'- GCTCTAGATTATGGTTTCTGAG-3 ' (SEQ ID No: 28; Xbal site is underlined). E7 was then ligated into the pZY-21 shuttle vector.
- LM strain 10403S was transformed with the resulting plasmid, pZY-21-E7, which includes an expression cassette inserted in the middle of a 1.6-kb sequence that corresponds to the orfX, Y, Z domain of the LM genome.
- the homology domain allows for insertion of the E7 gene cassette into the orfZ domain by homologous recombination.
- Clones were screened for integration of the E7 gene cassette into the orfZ domain.
- Bacteria were grown in brain heart infusion medium with (Lm-LLO-E7 and Lm-LLO-NP) or without (Lm-E7 and ZY-18) chloramphenicol (20 ⁇ g/ml). Bacteria were frozen in aliquots at -80°C. Expression was verified by Western blotting ( Figure 2).
- the gels were transferred to polyvinylidene difluoride and probed with an anti-E7 monoclonal antibody (mAb) (Zymed Laboratories, South San Francisco, CA), then incubated with HRP-conjugated anti-mouse secondary Ab (Amersham Pharmacia Biotech, Little Chalfont, U.K.), developed with Amersham ECL detection reagents, and exposed to Hyperfilm (Amersham Pharmacia Biotech). Measurement of tumor growth
- Tumors were measured every other day with calipers spanning the shortest and longest surface diameters. The mean of these two measurements was plotted as the mean tumor diameter in millimeters against various time points. Mice were sacrificed when the tumor diameter reached 20 mm. Tumor measurements for each time point are shown only for surviving mice.
- E:T cell ratios were 80: 1, 40: 1, 20: 1, 10: 1, 5: 1, and 2.5: 1. Following a 4- h incubation at 37°C, cells were pelleted, and 50 ⁇ supernatant was removed from each well. Samples were assayed with a Wallac 1450 scintillation counter (Gaithersburg, MD). The percent specific lysis was determined as [(experimental counts per minute (cpm)- spontaneous cpm)/(total cpm - spontaneous cpm)] x 100.
- C57BL/6 mice were immunized with 0.1 LD 50 and boosted by i.p. injection 20 days later with 1 LD 50 Lm-LLO-E7, Lm-E7, Lm-LLO-NP, or Lm-Gag.
- spleens were harvested from immunized and naive mice.
- Splenocytes were established in culture at 5 x 10 5 /well in flat-bottom 96-well plates with 2.5 x 10 4 , 1.25 x 10 4 , 6 x 10 3 , or 3 x 10 3 irradiated TC-1 cells/well as a source of E7 Ag, or without TC-1 cells or with 10 ⁇ g/ml Con A.
- C57BL/6 mice were immunized intravenously (i.v.) with 0.1 LD 50 Lm-LLO-E7 or Lm- E7 and boosted 30 days later.
- Three-color flow cytometry for CD8 (53-6.7, PE conjugated), CD62 ligand (CD62L; MEL- 14, APC conjugated), and E7 H-2Db tetramer was performed using a FACSCalibur® flow cytometer with CellQuest® software (Becton Dickinson, Mountain View, CA).
- Splenocytes harvested 5 days after the boost were stained at room temperature (rt) with H- 2Db tetramers loaded with the E7 peptide (RAHYNIVTF) (SEQ ID NO: 29) or a control (HIV- Gag) peptide.
- Tetramers were used at a 1/200 dilution and were provided by Dr. Larry R. Pease (Mayo Clinic, Rochester, MN) and by the NIAID Tetramer Core Facility and the NIH AIDS Research and Reference Reagent Program. Tetramer "1" , CD8 + , CD62L low cells were analyzed.
- Lm-E7 and Lm-LLO-E7 were compared for their abilities to impact on TC-1 growth.
- Subcutaneous tumors were established on the left flank of C57BL/6 mice. Seven days later tumors had reached a palpable size (4-5 mm).
- Mice were vaccinated on days 7 and 14 with 0.1 LD 50 Lm-E7, Lm-LLO-E7, or, as controls, Lm-Gag and Lm-LLO-NP.
- Lm-LLO-E7 induced complete regression of 75% of established TC-1 tumors, while tumor growth was controlled in the other 2 mice in the group ( Figure 3). By contrast, immunization with Lm-E7 and Lm-Gag did not induce tumor regression.
- an antigen as a fusion protein with ALLO enhances the immunogenicity of the antigen.
- EXAMPLE 2 LM-LLO-E7 TREATMENT ELICITS TC-1 SPECIFIC SPLENOCYTE
- Lm-ActA-E7 is a recombinant strain of LM, comprising a plasmid that expresses the E7 protein fused to a truncated version of the actA protein.
- Lm-actA-E7 was generated by introducing a plasmid vector pDD-1, constructed by modifying pDP-2028, into Listeria.
- pDD-1 comprises an expression cassette expressing a copy of the 310 bp hly promoter and the hly signal sequence (ss), which drives the expression and secretion of ActA-E7; 1170 bp of the actA gene that comprises four PEST sequences (the truncated ActA polypeptide consists of the first 390 AA of the molecule; the 300 bp HPV E7 gene; the 1019 bp prfA gene (controls expression of the virulence genes); and the CAT gene (chloramphenicol resistance gene) for selection of transformed bacteria clones (Sewell et al. (2004), Arch. Otolaryngol. Head Neck Surg., 130: 92- 97).
- ss hly signal sequence
- hly promoter (pHly) and gene fragment were PCR amplified from pGG55 (Example 1) using primer 5'-GGGGTCTAGACCTCCTTTGATTAGTATATTC-3' (Xba I site is underlined; SEQ ID NO: 30) and primer 5'-
- the actA gene was PCR amplified from the LM 10403s wildtype genome using primer 5'- GCGCAACAAACTGAAGCAGCGGCCGCGGCGACAGATAGCGAAGAT-3' (Notl site is underlined; SEQ ID NO: 32) and primer 5'-
- the E7 gene was PCR amplified from pGG55 (pLLO-E7) using primer 5'-GGAATTGATCGCCTAGCTCTCGAGCATGGAGATACACCTACA-3' (Xhol site is underlined; SEQ ID NO: 34) and primer 5'-
- the prfA gene was PCR amplified from the LM 10403s wild-type genome using primer 5'-TGTTCTCAGAAACCATAACCCGGGATCTAAATAAATCCGTTT- 3' (Xmal site is underlined; SEQ ID NO: 36) and primer 5'- GGGGGTCGACC AGCTCTTCTTGGTGAAG-3 ' (Sail site is underlined; SEQ ID NO: 37).
- the hly promoter- actA gene fusion (pHly-actA) was PCR generated and amplified from purified pHly DNA and purified actA DNA using the upstream pHly primer (SEQ ID NO: 30) and downstream actA primer (SEQ ID NO: 33).
- the E7 gene fused to the prfA gene (E7-prfA) was PCR generated and amplified from purified E7 DNA and purified prfA DNA using the upstream E7 primer (SEQ ID NO: 34) and downstream prfA gene primer (SEQ ID NO: 37).
- the pHly-actA fusion product fused to the E7-prfA fusion product was PCR generated and amplified from purified fused pHly-actA DNA product and purified fused E7-prfA DNA product using the upstream pHly primer (SEQ ID NO: 30) and downstream prfA gene primer (SEQ ID NO: 37) and ligated into pCRII (Invitrogen, La Jolla, Calif.). Competent E. coli (TOPIO'F, Invitrogen, La Jolla, Calif.) were transformed with pCRII-ActAE7.
- the plasmid was screened by restriction analysis using BamHI (expected fragment sizes 770 bp and 6400 bp (or when the insert was reversed into the vector: 2500 bp and 4100 bp)) and BstXI (expected fragment sizes 2800 bp and 3900 bp) and also screened with PCR analysis using the upstream pHly primer (SEQ ID NO: 30) and the downstream prfA gene primer (SEQ ID NO: 37).
- pHly-actA-E7-prfA DNA insert was excised from pCRII by double digestion with Xba I and Sal I and ligated into pDP-2028 also digested with Xba I and Sal I.
- chloramphenicol resistant clones were screened by PCR analysis using the upstream pHly primer (SEQ ID NO: 30) and the downstream PrfA gene primer (SEQ ID NO: 37).
- a clone comprising pActAE7 was grown in brain heart infusion medium (with chloramphenicol (20 meg (microgram)/ml (milliliter), Difco, Detroit, Mich.) and pActAE7 was isolated from the bacteria cell using a midiprep DNA purification system kit (Promega, Madison, Wis.).
- a prfA-negative strain of penicillin-treated Listeria (strain XFL-7) was transformed with expression system pActAE7, as described in Ikonomidis et al. (1994, J. Exp. Med. 180: 2209-2218) and clones were selected for the retention of the plasmid in vivo.
- Clones were grown in brain heart infusion with chloramphenicol (20 mcg/ml) at 37 °C. Bacteria were frozen in aliquots at -80 °C.
- Lm-PEST-E7 is identical to Lm-LLO-E7, except that it contains only the promoter and PEST sequence of the hly gene, specifically the first 50 AA of LLO.
- the hly promoter and PEST regions were fused to the full-length E7 gene using the SOE (gene splicing by overlap extension) PCR technique.
- the E7 gene and the hly-PEST gene fragment were amplified from the plasmid pGG-55, which contains the first 441 AA of LLO, and spliced together by conventional PCR techniques.
- pVS 16.5 the hly-PEST-E7 fragment and the prfA gene were subcloned into the plasmid pAM401, which includes a chloramphenicol resistance gene for selection in vitro, and the resultant plasmid was used to transform XFL-7.
- Lm-APEST-E7 is a recombinant Listeria strain that is identical to Lm- LLO-E7 except that it lacks the PEST sequence. It was made essentially as described for Lm-PEST-E7, except that the episomal expression system was constructed using primers designed to remove the PEST-containing region (bp 333-387) from the hly-E7 fusion gene.
- Lm-E7epi is a recombinant strain that secretes E7 without the PEST region or LLO. The plasmid used to transform this strain contains a gene fragment of the hly promoter and signal sequence fused to the E7 gene.
- Lm-E7epi is completely isogenic to Lm- LLO-E7, Lm-PEST- E7, and Lm-APEST-E7 except for the form of the E7 antigen expressed.
- Lm-LLO-E7, Lm-PEST-E7, Lm-APEST-E7, and Lm-E7epi were compared for their ability to cause regression of E7-expressing tumors.
- S.c. TC-1 tumors were established on the left flank of 40 C57BL/6 mice. After tumors had reached 4-5 mm, mice were divided into 5 groups of 8 mice. Each groups was treated with 1 of 4 recombinant LM vaccines, and 1 group was left untreated.
- Lm-LLO-E7 and Lm-PEST-E7 induced regression of established tumors in 5/8 and 3/8 cases, respectively.
- EXAMPLE 4 FUSION OF E7 TO LLP, ActA, OR A PEST-LIKE SEQUENCE ENHANCES E7-SPECIFIC IMMUNITY AND GENERATES TUMOR-INFILTRATING
- [00313] 500 mcl (microliter) of MATRIGEL®, comprising 100 mcl of 2 x 10 5 TC-1 tumor cells in phosphate buffered saline (PBS) plus 400 mcl of MATRIGEL® (BD Biosciences, Franklin Lakes, N.J.) were implanted subcutaneously on the left flank of 12 C57BL/6 mice (n 3). Mice were immunized intraperitoneally on day 7, 14 and 21, and spleens and tumors were harvested on day 28. Tumor MATRIGELs were removed from the mice and incubated at 4 °C overnight in tubes containing 2 milliliters (ml) of RP 10 medium on ice.
- PBS phosphate buffered saline
- MATRIGEL® BD Biosciences, Franklin Lakes, N.J.
- Tumors were minced with forceps, cut into 2 mm blocks, and incubated at 37 °C for 1 hour with 3 ml of enzyme mixture (0.2 mg/ml collagenase-P, 1 mg/ml DNAse-1 in PBS). The tissue suspension was filtered through nylon mesh and washed with 5% fetal bovine serum + 0.05% of NaN 3 in PBS for tetramer and IFN- gamma staining.
- Splenocytes and tumor cells were incubated with 1 micromole (mem) E7 peptide for 5 hours in the presence of brefeldin A at 10' cells/ml.
- Cells were washed twice and incubated in 50 mcl of anti-mouse Fc receptor supernatant (2.4 G2) for 1 hour or overnight at 4 °C.
- Cells were stained for surface molecules CD8 and CD62L, permeabilized, fixed using the permeabilization kit Golgi-stop® or Golgi-Plug® (Pharmingen, San Diego, Calif.), and stained for IFN-gamma.
- H-2D b tetramer was loaded with phycoerythrin (PE)-conjugated E7 peptide (RAHYNIVTF, SEQ ID NO: 27), stained at rt for 1 hour, and stained with anti- allophycocyanin (APC) conjugated MEL- 14 (CD62L) and FITC-conjugated CD8 + at 4 °C for 30 min.
- PE phycoerythrin
- APC anti- allophycocyanin conjugated MEL- 14
- CD8 + FITC-conjugated CD8 + at 4 °C for 30 min.
- mice were implanted with TC-1 tumor cells and immunized with either Lm-LLO-E7 (1 x 10 CFU), Lm-E7 (1 x 10 6 CFU), or Lm-ActA-E7 (2 x 10 8 CFU), or were untreated (naive).
- Tumors of mice from the Lm-LLO-E7 and Lm-ActA-E7 groups contained a higher percentage of IFN-gamma- secreting CD8 + T cells ( Figure 7A) and tetramer- specific CD8 + cells ( Figure 7B) than in Lm-E7 or naive mice.
- mice were administered Lm-LLO-E7, Lm-PEST- E7, Lm-APEST-E7, or Lm-E7epi, and levels of E7-specific lymphocytes within the tumor were measured.
- Mice were treated on days 7 and 14 with 0.1 LD 50 of the 4 vaccines. Tumors were harvested on day 21 and stained with antibodies to CD62L, CD8, and with the E7/Db tetramer. An increased percentage of tetramer-positive lymphocytes within the tumor were seen in mice vaccinated with Lm-LLO-E7 and Lm-PEST-E7 (Figure 8A). This result was reproducible over three experiments ( Figure 8B).
- Lm-LLO-E7, Lm-ActA-E7, and Lm-PEST-E7 are each efficacious at induction of tumor-infiltrating CD8 + T cells and tumor regression.
- E. coli strain MB2159 was used for transformations, using standard protocols. Bacterial cells were prepared for electroporation by washing with H 2 0.
- E. coli strain MB2159 (Strych U et al, FEMS Microbiol Lett. 2001 Mar 15;196(2):93-8) is an air (-)/dadX (-) deficient mutant that is not able to synthesize D-alanine racemase.
- Listeria strain Lm dal(-)/dat(-) (Lmdd) similarly is not able to synthesize D-alanine racemase due to partial deletions of the dal and the dat genes. Plasmid Constructions
- Plasmid pDP1500 containing prfA alone, was constructed by deleting the plcA gene, bases 429 to 1349 (Mengaud et al., supra), from pDP1462 after restriction with Xbal and PstI, treatment of the DNA ends with T4 DNA polymerase to make them blunt, and intramolecular ligation.
- Plasmid pDP1499 containing the plcA promoter and a portion of the 3' end of plcA, was constructed by deleting a plcA internal fragment, bases 428 to 882 (Mengaud et al., Infect. Immun. 1989 57, 3695-3701), from pDP1339 after restriction with PstI and Nsil and intramolecular ligation.
- pDP1526 (pKSV7::ziplcA) was constructed by a single three-part ligation of pKSV7 restricted with BAMHI and Xbal, the 468 bp Xbal and Nsil-generated fragment from pAM401::plcA containing the 5' end of plcA (bases 882 to 1351; Mengaud et al., supra) and, the 501 bp PstI- and BamHI-generated fragment from pAM401::plcA prfA containing the 3' end of plcA (bases 77 to 429; Mengaud et al., supra).
- the prfA promoter, bases 1-429 (Mengaud et al., supra), was isolated by EcoRI and PstI double digestion of pDP1462 and the fragment was subsequently ligated into EcoRI-and Pstl- restricted pKSV7 to generate pDP1498.
- L. monocytogenes strain DP-L1387 was isolated as a mutant with reduced lecithinase (PC- PLC) from a Tn917-LTV3 bank of SLCC 5764, constructed as previously described (Camilli et al., J. Bacteriol. 1990, 172, 3738-3744). The site of Tn917-LTV3 insertion was determined by sequencing one transposon-chromosomal DNA junction as previously described (Sun et al., Infect. Immun. 1990 58, 3770-3778). L. monocytogenes was transformed with plasmid DNA as previously described (Camilli et al., supra).
- Integration of pKSV7 derivatives into the L. monocytogenes chromosome occurred by homologous recombination between L. monocytogenes DNA sequences on the plasmids and their corresponding chromosomal alleles. Integration mutants were enriched by growth for approximately 30 generations at 40°C, a non-permissive temperature for pKSV7 replication, in Brain Heart Infusion (BHI) broth containing 10 ⁇ g chloramphenicol per ml of media. Each integration strain was subsequently colony purified on BHI agar containing 10 ⁇ g chloramphenicol per ml of media and incubated at 40°C. Southern blot analyses of chromosomal DNA isolated from each integration strain confirmed the presence of the integrated plasmid.
- BHI Brain Heart Infusion
- DP-L1552 is achieved by integration of the pKSV7 derivative, pDP1526, to generate a merodiploid intermediate as described above. Spontaneous excision of the integrated plasmid, through intramolecular homologous recombination, occurred at a low frequency. Bacteria in which the plasmid had excised from the chromosome were enriched by growth at 30°C. in BHI broth for approximately 50 generations. The nature of the selective pressure during this step was not known but may be due to a slight growth defect of strains containing integrated temperature-sensitive plasmids. Approximately 50% of excision events, i.e., those resulting from homologous recombination between sequences 3' of the deletion, resulted in allelic exchange of AplcA for the wild-type allele on the chromosome.
- the excised plasmids were cured by growing the bacteria at 40°C in BHI for approximately 30 generations. Bacteria cured of the plasmid retaining the AplcA allele on the chromosome were identified by their failure to produce a zone of turbidity surrounding colonies after growth on BHI agar plates containing a 5 ml overlay of BHI agar/2.5% egg yolk/2.5% phosphate-buffered saline (PBS) (BHI/egg yolk agar). The turbid zones resulted from PI-PLC hydrolysis of PI in the egg yolk, giving an insoluble diacylglycerol precipitate. The correct plcA deletion on the L. monocytogenes chromosome was confirmed by amplifying the deleted allele using PCR and sequencing across the deletion.
- PBS phosphate-buffered saline
- PI-PLC negative mutants may be used according to the present disclosure to generate attenuated L. monocytogenes vaccines.
- Other mutants were made using the same method, namely, an actA deletion mutant, a plcB deletion mutant, and a double mutant lacking both pic A and plcB, all of which may also be used according to the present disclosure to generate attenuated L. monocytogenes vaccines.
- an actA deletion mutant a plcB deletion mutant
- a double mutant lacking both pic A and plcB all of which may also be used according to the present disclosure to generate attenuated L. monocytogenes vaccines.
- one skilled in the art would be able to create other attenuated mutants in addition to those mentioned above.
- the dal gene was initially inactivated by means of a double-allelic exchange between the chromosomal gene and the temperature-sensitive shuttle plasmid pKSV7 (Smith K et al, Biochimie. 1992 Jul-Aug;74(7-8):705-l l) carrying an erythromycin resistance gene between a 450-bp fragment from the 5' end of the original 850-bp dal gene PCR product and a 450-bp fragment from the 3' end of the dal gene PCR product.
- a dal deletion mutant covering 82% of the gene was constructed by a similar exchange reaction with pKSV7 carrying homology regions from the 5' and 3' ends of the intact gene (including sequences upstream and downstream of the gene) surrounding the desired deletion.
- PCR analysis was used to confirm the structure of this chromosomal deletion.
- chromosomal dat gene was inactivated by a similar allelic exchange reaction.
- pKSV7 was modified to carry 450-bp fragments derived by PCR from both the 5' and 3' ends of the intact dat gene (including sequences upstream and downstream of the gene). These two fragments were ligated by appropriate PCR. Exchange of this construct into the chromosome resulted in the deletion of 30% of the central bases of the dat gene, which was confirmed by PCR analysis.
- E. coli were cultured following standard methods. Listeria were grown at 37° C, 250 rpm shaking in LB media (Difco, Detroit, MI). + 50 ⁇ g/ml streptomycin, and harvested during exponential growth phase. For Lm-LLOE7, 37 ⁇ g/ml chloramphenicol was added to the media. For growth kinetics determinations, bacteria were grown for 16 hours in 10 ml of LB + antibiotics. The OD 6 oonm was measured and culture densities were normalized between the strains. The culture was diluted 1:50 into LB + suitable antibiotics and D-alanine if applicable.
- the first step in the construction of the antibiotic resistance gene-free vector was construction of a fusion of a truncated p60 promoter to the dal gene.
- the LM alanine racemase (dal) gene forward primer: 5'-CCA TGG TGA CAG GCT GGC ATC-3'; SEQ ID NO: 38) (reverse primer: 5'-GCT AGC CTA ATG GAT GTA TTT TCT AGG- 3'; SEQ ID NO: 39) and a minimal p60 promoter sequence (forward primer: 5'-TTA ATT AAC AAA TAG TTG GTA TAG TCC-3'; SEQ ID No: 40) (reverse primer: 5'-GAC GAT GCC AGC CTG TCA CCA TGG AAA ACT CCT CTC-3'; SEQ ID No: 41) were isolated by PCR amplification from the genome of LM strain 10403S.
- the primers introduced a Pad site upstream of the p60 sequence, an Nhel site downstream of the dal sequence (restriction sites in bold type), and an overlapping dal sequence (the first 18 bp) downstream of the p60 promoter for subsequent fusion of p60 and dal by splice overlap extension (SOE)-PCR.
- the sequence of the truncated p60 promoter was:
- the oriRep was PCR-amplified from pGG55, using a 5'-primer that added a Narl/Ehel site upstream of the sequence (GGCGCCACTAACTCAACGCTAGTAG, SEQ ID NO: 43) and a 3'-primer that added a Nhel site downstream of the sequence (GCTAGCCAGCAAAGAAAAACAAACACG, SEQ ID NO: 44).
- the PCR product was cloned into cloning vector pCR2.1 and sequence verified.
- the p60-dal expression cassette was excised from pCR-p60dal by Pacl hel double digestion.
- the replication region for gram-positive bacteria in pGG55 was amplified from pCR-oriRep by PCR (primer 1, 5'-GTC GAC GGT CAC CGG CGC CAC TAA CTC AAC GCT AGT AG-3'; SEQ ID No: 45); (primer 2, 5'-TTA ATT AAG CTA GCC AGC AAA GAA AAA CAA ACA CG-3'; SEQ ID No: 46) to introduce additional restriction sites for Ehel and Nhel.
- pTV3 also contains a prfA (pathogenicity regulating factor A) gene. This gene is not necessary for the function of pTV3, but can be used in situations wherein an additional selected marker is required or desired.
- Total Listeria DNA was prepared using the Masterpure® Total DNA kit (Epicentre, Madison, WI). Listeria were cultured for 24 hours at 37° C and shaken at 250 rpm in 25 ml of Luria-Bertoni broth (LB). Bacterial cells were pelleted by centrifugation, resuspended in PBS supplemented with 5 mg/ml of lysozyme and incubated for 20 minutes at 37° C, after which DNA was isolated.
- LB Luria-Bertoni broth
- the LLO-E7 gene was PCR amplified from pGG55 (5'-ATGAAAAAAATAATGCTAGTTTTTATTAC-3' (SEQ ID NO: 47); 5'-GCGGCCGCTTAATGATGATGATGATGATGTGGTTTCTG AGAACAGATG-3' (SEQ ID NO: 48)) and cloned into vector pETbluel (Novagen, San Diego, CA). Similarly, the plcA amplicon was cloned into pCR2.1. E. coli were transformed with pET-LLOE7 and pCR-plcA, respectively, and purified plasmid DNA was prepared for use in real-time PCR.
- Taqman primer-probe sets (Applied Biosystems, Foster City, CA) were designed using the ABI PrimerExpress software (Applied Biosystems) with E7 as a plasmid target, using the following primers: 5'-GCAAGTGTGACTCTACGCTTCG-3' (SEQ ID NO: 49); 5'- TGCCCATTAACAGGTCTTCCA-3' (SEQ ID NO: 50); 5'-FAM-TGCGTA CAAAGCACACACGTAGACATTCGTAC-TAMRA-3' (SEQ ID NO: 51) and the one-copy gene plcA (TGACATCGTTTGTGTTTGAGCTAG -3' (SEQ ID NO: 52), 5'- GCAGCGCTCTCTATACCAGGTAC-3' (SEQ ID NO: 53); 5'-TET-TTAATGTCCATGTTA TGTCTCCGTTATAGCTCATCGTA-TAMRA-3'; SEQ ID NO: 54) as a Listeria genome target.
- Defibrinated total sheep blood (Cedarlane, Hornby, Ontario, Canada) was washed twice with 5 volumes of PBS and three to four times with 6 volumes of PBS-Cysteine until the supernatant remained clear, pelleting cells at 3000 x g for 8 minutes between wash steps, then resuspended to a final concentration of 10 % (v/v) in PBS-Cysteine. 100 ⁇ of 10% washed blood cells were mixed with 100 ⁇ of Listeria suspension and incubated for additional 45 minutes at 37° C. Un-lysed blood cells were then pelleted by centrifugation (10 minutes, 1000 x g). 100 ⁇ of supernatant was transferred into a new plate and the OD53o nm was determined and plotted against the sample dilution.
- TC-1 is a C57BL/6 epithelial cell line that was immortalized with HPV E6 and E7 and transformed with activated ras, which forms tumors upon subcutaneous implantation. Mice were immunized with 0.1 LD 50 of the appropriate Listeria strain on days 7 and 14 following implantation of tumor cells. A non- immunized control group (naive) was also included. Tumor growth was measured with electronic calipers.
- the strain Lm dal dat (Lmdd) was attenuated by the irreversible deletion of the virulence factor, ActA.
- An in frame deletion of actA in the Lmdaldat (Lmdd) background was constructed to avoid any polar effects on the expression of downstream genes.
- the Lm dal dat AactA contains the first 19 amino acids at the N-terminal and 28 amino acid residues of the C-terminal with a deletion of 591 amino acids of ActA.
- the deletion of the gene into the chromosomal spot was verified using primers that anneal external to the actA deletion region.
- primers 3 (Adv 305-tgggatggccaagaaattc) (SEQ ID NO: 55) and 4 (Adv304-ctaccatgtcttccgttgcttg) (SEQ ID NO: 56) as shown in the Fig. 12.
- the PCR analysis was performed on the chromosomal DNA isolated from Lmdd and Lm-ddAaciA.
- the sizes of the DNA fragments after amplification with two different set of primer pairs 1, 2 and 3, 4 in Lm-dd chromosomal DNA was expected to be 3.0 Kb and 3.4 Kb.
- the expected sizes of PCR using the primer pairs 1, 2 and 3, 4 was 1.2 Kb and 1.6 Kb.
- PCR analysis in Fig. 12 confirms that 1.8 kb region of actA was deleted in the strain, Lm-ddAactA.
- DNA sequencing was also performed on PCR products to confirm the deletion of actA containing region in the strain, Lm-ddAactA ( Figure 13, SEQ ID NO: 57).
- Macrophages such as RAW 264.7 are infected with different Listeria backbones such as Lm prfA- (pGG55), Lm dal dat, Lm dal dat actA, Lm dal dat actA ⁇ inlC and Lm dal dat ⁇ inlC and supernatant is harvested at different time points to quantify the level of various cytokines using different ELISA based kits.
- the cytokines that are quantified include IFN- ⁇ , TNF-a and IL-6.
- In vivo cytokine production To measure the in vivo cytokine production and recruitment of neutrophils, C57BL/6 mice are injected intraperitoneally with different 10 CFU of Lm prfA- (pGG55), Lm dal dat, Lm dal dat actA, Lm dal dat actA ⁇ inlC and Lm dal dat ⁇ inlC, Listeria control or an equivalent volume of saline. After 12 h mice are killed and peritoneal cavities are washed with 2 mL of PBS. The peritoneal washes are examined for bacterial load after plating on growth medium and analysis of proinflammatory cytokines such as MIP-loc, KC, MCP etc. Using flow cytometry the number of neutrophils and macrophages is determine after staining with markers such as Gr-1, CD1 lb and F4/80 and further these populations are quantified using CellQuest software.
- Lm prfA- pGG55
- Lm dal dat
- This assay is done to determine if there is an increase in the migration of neutrophils following infection of bone marrow derived macrophages or dendritic cells with the inlC deletion strain.
- Bone marrow-derived macrophages or dendritic cells are isolated from mice such as C57BL/6 and are infected with the inlC deletion mutants or control Listeria.
- the transwell assay is set up using corning costar Transwell plates. The assay is initially standardized using 3, 5, or 8 micron pore transwell plates. To test neutrophil migration, plate the infected APCs in the bottom of the plate and the neutrophils in the top of the well in the chamber. At different time points the cells are counted to determine the number of neutrophils that have migrated to the bottom.
- Therapeutic efficacy of the Lm dal dat actA ⁇ inlC mutant [00350] To determine the therapeutic efficacy of inlC mutant, human Prostate specific antigen (PSA) is used as tumor antigen as proof of concept.
- PSA Prostate specific antigen
- the backbone Lm dal dat actA inlC are transformed with the plasmid, pAdvl42 that contains expression cassette for human PSA resulting in LmddAm/C142.
- the strain LmddAm/C142 is characterized for the expression and secretion of fusion protein, tLLO-PSA.
- strain LmddAm/C142 are passaged twice in vivo in mice and the colonies obtained after two in vivo passages are examined for the expression and secretion of fusion protein, tLLO-PSA.
- the vaccine working stock are prepared from the colonies obtained after second in vivo passage and this are used for the assessment of therapeutic effects and immunogenicity.
- mice are inoculated with 1 x 10 6 TPSA23 tumor cells on day 0 and are vaccinated on day 7, 14 and 21 with 10 CFU of LmddAz ' n/ 142, LmddA 142 and other control strains.
- Tumors are harvested on day 28 and processed for further staining with different cell surface markers such as Gr-1, CDl lb, CD3, CD4, CD8, CD25, Foxp3, NK1.1 and CD62L.
- cell surface markers such as Gr-1, CDl lb, CD3, CD4, CD8, CD25, Foxp3, NK1.1 and CD62L.
- different cell populations that are examined include macrophages (CDl lb + ), NK cells (NK1.1 + ), neutrophils (Gr-1 + CDl lb + ), myeloid derived suppressor cells (MDSCs) (Gr-l + CDl lb + ), regulatory T cells (CD4 + CD25 + Foxp3 + ) and effector T cells (CD8 + CD3 + CD62L low ).
- Further effector T cells are characterized for their functional ability to produce effector cytokines such as IFN- ⁇ , TNF-oc and IL-2.
- the intratumoral regulatory T cells and MDSCs are tested for their ability to cause
- EXAMPLE 5 A PLASMID CONTAINING AN AMINO ACID METABOLISM ENZYME INSTEAD OF AN ANTIBIOTIC RESISTANCE GENE IS RETAINED IN E.
- E. coli strain MB2159 is an air (-)/dadX (-) deficient mutant that is not able to synthesize D-alanine racemase.
- Listeria strain Lm dal(-)/dat(-) (Lmdd) similarly is not able to synthesize D-alanine racemase due to partial deletions of the dal and the dat genes.
- Plasmid pGG55 which is based on E.
- metabolic enzyme-containing plasmids are efficacious as a therapeutic cancer vaccine. Because immune responses required for a therapeutic cancer vaccine are stronger than those required for a prophylactic cancer vaccine, these results demonstrate utility as well for a prophylactic cancer vaccine.
- EXAMPLE 8 m/C-DELETION MUTANT GENERATE SIGNIFICANTLY HIGH LEVELS OF THE CHEMOKINES AND CYTOKINES.
- inlC deletion mutant generates significantly high levels of the chemokines such as MIP- loc, KC (mouse homolog of IL-8), MCP resulting in infiltration of neutrophils and leukocytes towards the site of infection.
- the inlC mutant demonstrate an increase production of these cytokines and chemokines, which attract neutrophils and macrophages in the peritoneal fluid obtained 12 h after injection.
- inlC deletion mutant generate significantly high levels of the inflammatory cytokines when compared to control strains.
- the macrophages infected with inlC deletion mutant show significant increase in the migration of neutrophils at different time points when compared to other control strains.
- the results of this experiment strongly support the ability of this strain to attract immune cells such as neutrophils during infection.
- Oligonucleotides were synthesized by Invitrogen (Carlsbad, CA) and DNA sequencing was done by Genewiz Inc, South Plainfield, NJ.
- Flow cytometry reagents were purchased from Becton Dickinson Biosciences (BD, San Diego, CA). Cell culture media, supplements and all other reagents, unless indicated, were from Sigma (St. Louise, MO).
- Her2/neu HLA-A2 peptides were synthesized by EZbiolabs (Westfield, IN).
- C-RPMI 1640 (C-RPMI) medium contained 2mM glutamine, 0.1 mM non-essential amino acids, and ImM sodium pyruvate, 10% fetal bovine serum, penicillin/streptomycin, Hepes (25 mM).
- the polyclonal anti-LLO antibody was described previously and anti-Her2/neu antibody was purchased from Sigma.
- FVB/N mice were purchased from Jackson laboratories (Bar Harbor, ME).
- the FVB/N Her2/neu transgenic mice, which overexpress the rat Her2/neu onco-protein were housed and bred at the animal core facility at the University of Pennsylvania.
- the NT-2 tumor cell line expresses high levels of rat Her2/neu protein, was derived from a spontaneous mammary tumor in these mice and grown as described previously.
- DHFR-G8 (3T3/neu) cells were obtained from ATCC and were grown according to the ATCC recommendations.
- the EMT6-Luc cell line was a generous gift from Dr.
- Her2/neu-pGEM7Z was kindly provided by Dr. Mark Greene at the University of Pennsylvania and contained the full-length human Her2/neu (hHer2) gene cloned into the pGEM7Z plasmid (Promega, Madison WI). This plasmid was used as a template to amplify three segments of hHer-2/neu, namely, ECl, EC2, and IC1, by PCR using pfx DNA polymerase (Invitrogen) and the oligos indicated in Table 1.
- ChHer2 gene was excised from pAdvl38 using Xhol and Spel restriction enzymes, and cloned in frame with a truncated, non-hemolytic fragment of LLO in the Lmdd shuttle vector, pAdvl34.
- the sequences of the insert, LLO and hly promoter were confirmed by DNA sequencing analysis.
- This plasmid was electroporated into electro-competent actA, dal, dat mutant Listeria monocytogenes strain, LmddA and positive clones were selected on Brain Heart infusion (BHI) agar plates containing streptomycin (250 ⁇ g/ml).
- mice Groups of 3-5 FVB/N mice were immunized three times with one week intervals with 1 x 10 8 colony forming units (CFU) of Lm-LLO-ChHer2, ADXS31-164, Lm-hHer2 ICI or Lm-control (expressing an irrelevant antigen) or were left naive.
- CFU colony forming units
- NT-2 cells were grown in vitro, detached by trypsin and treated with mitomycin C (250 glr ⁇ in serum free C-RPMI medium) at 37°C for 45 minutes.
- splenocytes harvested from immunized or naive animals at a ratio of 1:5 (Stimulator: Responder) for 5 days at 37°C and 5% C0 2 .
- a standard cytotoxicity assay was performed using europium labeled 3T3/neu (DHFR-G8) cells as targets according to the method previously described. Released europium from killed target cells was measured after 4 hour incubation using a spectrophotometer (Perkin Elmer, Victor ) at 590 nm. Percent specific lysis was defined as (lysis in experimental group-spontaneous lysis)/(Maximum lysis-spontaneous lysis).
- mice Groups of 3-5 FVB/N or HLA-A2 transgenic mice were immunized three times with one week intervals with 1 x 10 CFU of ADXS31-164, a negative Listeria control (expressing an irrelevant antigen) or were left naive. Splenocytes from FVB/N mice were isolated one week after the last immunization and co-cultured in 24 well plates at 5 x 10 6 cells/well in the presence of mitomycin C treated NT-2 cells in C-RPMI medium.
- Splenocytes from the HLA-A2 transgenic mice were incubated in the presence of ⁇ of HLA-A2 specific peptides or ⁇ g/ml of a recombinant His-tagged ChHer2 protein, produced in E. coli and purified by a nickel based affinity chromatography system. Samples from supernatants were obtained 24 or 72 hours later and tested for the presence of interferon- ⁇ (IFN- ⁇ ) using mouse IFN- ⁇ Enzyme-linked immunosorbent assay (ELISA) kit according to manufacturer's recommendations.
- IFN- ⁇ interferon- ⁇
- ELISA Enzyme-linked immunosorbent assay
- ADXS31-164 Effect of ADXS31-164 on regulatory T cells in spleens and tumors
- mice were implanted subcutaneously (s.c.) with 1 x 10 6 NT-2 cells. On days 7, 14 and 21, they were immunized with 1 x 10 CFUs of ADXS31-164, LmddA -control or left naive. Tumors and spleens were extracted on day 28 and tested for the presence of CD3 + /CD4 + /FoxP3 + Tregs by FACS analysis. Briefly, splenocytes were isolated by homogenizing the spleens between two glass slides in C-RPMI medium.
- Tumors were minced using a sterile razor blade and digested with a buffer containing DNase (12U/ml), and collagenase (2mg/ml) in PBS. After 60 min incubation at RT with agitation, cells were separated by vigorous pipetting. Red blood cells were lysed by RBC lysis buffer followed by several washes with complete RPMI-1640 medium containing 10% FBS. After filtration through a nylon mesh, tumor cells and splenocytes were resuspended in FACS buffer (2% FBS/PBS) and stained with anti-CD3-PerCP-Cy5.5, CD4-FITC, CD25-APC antibodies followed by permeabilization and staining with anti-Foxp3-PE. Flow cytometry analysis was performed using 4-color FACS calibur (BD) and data were analyzed using cell quest software (BD).
- BD 4-color FACS calibur
- ChHer2 gene was generated by direct fusion of two extracellular (aa 40-170 and aa 359-433) and one intracellular fragment (aa 678-808) of the Her2/neu protein by SOEing PCR method.
- the chimeric protein harbors most of the known human MHC class I epitopes of the protein.
- ChHer2 gene was excised from the plasmid, pAdvl38 (which was used to construct Lm-LLO-ChHer2) and cloned into LmddA shuttle plasmid, resulting in the plasmid pAdvl64 ( Figure 15A). There are two major differences between these two plasmid backbones.
- pAdvl38 uses the chloramphenicol resistance marker (cat) for in vitro selection of recombinant bacteria
- pAdvl64 harbors the D-alanine racemase gene (dal) from bacillus subtilis, which uses a metabolic complementation pathway for in vitro selection and in vivo plasmid retention in LmddA strain which lacks the dal-dat genes.
- This vaccine platform was designed and developed to address FDA concerns about the antibiotic resistance of the engineered Listeria vaccine strains.
- pAdvl64 does not harbor a copy of the prfA gene in the plasmid (see sequence below and Fig.
- LmddA vaccine strain also lacks the actA gene (responsible for the intracellular movement and cell-to-cell spread of Listeria) so the recombinant vaccine strains derived from this backbone are 100 times less virulent than those derived from the Lmdd, its parent strain. LmddA-based vaccines are also cleared much faster (in less than 48 hours) than the Lmdd-based vaccines from the spleens of the immunized mice.
- EXAMPLE 12 ADXS31-164 IS AS IMMUNOGENIC AS LM-LLO-ChHER2.
- ADXS31-164 was also able to stimulate the secretion of IFN- ⁇ by the splenocytes from wild type FVB/N mice ( Figure 16B). This was detected in the culture supernatants of these cells that were co-cultured with mitomycin C treated NT-2 cells, which express high levels of Her2/neu antigen (Figure 19C).
- ADXS31-164 is able to elicit anti-Her2/neu specific immune responses to human epitopes that are located at different domains of the targeted antigen.
- EXAMPLE 13 ADXS31-164 WAS MORE EFFICACIOUS THAN LM-LLO-ChHER2 IN PREVENTING THE ONSET OF SPONTANEOUS MAMMARY TUMORS.
- ADXS31-164 Anti-tumor effects of ADXS31-164 were compared to those of Lm-LLO-ChHer2 in Her2/neu transgenic animals which develop slow growing, spontaneous mammary tumors at 20- 25 weeks of age. All animals immunized with the irrelevant Listeria-control vaccine developed breast tumors within weeks 21-25 and were sacrificed before week 33. In contrast, Liseria- Her2/neu recombinant vaccines caused a significant delay in the formation of the mammary tumors. On week 45, more than 50% of ADXS31-164 vaccinated mice (5 out of 9) were still tumor free, as compared to 25% of mice immunized with Lm-LLO-ChHer2.
- EXAMPLE 14 MUTATIONS IN HER2/NEU GENE UPON IMMUNIZATION WITH
- EXAMPLE 15 ADXS31-164 CAUSES A SIGNIFICANT DECREASE IN INTRA- TUMORAL T REGULATORY CELLS.
- mice were implanted with NT-2 tumor cells.
- Splenocytes and intra-tumoral lymphocytes were isolated after three immunizations and stained for Tregs, which were defined as CD3 + /CD4 + /CD25 + /FoxP3 + cells, although comparable results were obtained with either FoxP3 or CD25 markers when analyzed separately.
- This expression system is designed to facilitate cloning of panels of recombinant proteins containing distinct peptide moieties at the carboxy-terminus. This is accomplished by a simple PCR reaction utilizing a sequence encoding one of the SS-Ub-Peptide constructs as a template. By using a primer that extends into the carboxy-terminal region of the Ub sequence and introducing codons for the desired peptide sequence at the 3' end of the primer, a new SS-Ub- Peptide sequence can be generated in a single PCR reaction. The 5' primer encoding the bacterial promoter and first few nucleotides of the ActA signal sequence is the same for all constructs.
- Fig 1 The constructs generated using this strategy are represented schematically in Fig 1.
- two constructs are described.
- One contains a model peptide antigen presented on mouse MHC class I and the second construct indicates where a therapeutically relevant peptide, such as one derived from a human glioblastoma (GBM) TAA, would be substituted.
- GBM human glioblastoma
- One of the advantages of the proposed system is that it will be possible to load cells with multiple peptides using a single Listeria vector construct. Multiple peptides will be introduce into recombinant attenuated Listeria (e.g. prfA mutant Listeria or a dal/dat/actA mutant Listeria) using a modification of the single peptide expression system described above.
- a chimeric protein encoding multiple distinct peptides from sequential SS-Ub-Peptide sequences encoded in one insert. Shine-Dalgarno ribosome binding sites are introduced before each SS-Ub- Peptide coding sequence to enable separate translation of each of the peptide constructs.
- Figure 1C demonstrates a schematic representation of a construct designed to express 4 separate peptide antigens from one strain of recombinant Listeria. Since this is strictly a representation of the general expression strategy, we have included 4 distinct MHC class I binding peptides derived from known mouse or human tumor associated- or infectious disease antigens.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Mycology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Oncology (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562127614P | 2015-03-03 | 2015-03-03 | |
PCT/US2016/020571 WO2016141121A1 (en) | 2015-03-03 | 2016-03-03 | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
EP3265553A1 true EP3265553A1 (en) | 2018-01-10 |
EP3265553A4 EP3265553A4 (en) | 2018-11-07 |
Family
ID=56848625
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP16759454.8A Pending EP3265553A4 (en) | 2015-03-03 | 2016-03-03 | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof |
Country Status (14)
Country | Link |
---|---|
US (3) | US10900044B2 (en) |
EP (1) | EP3265553A4 (en) |
JP (2) | JP6921750B2 (en) |
KR (1) | KR20170120119A (en) |
CN (1) | CN107406822A (en) |
AU (2) | AU2016226247B2 (en) |
CA (1) | CA2978082A1 (en) |
HK (1) | HK1248758A1 (en) |
IL (2) | IL290248B2 (en) |
MA (1) | MA41644A (en) |
MX (1) | MX2017011246A (en) |
SG (2) | SG11201706969YA (en) |
TW (2) | TWI808415B (en) |
WO (1) | WO2016141121A1 (en) |
Families Citing this family (17)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9012141B2 (en) | 2000-03-27 | 2015-04-21 | Advaxis, Inc. | Compositions and methods comprising KLK3 of FOLH1 antigen |
WO2012125551A1 (en) | 2011-03-11 | 2012-09-20 | Advaxis | Listeria-based adjuvants |
CN104411327A (en) | 2012-03-12 | 2015-03-11 | 阿德瓦希斯公司 | Suppressor cell function inhibition following listeria vaccine treatment |
US10143734B2 (en) | 2014-02-18 | 2018-12-04 | Advaxis, Inc. | Biomarker directed multi-target immunotherapy |
SG10202011841WA (en) | 2014-04-24 | 2021-01-28 | Advaxis Inc | Recombinant listeria vaccine strains and methods of producing the same |
MA41644A (en) | 2015-03-03 | 2018-01-09 | Advaxis Inc | LISTERIA-BASED COMPOSITIONS INCLUDING A MINIGEN EXPRESSION SYSTEM CODING PEPTIDES, AND METHODS OF USE THEREOF |
RU2729116C2 (en) | 2015-12-16 | 2020-08-04 | Гритстоун Онколоджи, Инк. | Identification, production and use of neoantigens |
EP3481854A4 (en) * | 2016-07-05 | 2020-07-29 | Advaxis, Inc. | Listeria-based immunogenic compositions comprising wilms tumor protein antigens and methods of use thereof |
SG11201901979SA (en) * | 2016-11-30 | 2019-04-29 | Advaxis Inc | Immunogenic compositions targeting recurrent cancer mutations and methods of use thereof |
WO2018102585A1 (en) * | 2016-11-30 | 2018-06-07 | Advaxis, Inc. | Personalized immunotherapy in combination with immunotherapy targeting recurrent cancer mutations |
WO2019006401A2 (en) * | 2017-06-30 | 2019-01-03 | Advaxis, Inc. | Listeria-based immunogenic compositions comprising heteroclitic wilms tumor protein antigens and methods of use thereof |
MX2020003100A (en) | 2017-09-19 | 2020-08-20 | Advaxis Inc | COMPOSITIONS AND METHODS FOR LYOPHILIZATION OF BACTERIA OR <i>LISTERIA </i>STRAINS. |
KR20200087143A (en) | 2017-10-10 | 2020-07-20 | 그릿스톤 온콜로지, 인코포레이티드 | Identification of new antigens using hot spots |
CA3081710A1 (en) * | 2017-11-08 | 2019-05-16 | Advaxis, Inc. | Immunogenic heteroclitic peptides from cancer-associated proteins and methods of use thereof |
JP2021503897A (en) | 2017-11-22 | 2021-02-15 | グリットストーン オンコロジー インコーポレイテッド | Reduced junction epitope presentation for nascent antigens |
CN111979162B (en) * | 2019-05-22 | 2024-02-13 | 上海市公共卫生临床中心 | Recombinant bacillus calmette-guerin strain, preparation method and application thereof |
WO2020239947A1 (en) * | 2019-05-29 | 2020-12-03 | Centre National De La Recherche Scientifique | Prognosis method of leukemia |
Family Cites Families (84)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
US5830702A (en) | 1990-10-31 | 1998-11-03 | The Trustees Of The University Of Pennsylvania | Live, recombinant listeria monocytogenes and production of cytotoxic T-cell response |
US7820180B2 (en) | 2004-09-24 | 2010-10-26 | The Trustees Of The University Of Pennsylvania | Listeria-based and LLO-based vaccines |
US8791237B2 (en) | 1994-11-08 | 2014-07-29 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of non-hodgkins lymphoma |
US6051237A (en) | 1994-11-08 | 2000-04-18 | The Trustees Of The University Of Pennsylvania | Specific immunotherapy of cancer using a live recombinant bacterial vaccine vector |
US8956621B2 (en) | 1994-11-08 | 2015-02-17 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cervical dysplasia |
US7662396B2 (en) | 2001-03-26 | 2010-02-16 | The Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing the immunogenicity of antigens |
US7635479B2 (en) | 2000-03-29 | 2009-12-22 | The Trustees Of The University Of Pennsylvania | Composition and methods for enhancing immunogenecity of antigens |
US7794729B2 (en) | 1994-11-08 | 2010-09-14 | The Trustees Of The University Of Pennsylvania | Methods and compositions for immunotherapy of cancer |
US8114414B2 (en) | 1994-11-08 | 2012-02-14 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treatment of cervical cancer |
US20070264279A1 (en) | 1994-11-08 | 2007-11-15 | Claudia Gravekamp | Compositions and methods comprising a MAGE-b antigen |
WO1998012332A1 (en) | 1996-09-17 | 1998-03-26 | Chiron Corporation | Compositions and methods for treating intracellular diseases |
US6099848A (en) | 1997-11-18 | 2000-08-08 | The Trustees Of The University Of Pennsylvania | Immunogenic compositions comprising DAL/DAT double-mutant, auxotrophic, attenuated strains of Listeria and their methods of use |
GB9726555D0 (en) | 1997-12-16 | 1998-02-11 | Smithkline Beecham Plc | Vaccine |
US20030138808A1 (en) * | 1998-02-19 | 2003-07-24 | Simard John J.L. | Expression vectors encoding epitopes of target-associated antigens |
CA2393688A1 (en) | 1999-12-09 | 2001-06-14 | Chiron Corporation | Method for administering a cytokine to the central nervous system and the lymphatic system |
US9012141B2 (en) | 2000-03-27 | 2015-04-21 | Advaxis, Inc. | Compositions and methods comprising KLK3 of FOLH1 antigen |
US6855320B2 (en) | 2000-03-29 | 2005-02-15 | The Trustees Of The University Of Pennsylvania | Fusion of non-hemolytic, truncated form of listeriolysin O to antigens to enhance immunogenicity |
US7700344B2 (en) | 2001-03-26 | 2010-04-20 | The Trustees Of The University Of Pennsylvania | Compositions and methods for enhancing the immunogenicity of antigens |
US8771702B2 (en) | 2001-03-26 | 2014-07-08 | The Trustees Of The University Of Pennsylvania | Non-hemolytic LLO fusion proteins and methods of utilizing same |
AUPR446801A0 (en) * | 2001-04-18 | 2001-05-17 | University Of Queensland, The | Novel compositions and uses therefor |
WO2004062597A2 (en) | 2003-01-09 | 2004-07-29 | The Trustees Of The University Of Pennsylvania | Compositions, methods and kits for enhancing the immunogenicity of a bacterial vaccine vector |
US7855064B2 (en) | 2004-08-13 | 2010-12-21 | The Trustees Of The University Of Pennsylvania | Antibiotic resistance free vaccines and methods for constructing and using same |
ES2684749T3 (en) | 2004-08-13 | 2018-10-04 | The Trustees Of The University Of Pennsylvania | Methods to build vaccines without antibiotic resistance |
US7858097B2 (en) | 2004-08-13 | 2010-12-28 | The Trustees Of The University Of Pennsylvania | Antibiotic resistance free Listeria strains and methods for constructing and using same |
US9034650B2 (en) | 2005-02-02 | 2015-05-19 | Intrexon Corporation | Site-specific serine recombinases and methods of their use |
US7935804B2 (en) * | 2006-03-01 | 2011-05-03 | Aduro Biotech | Engineered Listeria and methods of use thereof |
US8268326B2 (en) | 2006-08-15 | 2012-09-18 | The Trustees Of The University Of Pennsylvania | Compositions comprising HMW-MAA and fragments thereof, and methods of use thereof |
WO2008079172A2 (en) | 2006-08-15 | 2008-07-03 | The Trustees Of The University Of Pennsylvania | Compositions comprising hmw-maa and fragments thereof, and methods of use thereof |
EP2147092A4 (en) | 2007-04-16 | 2010-06-09 | Univ Pennsylvania | Antibiotic resistance free listeria strains and methods for constructing and using same |
US9017660B2 (en) | 2009-11-11 | 2015-04-28 | Advaxis, Inc. | Compositions and methods for prevention of escape mutation in the treatment of Her2/neu over-expressing tumors |
EP2853269B1 (en) | 2008-05-19 | 2019-05-01 | Advaxis, Inc. | Dual delivery system for heterologous antigens comprising a recombinant Listeria strain attenuated by mutation of dal/dat and deletion of ActA comprising a nucleic acid molecule encoding an listeriolysin O - prostate specific anigen fusion protein |
US20140234370A1 (en) | 2009-11-11 | 2014-08-21 | Advaxis, Inc. | Compositions and methods for prevention of escape mutation in the treatment of her2/neu over-expressing tumors |
US20150366955A9 (en) | 2009-11-11 | 2015-12-24 | Advaxis, Inc. | Compositions and methods for prevention of escape mutation in the treatment of her2/neu over-expressing tumors |
US20120135033A1 (en) | 2008-05-19 | 2012-05-31 | Anu Wallecha | Multiple delivery system for heterologous antigens |
US9650639B2 (en) | 2008-05-19 | 2017-05-16 | Advaxis, Inc. | Dual delivery system for heterologous antigens |
JP5539411B2 (en) | 2009-03-04 | 2014-07-02 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | Compositions containing angiogenic factors and methods of use thereof |
JP5985397B2 (en) | 2009-11-11 | 2016-09-06 | アドバクシス インコーポレイテッド | Recombinant Listeria strain and immunogenic composition containing the same |
US10016617B2 (en) | 2009-11-11 | 2018-07-10 | The Trustees Of The University Of Pennsylvania | Combination immuno therapy and radiotherapy for the treatment of Her-2-positive cancers |
WO2011100754A1 (en) | 2010-02-15 | 2011-08-18 | The Trustees Of The University Of Pennsylvania | Live listeria-based vaccines for central nervous system therapy |
US20110305724A1 (en) | 2010-04-19 | 2011-12-15 | Yvonne Paterson | Immunotherapeutic, anti-tumorigenic compositions and methods of use thereof |
WO2012138377A2 (en) | 2010-10-01 | 2012-10-11 | Trustees Of The University Of Pennsylvania | The use of listeria vaccine vectors to reverse vaccine unresponsiveness in parasitically infected individuals |
WO2012125551A1 (en) | 2011-03-11 | 2012-09-20 | Advaxis | Listeria-based adjuvants |
CN104411327A (en) | 2012-03-12 | 2015-03-11 | 阿德瓦希斯公司 | Suppressor cell function inhibition following listeria vaccine treatment |
BR112015015076A2 (en) | 2012-12-27 | 2018-10-30 | Aduro Biotech Inc | signal peptide fusion partners that facilitate listerial expression of antigenic sequences and methods of preparing and using them. |
CN103550789B (en) * | 2013-11-25 | 2015-04-22 | 苏州大学 | Preparation and application of oral tumor vaccine with attenuated salmonella typhimurium as vector |
US10143734B2 (en) | 2014-02-18 | 2018-12-04 | Advaxis, Inc. | Biomarker directed multi-target immunotherapy |
CA2940646A1 (en) | 2014-02-25 | 2015-09-03 | Advaxis, Inc. | Compositions and methods for the treatment of her2/neu over-expressing tumors |
AU2015227163A1 (en) | 2014-03-05 | 2016-10-20 | Advaxis, Inc. | Methods and compositions for increasing a T-effector cell to regulatory T cell ratio |
SG10202011841WA (en) | 2014-04-24 | 2021-01-28 | Advaxis Inc | Recombinant listeria vaccine strains and methods of producing the same |
KR20170002552A (en) | 2014-05-02 | 2017-01-06 | 더 트러스티스 오브 더 유니버시티 오브 펜실베니아 | Combination immuno therapy and radiotherapy for the treatment of her-2-positive cancers |
WO2016011353A1 (en) | 2014-07-18 | 2016-01-21 | Advaxis, Inc. | Recombinant listeria strain expressing heterologous antigen fusion proteins and methods of use thereof |
US20180064765A1 (en) | 2014-07-18 | 2018-03-08 | Advaxis, Inc. | Listeria-based immunogenic compositions for eliciting anti-tumor responses |
KR20170052569A (en) | 2014-07-18 | 2017-05-12 | 어드박시스, 인크. | Combination of a pd-1 antagonist and a listeria-based vaccine for treating prostate cancer |
WO2016011320A1 (en) | 2014-07-18 | 2016-01-21 | Advaxis, Inc. | Bivalent listeria-based delivery system of heterologous antigens |
JP2017536095A (en) | 2014-10-14 | 2017-12-07 | ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア | Recombinant Listeria vaccine strain and method of use in cancer immunotherapy |
MA41217A (en) | 2014-12-19 | 2017-10-24 | Advaxis Inc | POLYTHERAPIES WITH RECOMBINATED LISTERIA STRAINS |
WO2016126878A2 (en) | 2015-02-03 | 2016-08-11 | The Trustees Of The University Of Pennsylvania | Listeria-based immunomodulation |
WO2016126876A2 (en) | 2015-02-03 | 2016-08-11 | Advaxis, Inc. | Listeria-based adjuvants |
US20160220652A1 (en) | 2015-02-03 | 2016-08-04 | Advaxis, Inc. | Methods of using recombinant listeria vaccine strains in disease immunotherapy |
MA41644A (en) | 2015-03-03 | 2018-01-09 | Advaxis Inc | LISTERIA-BASED COMPOSITIONS INCLUDING A MINIGEN EXPRESSION SYSTEM CODING PEPTIDES, AND METHODS OF USE THEREOF |
WO2016154412A2 (en) | 2015-03-26 | 2016-09-29 | The Trustees Of The University Of Pennsylvania | Combination of a pd-1 antagonist and a listeria based vaccine for treating pancreatic cancer |
US20180104284A1 (en) | 2015-05-13 | 2018-04-19 | Advaxis, Inc. | Immunogenic Listeria-Based Compositions Comprising Truncated Acta-Antigen Fusions And Methods Of Use Thereof |
TW201708536A (en) | 2015-05-26 | 2017-03-01 | 艾法西斯公司 | Personalized delivery vector-based immunotherapy and uses thereof |
AU2016281958A1 (en) * | 2015-06-24 | 2018-02-15 | Advaxis, Inc. | Manufacturing device and process for personalized delivery vector-based immunotherapy |
CA2998857A1 (en) | 2015-09-15 | 2017-03-23 | Anu Wallecha | Manufacturing method of an immunotherapeutic formulation comprising a recombinant listeria strain |
US20180305702A1 (en) | 2015-09-15 | 2018-10-25 | Advaxis, Inc. | Listeria-Based Immunogenic Compositions And Methods Of Use Thereof in Cancer Prevention And Treatment |
AU2016324170A1 (en) | 2015-09-17 | 2018-04-12 | Advaxis, Inc. | Recombinant Listeria vaccine strains and methods of using the same in cancer immunotherapy |
CA3001702A1 (en) | 2015-10-14 | 2017-04-20 | Advaxis, Inc. | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy |
US20180325964A1 (en) | 2015-11-20 | 2018-11-15 | Advaxis, Inc. | Manufacturing device and method of an immunotherapeutic formulation comprising a recombinant listeria strain |
AU2016369580A1 (en) | 2015-12-16 | 2018-07-12 | Advaxis, Inc. | Listeria-based immunotherapy and methods of use thereof |
US20190032064A1 (en) | 2016-01-27 | 2019-01-31 | Advaxis, Inc. | Personalized Delivery Vector-Based Immunotherapy and Uses Thereof |
EP3481854A4 (en) | 2016-07-05 | 2020-07-29 | Advaxis, Inc. | Listeria-based immunogenic compositions comprising wilms tumor protein antigens and methods of use thereof |
WO2018085854A1 (en) | 2016-11-07 | 2018-05-11 | Advaxis, Inc. | Combination of listeria-based vaccine with anti-ctla-4 or anti-cd137 antibodies |
SG11201901979SA (en) | 2016-11-30 | 2019-04-29 | Advaxis Inc | Immunogenic compositions targeting recurrent cancer mutations and methods of use thereof |
WO2018102585A1 (en) | 2016-11-30 | 2018-06-07 | Advaxis, Inc. | Personalized immunotherapy in combination with immunotherapy targeting recurrent cancer mutations |
AR110730A1 (en) | 2017-01-05 | 2019-04-24 | Advaxis Inc | LISTERY AND METHOD RECOMBINANT VACCINE VACCINES FOR USE IN CANCER IMMUNOTHERAPY |
WO2018170313A1 (en) | 2017-03-16 | 2018-09-20 | Advaxis, Inc. | Methods and compositions for increasing efficacy of vaccines |
WO2019006401A2 (en) | 2017-06-30 | 2019-01-03 | Advaxis, Inc. | Listeria-based immunogenic compositions comprising heteroclitic wilms tumor protein antigens and methods of use thereof |
MX2020003100A (en) | 2017-09-19 | 2020-08-20 | Advaxis Inc | COMPOSITIONS AND METHODS FOR LYOPHILIZATION OF BACTERIA OR <i>LISTERIA </i>STRAINS. |
CA3081710A1 (en) | 2017-11-08 | 2019-05-16 | Advaxis, Inc. | Immunogenic heteroclitic peptides from cancer-associated proteins and methods of use thereof |
WO2019157098A1 (en) | 2018-02-06 | 2019-08-15 | Advaxis, Inc. | Compositions comprising a recombinant listeria strain and an anti-ccr8 antibody and methods of use |
JP2021516972A (en) | 2018-03-09 | 2021-07-15 | アドバクシス, インコーポレイテッド | Compositions and Methods for Assessing Attenuation and Infectivity of Listeria Strains |
EP3785029A1 (en) | 2018-04-27 | 2021-03-03 | Advaxis, Inc. | Compositions and methods for evaluating potency of listeria-based immunotherapeutics |
-
2016
- 2016-03-02 MA MA041644A patent/MA41644A/en unknown
- 2016-03-03 CA CA2978082A patent/CA2978082A1/en active Pending
- 2016-03-03 WO PCT/US2016/020571 patent/WO2016141121A1/en active Application Filing
- 2016-03-03 TW TW110116020A patent/TWI808415B/en active
- 2016-03-03 JP JP2017545631A patent/JP6921750B2/en active Active
- 2016-03-03 MX MX2017011246A patent/MX2017011246A/en unknown
- 2016-03-03 CN CN201680013085.4A patent/CN107406822A/en active Pending
- 2016-03-03 AU AU2016226247A patent/AU2016226247B2/en not_active Ceased
- 2016-03-03 SG SG11201706969YA patent/SG11201706969YA/en unknown
- 2016-03-03 EP EP16759454.8A patent/EP3265553A4/en active Pending
- 2016-03-03 IL IL290248A patent/IL290248B2/en unknown
- 2016-03-03 US US15/553,507 patent/US10900044B2/en active Active
- 2016-03-03 SG SG10201908086S patent/SG10201908086SA/en unknown
- 2016-03-03 TW TW105106585A patent/TWI728968B/en not_active IP Right Cessation
- 2016-03-03 KR KR1020177024227A patent/KR20170120119A/en not_active Application Discontinuation
-
2017
- 2017-08-28 IL IL254178A patent/IL254178B/en unknown
-
2018
- 2018-06-27 HK HK18108281.1A patent/HK1248758A1/en unknown
-
2020
- 2020-12-18 US US17/127,530 patent/US11702664B2/en active Active
-
2021
- 2021-07-28 JP JP2021123032A patent/JP7346501B2/en active Active
-
2022
- 2022-02-01 AU AU2022200643A patent/AU2022200643B2/en active Active
-
2023
- 2023-05-12 US US18/316,539 patent/US20230357781A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
US20190002891A1 (en) | 2019-01-03 |
US20210246457A1 (en) | 2021-08-12 |
CN107406822A (en) | 2017-11-28 |
US11702664B2 (en) | 2023-07-18 |
JP7346501B2 (en) | 2023-09-19 |
HK1248758A1 (en) | 2018-10-19 |
JP2021176322A (en) | 2021-11-11 |
US10900044B2 (en) | 2021-01-26 |
AU2016226247B2 (en) | 2021-11-18 |
TW202202613A (en) | 2022-01-16 |
SG10201908086SA (en) | 2019-10-30 |
TWI808415B (en) | 2023-07-11 |
MX2017011246A (en) | 2018-01-12 |
AU2022200643A1 (en) | 2022-02-24 |
TWI728968B (en) | 2021-06-01 |
WO2016141121A1 (en) | 2016-09-09 |
IL290248B1 (en) | 2023-12-01 |
IL290248B2 (en) | 2024-04-01 |
SG11201706969YA (en) | 2017-09-28 |
EP3265553A4 (en) | 2018-11-07 |
IL254178A0 (en) | 2017-10-31 |
MA41644A (en) | 2018-01-09 |
IL290248A (en) | 2022-04-01 |
KR20170120119A (en) | 2017-10-30 |
TW201704464A (en) | 2017-02-01 |
JP2018508212A (en) | 2018-03-29 |
AU2016226247A1 (en) | 2017-09-21 |
JP6921750B2 (en) | 2021-08-18 |
IL254178B (en) | 2022-03-01 |
US20230357781A1 (en) | 2023-11-09 |
AU2022200643B2 (en) | 2022-06-02 |
CA2978082A1 (en) | 2016-09-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11702664B2 (en) | Listeria-based compositions comprising a peptide minigene expression system and methods of use thereof | |
JP7300041B2 (en) | Recombinant Listeria Vaccine Strains and Methods of Producing The Same | |
AU2013232291B8 (en) | Suppressor cell function inhibition following listeria vaccine treatment | |
AU2015364260A1 (en) | Combination of Listeria-based vaccine with anti-OX40 or anti-GITR antibodies | |
US20180280487A1 (en) | Recombinant listeria vaccine strains and methods of using the same in cancer immunotherapy | |
WO2015126921A1 (en) | Biomarker directed multi-target immunotherapy |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20170901 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
AX | Request for extension of the european patent |
Extension state: BA ME |
|
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 1248758 Country of ref document: HK |
|
A4 | Supplementary search report drawn up and despatched |
Effective date: 20181010 |
|
RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61K 35/74 20150101ALI20181001BHEP Ipc: C12N 15/74 20060101ALI20181001BHEP Ipc: C12N 9/90 20060101ALI20181001BHEP Ipc: C07K 14/195 20060101ALI20181001BHEP Ipc: C12N 9/10 20060101ALI20181001BHEP Ipc: A61P 35/00 20060101ALI20181001BHEP Ipc: A61K 39/00 20060101AFI20181001BHEP Ipc: C12N 1/21 20060101ALI20181001BHEP |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
17Q | First examination report despatched |
Effective date: 20200207 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |