EP2334166A2 - Transgenic plants with enhanced growth characteristics - Google Patents

Transgenic plants with enhanced growth characteristics

Info

Publication number
EP2334166A2
EP2334166A2 EP09810728A EP09810728A EP2334166A2 EP 2334166 A2 EP2334166 A2 EP 2334166A2 EP 09810728 A EP09810728 A EP 09810728A EP 09810728 A EP09810728 A EP 09810728A EP 2334166 A2 EP2334166 A2 EP 2334166A2
Authority
EP
European Patent Office
Prior art keywords
plant
gpt
transgene
seq
transgenic
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP09810728A
Other languages
German (de)
French (fr)
Other versions
EP2334166A4 (en
Inventor
Pat J. Unkefer
Penelope S. Anderson
Thomas J. Knight
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Maine System
Los Alamos National Security LLC
Original Assignee
University of Maine System
Los Alamos National Security LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Maine System, Los Alamos National Security LLC filed Critical University of Maine System
Publication of EP2334166A2 publication Critical patent/EP2334166A2/en
Publication of EP2334166A4 publication Critical patent/EP2334166A4/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1096Transferases (2.) transferring nitrogenous groups (2.6)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A40/00Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
    • Y02A40/10Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
    • Y02A40/146Genetically Modified [GMO] plants, e.g. transgenic plants

Definitions

  • transgenic plant technologies may be gradually increasing, particularly in the United States, Canada and Australia, many regions of the World remain slow to adopt genetically modified plants in agriculture, notably Europe. Therefore, consonant with pursuing the objectives of responsible and sustainable agriculture, there is a strong interest in the development of genetically engineered plants that do not introduce toxins or other potentially problematic substances into plants and/or the environment. There is also a strong interest in minimizing the cost of achieving objectives such as improving herbicide tolerance, pest and disease resistance, and overall crop yields. Accordingly, there remains a need for transgenic plants that can meet these objectives.
  • the metabolism of carbon and nitrogen in photosynthetic organisms must be regulated in a coordinated manner to assure efficient use of plant resources and energy.
  • Current understanding of carbon and nitrogen metabolism includes details of certain steps and metabolic pathways which are subsystems of larger systems, in photosynthetic organisms, carbon metabolism begins with CO 2 fixation, which proceeds via two major processes, termed C-3 and C-4 metabolism.
  • C-3 metabolism the enzyme ribulose bisphosphate carboxylase (RuBisCo) catalyzes the combination of CO2 with ribulose bisphosphate to produce 3- phosphogiycerate, a three carbon compound (C-3) that the plant uses to synthesize carbon-containing compounds.
  • RuBisCo ribulose bisphosphate carboxylase
  • CO2 is combined with phosphoenoi pyruvate to form acids containing four carbons (C-4), in a reaction catalyzed by the enzyme phosphoeno! pyruvate carboxylase.
  • the acids are transferred to bundle sheath ceils, where they are decarboxylated to release CO 2 , which is then combined with rib ⁇ iose bisphosphate in the same reaction employed by C-3 piants.
  • GS glutamine synthetase
  • GS also reassimilates ammonia released as a result of photorespiration and the breakdown of proteins and nitrogen transport compounds.
  • GS enzymes may be divided into two general classes, one representing the cytoplasmic form (GS1) and the other representing the piastidic (i.e., chloroplastic) form (GS2).
  • transgenic tobacco piants overexpressing the full length Alfalfa GS1 coding sequence contained greatly elevated levels of GS transcript, and GS polypeptide which assembled into active enzyme, but did not report phenotypic effects on growth (Temple et al., 1993, Molecular and General Genetics 236: 315- 325).
  • Corruzi et al. have reported that transgenic tobacco overexpressing a pea cytosolic GS1 transgene under the control of the CaMV S35 promoter show increased GS activity, increased cytosolic GS protein, and improved growth characteristics (U.S. Patent No. 6,107,547). Unkefer et al.
  • transgenic tobacco plants overexpressing the Alfalfa GS1 in foliar tissues which had been screened for increased leaf-to-root GS activity following genetic segregation by selfing to achieve increased GS1 transgene copy number, were found to produce increased 2-hydroxy-5-oxoproline levels in their foliar portions, which was found to lead to markedly increased growth rates over wildtype tobacco plants (see, U.S. Patent Nos. 6,555,500; 6,593,275; and 6,831,040).
  • Unkefer et al. have further described the use of 2-hydroxy-5-oxoproline (also known as 2-oxoglutaramate) to improve plant growth (U.S. Patent Nos. 6,555,500; 6,593,275; 6,831.040).
  • 2-hydroxy-5-oxoproline also known as 2-oxoglutaramate
  • Unkefer et al. disclose that increased concentrations of 2-hydroxy-5-oxoproiine in foliar tissues (relative to root tissues) triggers a cascade of events that result in increased plant growth characteristics.
  • the invention relates to transgenic plants exhibiting dramatically enhanced growth rates, greater seed and fruit/pod yields, earlier and more productive flowering, more efficient nitrogen utilization, increased tolerance to high salt conditions, and increased biomass yields, in one embodiment, transgenic plants engineered to over-express both gl ⁇ tamine phenylpyruvate transaminase (GPT) and giutamine synthetase (GS) are provided.
  • GPT+GS double-transgenic plants of the invention consistently exhibit enhanced growth characteristics, with T0 generation lines showing an increase in biomass over wild type counterparts of between 50% and 300%. Generations that result from sexual crosses and/or seifing typically perform even better, with some of the double-transgenic plants achieving an astonishing four-fold biomass increase over wild type plants.
  • GPT glitamine phenylpyruvate transaminase
  • the invention provides isolated nucleic acid molecules encoding GPT, and discloses the novel finding that the encoded enzyme is directly involved in the synthesis of 2-hydroxy-5-oxoproline.
  • This aspect of the invention is exemplified herein by the disclosure of GPT polynucleotides encoding GPTs from several species, including Arabidopsis. Grape, Rice, Soybean, Barley, bamboo and a non-plant homolog from Zebra fish, most of which have been expressed as recombinant GPTs and confirmed as having GPT activity.
  • the invention further provides transgenic plants which express both a GPT transgene and a GS transg ⁇ ne.
  • the expression of these two transgenes in such "double-transgene" plants results in a substantially increased rate of carbon dioxide fixation and an extremely potent growth enhancing effect, as these plants exhibit very significantly and sometimes tremendously enhanced growth rates and flower/fruit/pod/seed yields. Methods for the generation of such growth-enhanced transgenic plants are provided.
  • the transgenic plants of the invention are capable of producing higher overall yields over shorter periods of time, and therefore may provide agricultural industries with enhanced productivity across a wide range of crops.
  • the invention utilizes natural plant genes encoding a natural plant enzyme.
  • the enhanced growth characteristics of the transgenic plants of the invention is achieved essentially by introducing additional GPT and GS capacity into the plant.
  • the transgenic plants of the invention do not express any toxic substances, growth hormones, viral or bacterial gene products, and are therefore free of many of the concerns that have heretofore impeded the adoption of transgenic plants in certain parts of the World.
  • the invention provides a transgenic plant comprising a GPT transgene and a GS transgene, wherein said GPT transgene and said GS transgene are operably linked to a plant promoter.
  • the GS transgene is a GS1 transgene.
  • the GPT transgene encodes a polypeptide having an amino acid sequence selected from the group consisting of (a) SEQ ID NO: 2; SEQ ID NO: 9; SEQ ID NO: 15. SEQ IO NO: 19, SEQ ID NO: 21.
  • SEQ ID NO: 35 and SEQ ID NO: 36 and (b) an amino acid sequence thai is at least 75% identical to any one of SEQ IO NO: 2; SEQ ID NO: 9; SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO 24, SEQ ID NO: 30, SEQ ID NO: 31.
  • the GS transgene encodes a polypeptide having an amino acid sequence selected form the group consisting of (a) SEQ ID NO: 4 and SEQ ID NO: 7 from residue 11, and (b) an amino acid sequence that is at least 75% identical to SEQ ID NO: 4 or SEQ ID NO: 7.
  • the GPT and GS transgenes are incorporated into the genome of the plant.
  • the transgenic plant of the invention may be a monocotyledonous or a dicotyledonous plant.
  • the invention also provides progeny of any generation of the transgenic plants of the invention, wherein said progeny comprises a GPT transgene and a GS transgene, as well as a seed of any generation of the transgenic plants of the invention, wherein said seed comprises said GPT transgene and said GS transgene.
  • the transgenic plants of the invention may display one or more enhanced growth characteristics rate when compared to an analogous wild-type or uniransformed plant, including without limitation increased growth rate, biomass yield, seed yield, flower or flower bud yield, fruit or pod yield, larger leaves, and may also display increased levels of GPT and/or GS activity, and/or increased levels of 2-oxogiutaramate, In some embodiments, the transgenic plants of the invention display increased nitrogen use efficiency or increased tolerance to salt or saline conditions.
  • Methods for producing the transgenic plants of the invention and seeds thereof are also provided, including methods for producing a plant having enhanced growth properties, increased nitrogen use efficiency and increased tolerance to germination or growth in salt or saline conditions, relative to an analogous wild type or untra ⁇ sformed plant.
  • FIG. 1 Nitrogen assimilation and 2-oxogi ⁇ taramate biosynthesis: schematic of metabolic pathway.
  • FIG. 2 Photograph showing comparison of transgenic tobacco piants over- expressing either GS1 or GPT, compared to wild type tobacco plant. From left to right: wild type plant, Alfalfa GS1 transgene, Arabidopsis GPT tra ⁇ sgene. See Examples 3 and 5, infra.
  • FIG. 3 Photograph showing comparison of transgenic Micro-Tom tomato plants over-expressing either GS1 or GPT, compared to wild type tomato plant. From left to right: wild type plant, Alfalfa GS1 transgene, Arabidopsis GPT transgene. See Examples 4 and 6, infra.
  • FIG. 4 Photographs showing comparisons of leaf sizes between wiid type and GS1 or GPT transgenic tobacco piants.
  • A Comparison between leaves from GS1 transgenic tobacco (bottom leaf) and wild type (top leaf).
  • B Comparison between leaves from GPT transgenic tobacco (bottom leaf) and wild type (top leaf).
  • FIG. 5 Photographs showing comparisons of transgenic tobacco piants generated from various crosses between GS1 and GPT transgenic tobacco iines with wild type and single transgene plants.
  • A-C Cross 2, 3 and 7, respectively. See Example 7, infra.
  • A Comparison between leaves from GSXGPT Cross 3 (bottom leaf) and wiid type (top leaf).
  • B Comparison between leaves from GSXGPT Cross 7 (bottom leaf) and wiid type (top leaf). See Example 7, infra.
  • FIG. 7. Photograph of transgenic pepper plant (right) and wild type control pepper plant (left), showing larger pepper fruit yield in the transgenic plant relative to the wild type control plant. See Example 8, infra.
  • FIG. 8 Transgenic bean plants compared to wild type control bean plants (several transgenic lines expressing Arabidopsis GPT and GS transgenes). Upper Left: plant heights on various days; Upper right: flower bud numbers; Lower left: flower numbers; Lower right: bean pod numbers. Wildtype is the control, and lines 2A 1 4A and 58 are all transgenic plant lines. See Example 9, infra.
  • FIG. 9 Photograph of transgenic bean plant (right) and wild type control bean plant (left), showing increased growth in the transgenic plant relative to the wild type control plant.
  • FIG. 10 Transgenic bean plants pods, flowers and flower buds compared to wild type control bean plants (transgenic line expressing grape GPT and Arabidopsis GS transgenes). See Example 10, infra.
  • FIG. 11 Photograph of transgenic bean plant (right) and wild type control bean plant (left), showing increased growth in the transgenic plant relative to the wild type control plant Transgenic line expressing Grape GPT and Arabidopsis GS transgenes. See Example 10, infra.
  • FIG. 12 Transgenic Cowpea Line A plants compared to wild type control Cowpea plants (transgenic line expressing Arabidopsis GPT and GS transgenes), showing that the transgenic plants grow faster and flower and set pods sooner than wild type control plants.
  • A Relative height and longest leaf measurements as of May 21,
  • B Relative trifolate leafs and flower buds as of June 18,
  • C Relative numbers of flowers, flower buds and pea pods as of June 22. See Example 11, infra.
  • FIG. 13 Photograph of transgenic Cowpea Line A plant (right) and wild type control Cowpea plant (left), showing increased growth in the transgenic plant relative to the wiid type control plant.
  • Transgenic line expressing Arabidopsis GPT and GS transgenes See Example 11, infra.
  • FIG. 14 Transgenic Cowpea Line G plants compared to wild type control Cowpea plants (transgenic line expressing Grape GPT and Arabidopsis GS transgenes), showing that the transgenic plants grow faster and flower and set pods sooner than wild type control plants.
  • A plant heights
  • B flowers and pea pod numbers
  • C leaf bud and trifolate numbers. See Example 12, infra.
  • FIG. 15 Photograph of transgenic Cowpea Line G plant (right) and wiid type control Cowpea plant (left), showing increased growth in the transgenic plant relative to the wild type control plant.
  • FIG. 16 Photograph of transgenic Cantaloupe plant (right) and wild type controi Cantaloupe plant (left), showing increased growth in the transgenic plant relative to the wiid type controi plant.
  • FIG. 17 Photograph of transgenic Pumpkin plants (right) and wild type control Pumpkin plants (left), showing increased growth in the transgenic plants relative to the wild type control plants.
  • FIG. 18 Photograph of transgenic Arabidopsts plants (right) and wild type control Arabidopsis plants (left), showing increased growth in the transgenic plants relative to the wild type control plants.
  • FIG. 19 Transgenic tomato plants expressing Arabidopsis GPT and GS transgenes compared to control tomato plants.
  • A Photograph of transgenic tomato plant leaves (right) vs. wild type control leaves (left) showing larger leaves in the transgenic plant
  • B Photograph of transgenic tomato plants (right) and wild type control plants (left), showing increased growth in the transgenic plants relative to the wild type control piants. See Example 17, infra.
  • FIG. 20 Photograph of transgenic Camelina plant (right) and wild type control Camelina plant (left), showing increased growth in the transgenic plant relative to the wild type control plant.
  • nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof ("polynucleotides”) in either single- or double-stranded form.
  • polynucleotide encompasses nucleic adds containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
  • a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof ⁇ e.g. degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues ( ⁇ atzer et at., 1991, Nucleic Acid Res. 19: 5081; Ohts ⁇ ka et al., 1985 J. Biol. Chem. 260: 2605-2608; and Cassol et a).. 1992; Rossolini et a!., 1994, MoI. Cell. Probes 8: 91-98).
  • nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
  • promoter refers to an array of nucleic acid control sequences that direct transcription of an operably linked nucleic acid.
  • a "plant promoter” is a promoter that functions in plants. Promoters include necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase Il type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.
  • a “constitutive” promoter is a promoter that is active under most environmental and developmental conditions.
  • An “inducible” promoter is a promoter that is active under environmental or developmental regulation.
  • operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucieic acid corresponding to the second sequence.
  • a nucleic acid expression control sequence such as a promoter, or array of transcription factor binding sites
  • polypeptide peptide
  • protein protein
  • amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and ⁇ on- ⁇ aturaliy occurring amino acid polymers.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline. ⁇ -carboxygjutamate, and O-phosphoserine.
  • Amino acid analogs refers to compounds that have tie same basic chemical structure as a naturally occurring amino acid, i.e., an ⁇ carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyf suifonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-fetter codes.
  • plant includes whole plants, plant organs (e.g., leaves, stems, flowers, roots, etc.), seeds and plant cells and progeny thereof.
  • plant organs e.g., leaves, stems, flowers, roots, etc.
  • the class of plants which can be used in the method of the invention is generally as broad as the class of higher plants amenable to transformation techniques, including angiosperms
  • GPT polynucleotide and “GPT nucleic acid” are used interchangeably herein, and refer to a full length or partial length polynucleotide sequence of a gene which encodes a polypeptide involved in catalyzing the synthesis of 2- oxoglutaramate, and includes polynucleotides containing both translated (coding) and un-transiated sequences, as well as the complements thereof.
  • the term “GPT coding sequence” refers to the part of the gene which is transcribed and encodes a GPT protein.
  • targeting sequence refers to the amino terminal part of a protein which directs the protein into a subcellular compartment of a cell, such as a chloropiast in a piant cell.
  • GPT polynucleotides are further defined by their ability to hybridize under defined conditions to the GPT polynucleotides specifically disclosed herein, or to PCR products derived therefrom.
  • a “GPT transgene” is a nucleic acid molecule comprising a GPT polynucleotide which is exogenous to transgenic piant, or piant embryo, organ or seed, harboring the nucleic acid molecule, or which is exogenous to an ancestor piant, or piant embryo, organ or seed thereof, of a transgenic plant harboring the GPT polynucleotide.
  • GS polynucleotide and “GS nucleic acid” are used interchangeably herein, and refer to a fuli length or partial length polynucleotide sequence of a gene which encodes a giutamine synthetase protein, and includes polynucleotides containing both translated (coding) and un-transiated sequences, as well as the complements thereof.
  • GS coding sequence * refers to the part of the gene which is transcribed and encodes a GS protein.
  • M GS1 polynucleotide and "GS1 nucleic acid” are used interchangeably herein, and refer to a fuli length or partial length polynucleotide sequence of a gene which encodes a giutamine synthetase isoform 1 protein, and includes polynucleotides containing both translated (coding) and un-transiated sequences, as well as the complements thereof.
  • GS 1 coding sequence refers to the part of the gene which is transcribed and encodes a GS1 protein.
  • a "GS transgene” is a nucleic acid molecule comprising a GS polynucleotide which is exogenous to transgenic piant, or plant embryo, organ or seed, harboring the nucleic acid molecule, or which is exogenous to an ancestor plant, or piant embryo, organ or seed thereof, of a transgenic plant harboring the GPT polynucleotide.
  • a “GS1 transgene” is a nucleic acid molecule comprising a GS1 polynucleotide which is exogenous to transgenic plant, or plant embryo, organ or seed, harboring the nucleic acid molecule, or which is exogenous to an ancestor plant, or plant embryo, organ or seed thereof, of a transgenic plant harboring the GPT polynucleotide.
  • GPT polynucleotides of the invention include GPT coding sequences for Arabidopsis, Rice, Barley. Bamboo, Soybean, Grape, and Zebra Fish GPTs.
  • Partial length GPT polynucleotides include polynucleotide sequences encoding N- or C-terminai truncations of GPT, mature GPT (without targeting sequence) as well as sequences encoding domains of GPT.
  • Exemplary GPT polynucleotides encoding N-terminal truncations of GPT include Arabidopsis -30, -45 and -56 constructs, in which coding sequences for the first 30, 45, and 56 respectively, amino acids of the full length GPT structure of SEQ ID NO: 2 are eliminated.
  • GPT polynucleotide sequence need not be identical, but may be only “substantially identical” to a sequence of the gene from which it was derived, as further defined below.
  • the term "GPT polynucleotide” specifically encompasses such substantially identical variants.
  • GPT polynucleotide specifically includes those sequences substantially identical (determined as described below) with an GPT polynucleotide sequence disclosed herein and that encode polypeptides that are either mutants of wild type GPT polypeptides or retain the function of the GPT polypeptide (e.g., resulting from conservative substitutions of amino acids in a GPT polypeptide).
  • GPT polynucleotide therefore also includes such substantially identical variants.
  • conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • TGG which is ordinarily the only codon for tryptophan
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic add, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in One substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are weii known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homoiogs, and alleles of the invention.
  • the following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K): 5) lsoleucine (I), Leucine (L), Methionine (M), Valine (V): 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g.. Creighton, Proteins (1984)).
  • Macromoiec ⁇ iar structures such as polypeptide structures can be described in terms of various levels of organization. For a general discussion of this organization, see, e.g., Alberts ef al., Molecular Biology of the Cell (3 rd ed., 1994) and Cantor and Schimmel, Biophysical Chemistry Part f: The Conformation of Biological Macromolec ⁇ les (1980).
  • Primary structure refers to the amino acid sequence of a particular peptide.
  • “Secondary structure” refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains. Domains are portions of a polypeptide that form a compact unit of the polypeptide and are typically 25 to approximately 500 amino acids long.
  • Tertiary structure refers to the complete three dimensional structure of a polypeptide monomer.
  • Quaternary structure refers to the three dimensional structure formed by the noncovalent association of independent tertiary units. Anisotropic terms are also known as energy terms.
  • isolated refers to material which is substantially or essentially free from components which normally accompany the material as it is found in its native or natural state. However, the term “isolated” is not intended refer to the components present in an eiectrophoretic gel or other separation medium. An isolated component is free from such separation media and in a form ready for use in another application or already in use in the new application/milieu.
  • An "isolated” antibody is one that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceo ⁇ s or non-proteinaceous solutes.
  • the antibody will be purified (1 ) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain, isolated antibody includes the antibody in situ within recombinant ceils since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • heterologous when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not found in the same relationship to each other in nature.
  • a nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a nucleic acid encoding a protein from one source and a nucleic acid encoding a peptide sequence from another source.
  • a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature ⁇ e.g., a fusion protein).
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 70% identity, preferably 75%, 80%, 85%, 90%, or 95% identity over a specified region, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithms, or by manual alignment and visual inspection.
  • This definition also refers to the complement of a test sequence, which has substantial sequence or subsequence complementarity when the test sequence has substantial identity to a reference sequence.
  • This definition also refers to the complement of a test sequence, which has substantial sequence or subsequence complementarity when the test sequence has substantial identity to a reference sequence.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art. Optima! alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981, Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. MoL Biol.
  • BLAST and BLAST 2.0 are used, typically with the default parameters described herein, to determine percent sequence identity for the nucleic adds and proteins of the invention.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive- valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altsch ⁇ l et a/., supra).
  • initiai neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
  • the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N ⁇ penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from Its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • the BLASTP program uses as defaults a word length of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix ⁇ see Henikoff & Henikoff, Proc. Natl. Acad. ScL USA 89:10915 (1989)) alignments (B) of 50.
  • the BLAST algorithm aiso performs a statistical analysis of the similarity between two sequences (see, e.g., Kariin & Altsch ⁇ i, 1993, Proc. Nat'l. Acad. Sci. USA 90:5873-5787).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001.
  • stringent hybridization conditions refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acid, but to no other sequences. Stringent conditions are sequence- dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays” (1993). Generally, highly stringent conditions are selected to be about 5-10°C- lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH.
  • Tm thermal melting point
  • Low stringency conditions are generally selected to be about 15-30°C. below the Tm.
  • Tm is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium).
  • Stringent conditions will be those in which the salt concentration is less than about 1.0M sodium ion, typically about 0.01 to 1.0M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides).
  • Stringent conditions may aiso be achieved with the addition of destabilizing agents such as formamide.
  • destabilizing agents such as formamide.
  • a positive signal is at least two times background, preferably 10 times background hybridization.
  • Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical. This occurs, for exampie, when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code, in such cased, the nucleic acids typically hybridize under moderately stringent hybridization conditions.
  • Genomic ONA or cDNA comprising GPT polynucleotides may be identified in standard Southern blots under stringent conditions using the GPT polynucleotide sequences disclosed here.
  • suitable stringent conditions for such hybridizations are those which include a hybridization in a buffer of 40% formamide, 1M NaCl, 1% SDS at 37"C, and at least one wash in 0.2 X SSC at a temperature of at least about 50°C, usually about 55X to about 60*0, for 20 minutes, or equivalent conditions.
  • a positive hybridization is at least twice background.
  • alternative hybridization and wash conditions may be utilized to provide conditions of similar stringency.
  • a further indication that two polynucleotides are substantially identical is if the reference sequence, amplified by a pair of oligonucleotide primers, can then be used as a probe under stringent hybridization conditions to isolate the test sequence from a cDNA or genomic library, or to identify the test sequence in, e.g., a northern or Southern blot.
  • the invention provides novel transgenic plants exhibiting substantially enhanced agronomic characteristics, including faster growth, greater mature plant fresh weight and total biomass, earlier and more abundant flowering, and greater fruit, pod and seed yields.
  • the transgenic plants of the invention are generated by introducing into a plant one or more expressible genetic constructs capable of driving the expression of one or more polynucleotides encoding glutamine synthetase (GS) and glutamine phenylpyruvate transaminase (GPT).
  • GPT glutamine synthetase
  • GPT glutamine phenylpyruvate transaminase
  • single-transgene parental lines carrying either a GPT or GS1 transge ⁇ e coding sequence are generated, preferably selfed until homozygous for the transgene, then crossed to generate progeny plants containing both transg ⁇ nes.
  • one or more copies of the expressible genetic construct become integrated into Hie host plant genome, thereby providing increased GS and GPT enzyme capacity into the plant, which serves to mediate increased synthesis of 2-oxogi ⁇ taramate, which in turn signals metabolic gene expression, resulting in increased plant growth and the enhancement other agronomic characteristics.
  • 2-oxoglutaramate is a metabolite which is an extremely potent effector of gene expression, metabolism and plant growth (U.S. Patent No. 6,555,500), and which may play a pivotal roie in the coordination of the carbon and nitrogen metabolism systems (L ancient et al., 2000.
  • Arabidopsis GPT transgene showed significant enhancement of growth rate, flowering, and seed yield in relation to wild type control plants (FIG. 3 and Example 4, infra).
  • a first set of parentai singfe-transgene tobacco plant lines carrying the Alfalfa GS1 gene, including 5 * and 3' untranslated regions, were generated using Agrobacterium mediated gene transformation, under selective pressure, together with screening for the fastest growing phenotype, and selflng to transgene/phenotype homozygosity (see Example 5, infra).
  • a second set of parental single-transgene tobacco plant lines carrying the full length coding sequence of Arabidopsis GPT were generated in the same manner (Example 3, infra). High growth rate performing plants from each of the parental lines were then sexually crossed to yield progeny lines (Example 7, infra).
  • FIG. 5 shows photographs of double-transgene progeny from single-transgene GS1 X GPT plant crosses, relative to wild type and single-transgene parentai plants.
  • FIG. 6 shows photographs comparing leaf sizes of double-transgene progeny and wild type plants. Experimentally observed growth rates in these double transgenic plants ranged between 200% and 300% over wild-type plants (Example 7, infra).
  • total biomass ieveis increased substantially in the double-transgene plants, with whole plant fresh weights typically being about two to three times the wild-type plant weights.
  • seed yields showed similar increases in the double-transgene plants, with seed pod production typically two to three times the wild type average, and overall seed yields exceeding wild-type plant yields by 300-400%.
  • transgenic plants comprising GPT and GS transgenes are specifically exemplified herein.
  • transgenic plants showing enhanced growth characteristics have been generated in two species of Tomato (see Examples 4 and 17), Pepper (Example 8), Beans (Examples 9 and 10), Cowpea (Examples 11 and 12), Alfalfa (Example 13), Cantaloupe (Example 14), Pumpkin (Example 15), Arabidopsis (Example 16) and Camilena (Example 18).
  • transgenic plants of the invention were generated using a variety of transformation methodologies, including Agrobacteri ⁇ m-mediated callus, floral dip, seed inoculation, pod inoculation, and direct flower inoculation, as well as combinations thereof, and via sexual crosses of single transgene plants, as exemplified herein.
  • transformation methodologies including Agrobacteri ⁇ m-mediated callus, floral dip, seed inoculation, pod inoculation, and direct flower inoculation, as well as combinations thereof, and via sexual crosses of single transgene plants, as exemplified herein.
  • Different GPT and GS transgenes were successfully employed in generating the transgenic plants of the invention, as exemplified herein.
  • a method of generating a transgenic plant having enhanced growth and other agronomic characteristics comprises introducing into a plant ceil an expression cassette comprising a nucleic acid molec ⁇ ie encoding a GPT transgene, under the control of a suitable promoter capable of driving the expression of the transgene, so as to yield a transformed plant ceil, and obtaining a transgenic plant which expresses the encoded GPT.
  • a method of generating a transgenic plant having enhanced growth and other agronomic characteristics comprises introducing into a plant ceil one or more nucleic acid constructs or expression cassettes comprising nucleic acid molecules encoding a GPT transgene and an GS transgene, under the control of one or more suitable promoters (and, optionally, other regulatory elements) capable of driving the expression of the transgenes, so as to yield a plant eel! transformed thereby, and obtaining a transgenic plant which expresses the GPT and GS transgenes.
  • GPT and GS polynucleotides may be used to generate the transgenic plants of the invention. Both GS1 and GPT proteins are highly conserved among various plant species, and it is evident from the experimental data disclosed herein that closely-related non-plant GPTs may be used as well (e.g., Danio rerio GPT). WiUi respect to GPT, numerous GPT polynucleotides derived from different species have been shown to be active and useful as GPT transgenes. Similarly, different GS polynucleotides may be used, including without limitation any plant GS1 encoding polynucleotide that generates GS activity in a host cell transformed with an expressible GS 1 construct.
  • the GPT transgene is a GPT polynucleotide encoding an Arabidopsis derived GPT 1 such as the GPT of SEQ ID NO: 2, SEQ ID NO: 21 and SEQ ID NO: 30, and the GS transgene is a GS polynucleotide encoding an Alfalfa derived GS1 (i,e M SEQ ID NO: 4) or an Arabidopsis derived GS1 (SEQ ID NO: 7).
  • the GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 1 ; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 1, and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 2, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity; and a nucleotide sequence encoding the polypeptide of SEQ ID NO: 2 truncated at its amino terminus by between 30 to 56 amino acid residues, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity.
  • the GS1 transgene may be encoded by the polynucleotide of SEQ ID NO: 3 or SEQ ID NO: 6 or a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 3 or SEQ ID NO: 6, and encoding a polypeptide having GPT activity; and a nucleotide sequence encoding the polypeptide of SEQ ID NO: 4 or 7, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GS activity.
  • the GPT transgene is a GPT polynucleotide encoding a Grape derived GPT 1 such as the Grape GPTs of SEQ ID NO: 9 and SEQ ID NO: 31, and the GS transgene is a GS1 polynucleotide.
  • the GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 8; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ IO NO: S, and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 9 or SEQ ID NO:
  • the GPT transgene is a GPT polynucleotide encoding a Rice derived GPT, such as the Rice GPTs of SEQ ID NO: 11 and SEQ ID NO: 32, and the GS transgene is a GS1 polynucleotide.
  • the GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 10; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 10. and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 11 or SEQ ID NO:
  • the GPT transgene is a GPT polynucleotide encoding a Soybean derived GPT, such as the Soybean GPTs of SEQ ID NO: 13, SEQ IS NO: 33 or SEQ ID NO: 33 with a further lsoleucine at the N-terminus of the sequence, and the GS transgene is a GS1 polynucleotide.
  • the GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 12; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 12, and encoding a polypeptide having GPT activity: a nucleotide sequence encoding the polypeptide of SEQ ID NO: 13 or SEQ ID NO: 33 or SEQ ID NO: 33 with a further lsoleucine at the N-terminus of the sequence, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity.
  • the GPT transgene is a GPT polynucleotide encoding a Barley derived GPT, such as the Barley GPTs of SEQ ID NO: 15 and SEQ ID NO: 34
  • the GS transgene is a GS1 polynucleotide.
  • the GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 14; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ iO NO: 10, and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ SO NO: 15 or SEQ ID NO:
  • polypeptide 34 or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity.
  • the GPT transgene is a GPT polynucleotide encoding a Zebra fish derived GPT, such as the Zebra fish GPTs of SEQ ID NO: 17 and SEQ ID NO: 35
  • the GS transgene is a GS1 polynucleotide.
  • the GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 16; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 16. and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 17 or SEQ ID NO:
  • the GPT transgene is a GPT polynucleotide encoding a Bamboo derived GPT, such as the Bamboo GPT of SEQ ID NO: 36
  • the GS transgene is a GS 1 polynucleotide.
  • the GPT transgene may be encoded by a nucleotide sequence encoding the polypeptide of SEQ ID NO: 36, or a polypeptide having at least 75% and more preferably at ieast 80% sequence identity thereto which has GPT activity.
  • GPT polynucleotides suitable for use as GPT transgenes in the practice of the invention may be obtained by various means, as will be appreciated by one skilled in the art, tested for the ability to direct the expression of a GPT with GPT activity in a recombinant expression system (i.e., E. coli (see Examples 20-23), in a transient in pfanta expression system (see Example 19), or in a transgenic plant (see Examples 1-18).
  • a recombinant expression system i.e., E. coli (see Examples 20-23)
  • a transient in pfanta expression system see Example 19
  • transgenic plant see Examples 1-18.
  • the gene coding sequence for the desired transgene(s) must be incorporated into a nucleic acid construct (also interchangeably referred to herein as a (iransgene) expression vector, expression cassette, expression construct or expressible genetic construct) which can direct the expression of the transgene sequence in transformed piant celis.
  • a nucleic acid construct also interchangeably referred to herein as a (iransgene) expression vector, expression cassette, expression construct or expressible genetic construct
  • nucleic acid constructs carrying the transgene(s) of interest may be introduced into a piant cell or cells using a number of methods known in the art, including but not limited to electroporation, ONA bombardment or bioSistic approaches, microinjection, and via the use of various DNA-ba ⁇ ed vectors such as Agrobacteri ⁇ m t ⁇ mefaciens and Agrobacterium rhizogenes vectors.
  • the nucleic acid construct may direct the expression of the incorporated transgene(s) (i.e., GPT), either in a transient or stable fashion. Stable expression is preferred, and is achieved by utilizing plant transformation vectors which are able to direct the chromosomal integration of the transgene construct.
  • GPT transgene
  • a typical plant expression vector for generating transgenic plants wiii comprise the transgene of interest under the expression regulatory control of a promoter, a selectable marker for assisting in the selection of transformants, and a transcriptional terminator sequence.
  • the basic elements of a nucleic acid construct for use in generating the transgenic plants of the invention are: a suitable promoter capable of directing the functional expression of the transgene(s) in a transformed plant cell, the transgene (s) (i.e., GPT coding sequence) operably linked to the promoter, preferably a suitable transcription termination sequence (i.e., nopafi ⁇ e synthetic enzyme gene terminator) operabiy linked to the transgene, and typically other elements useful for controlling the expression of the transgene, as well as one or more selectable marker genes suitable for selecting the desired transgenic product (i.e., antibiotic resistance genes).
  • a suitable promoter capable of directing the functional expression of the transgene(s) in a transformed plant cell
  • the transgene (s) i.e., GPT coding sequence
  • a suitable transcription termination sequence i.e., nopafi ⁇ e synthetic enzyme gene terminator
  • Agrobacterium tumefaciens is the primary transformation system used to generate transgenic plants, there are numerous vectors designed for Agrobacterium transformation.
  • Agrobacterium systems utilize "binary" vectors that permit plasmid manipulation in both £ coli and Agrobacterium, and typically contain one or more selectable markers to recover transformed plants (Heiiens et a!., 2000, Technical focus: A guide to Agrobacterium binary Ti vectors. Trends Rant Sci 5:446-451).
  • Binary vectors for use in Agrobacterium transformation systems typically comprise the borders of T- DNA, multiple cloning sites, replication functions for Escherichia coli and A. tumefaciens, and selectable marker and reporter genes.
  • So-called "super-binary" vectors provide higher transformation efficiencies, and generally comprise additional virulence genes from a Ti (Komari et at., 2006, Methods MoI. ⁇ ioi. 343: 15-41).
  • Super binary vectors are typically used in plants which exhibit lower transformation efficiencies, such as cereals.
  • Such additional virulence genes include without limitation WrS, virE, and virG (Vain et aL, 2004, The effect of additional virulence genes on transformation efficiency, transgene integration and expression in rice plants using the pGreen/pSoup dual binary vector system.
  • expression vectors which place the inserted transgene(s) under the control of the constitutive CaMV 3SS promoter and the RuBisCo promoter are employed.
  • a number of expression vectors which ⁇ tifize the CaMV 35S and RuBsCo promoter are known and/or commercially available and/or derivable using ordinary skill in the art.
  • 'promoter' is used to designate a region in the genome sequence upstream of a gene transcription start site (TSS), although sequences downstream of TSS may also affect transcription initiation as well.
  • Promoter elements select the transcription initiation point, transcription specificity and rate.
  • 'proximal promoter' severe hundreds nucleotides around the TSS
  • 'distal promoter' thousands and more nucleotides upstream of the TSS
  • Both proximal and distal promoters include sets of various elements participating in the complex process of cell-, issue-, organ-, developmental stage and environmental factors- specific regulation of transcription. Most promoter elements regulating TSS selection are localized in the proximal promoter.
  • the selected promoters may be constitutive, non-specific promoters such as the Cauliflower Mosaic Virus 35S ribosomal promoter (CaMV 35S promoter), which is widely employed for the expression of tra ⁇ sgenes in plants.
  • CaMV 35S promoter Cauliflower Mosaic Virus 35S ribosomal promoter
  • Examples of other strong constitutive promoters include without limitation the rice actin 1 promoter, the CaMV 19S promoter, the Ti piasmid nopaiine synthase promoter, the alcohol dehydrogenase promoter and the sucrose synthase promoter.
  • a promoter based upon the desired plant cells to be transformed by the transgene construct, the desired expression level of the transgene, the desired tissue or subcellular compartment for transgene expression, the developmental stage targeted, and the like.
  • a promoter of the rib ⁇ iose bisphosphate carboxylase (RuBisCo) gene may be employed.
  • expressible nucleic acid constructs comprising QPT and GS1 transgenes under the control of a tomato RuBIsCo promoter were prepared and used in the generation of transgenic plants or to assay for GPT activity in ⁇ tanta or in E coll
  • promoters of various seed storage protein genes may be employed.
  • a fruit-specific promoter such as tomato 2A11 may be used.
  • tissue specific promoters include the promoters encoding lectin (Vodkin et al M 1983, Cell 34:1023-31: Lindstrom et aL, 1990, Developmental Genetics 11:160-167), com alcohol dehydrogenase 1 (Vogel et at, 1989, J. Cell. Biochem. (Suppl. 0) 13:Part D; Dennis et a!., 1984, Nucl.
  • inducible promoter sequences may be employed in cases where it is desirable to regulate transgene expression as the transgenic plant regenerates, matures, flowers, etc.
  • inducible promoters include promoters of heat shock genes, protection responding genes (i.e., phenylalanine ammonia lyase: see, for example Bevan et al., 1989, EMBO J. 8(7): 899-906), wound responding genes (i.e., cell wall protein genes), chemically inducible genes (i.e., nitrate reductase, chitinase) and dark inducible genes (i.e., asparagine synthetase; see, for example U.S.
  • Patent No. 5,256,558 a number of plant nuclear genes are activated by light, including gene families encoding the major chlorophyll a/b binding proteins (cab) as well as the small subunit of ribuiose-1 ,5-bisphosphate carboxylase ⁇ rbcS) (see, for example, Tobin and Silverthorne, 1985, Annu. Rev. Plant Physiol. 36: 569-593; Dean et al., 1989, Annu. Rev. Plant Physiol.40: 415-439.).
  • inducible promoters include ABA- and turgor-inducible promoters, the auxin-binding protein gene promoter (Schwob et al., 1993, Plant J. 4(3): 423-432), the UDP glucose flavonoid giycosyf-transferase gene promoter (Ralston et aL, 1988, Genetics 119(1): 185-197); the MPI proteinase inhibitor promoter (Cordero et al., 1994, Plant J. 6(2): 141-150), the glyceraidehyde-3-phosphate dehydrogenase gene promoter (Kohler et a!., 1995, Plant MoI. Biol.
  • the present invention discloses for the first time that plants contain a glutamine phenylpyruvate transaminase (GPT) enzyme which is directly functional in the synthesis of the signal metabolite 2-hydroxy-5-oxoproline.
  • GPT glutamine phenylpyruvate transaminase
  • Applicants have isolated and tested GPT polynucleotide coding sequences derived from several plant and animal species, and have successfully incorporated the gene into heterologous transgenic host plants which exhibit markedly improved growth characteristics, including faster growth, higher foliar protein content, increased glutamine synthetase activity in foliar tissue, and faster CCfe fixation rates,
  • the GPT gene functions as one of at least two transgenes incorporated into the transgenic plants of the invention, the other being the glutamine sythetase gene (see infra).
  • ali piant species contain a GPT which functions in the same metabolic pathway, involving the biosynthesis of the signal metabolite 2-hydroxy- 5-oxoproline.
  • any plant gene encoding a GPT homolog or functional variants thereof may be useful in the generation of transgenic plants of this invention.
  • other non- plant GPT homologs may be used in preparing GPT transgenes for use in generating the transgenic plants of the invention.
  • FIG.2 Poplar 85 93
  • the coding sequence thereof in E coli or another suitable host and determine whether the 2-oxogiutaramate signal metabolite is synthesized at increased levels (see Exampies 19*23). Where such an increase is demonstrated, the coding sequence may then be introduced into both homologous plant hosts and heterologous plant hosts, and growth characteristics evaluated. Any assay that is capable of detecting 2-oxoglutaramate with specificity may be used for this purpose, including without iimitation the NMR and HPLC assays described in Example 2, infra.
  • assays which measure GPT activity directly may be empioyed, such as the GPT activity assay described in Example 7.
  • Any plant GPT with 2-oxoglutaramate synthesis activity may be used to transform plant ceils in order to generate transgenic plants of the invention.
  • GPT transgenes expressed in a homologous piant would be expected to res ⁇ it in the desired enhanced-growth characteristics as weli (i.e., rice giutamine transaminase over-expressed in transgenic rice plants), although it is possible that regulation within a homologous celi may attenuate the expression of the transgene in some fashion that may not be operable in a heterologous cell.
  • the giutamine synthetase (GS) gene functions as one of at least two transgenes incorporated into the transgenic plants of the invention (GPT being the other of the two).
  • Giutamine synthetase plays a key role in nitrogen metabolism in plants, as well as in animals and bacteria.
  • the GS enzyme catalyzes the addition of ammonium to gl ⁇ tamate to synthesize giutamine in an ATP-dependent reaction.
  • GS enzymes from assorted species show highly conserved amino acid residues considered to be important for active site function, indicating that GS enzymes function similarly (for review, see Eisenberg et ai., Biochimtca et Biophysica Acta, 1477:122 145, 2000).
  • GS is distributed in different subcellular locations (chloroplast and cytoplasm) and is found in various plant tissues, including leaf, root, shoot, seeds and fruits.
  • cystolic isoform GS1
  • plastidic chloroplastic
  • GS2 is principally found in leaf tissue and functions in the assimilation of ammonia produced by photorespiraiion or by nitrate reductton.
  • GS1 is mainly found in leaf and root tissue, typically exists in a number of different isofcrms in higher plants, and functions to assimilate ammonia produced by all other physiological processes (Coruzzi, 1991, Plant Science 74: 145-155; McGrath and Coruzzi, 1991, Plant J. 1(3): 275-280; Lam et al, 1996, Ann. Rev. Plant Physiol. Plant MoI. Biol. 47: 569-593; Stitt, 1999. Curr. Op. Plant Biol. 2: 178-186; Oiiveira et at., 2001, Brazilian J. Med. Bioi. Res. 34: 567-575).
  • Multiple QS genes are associated with a complex promoter repertoire which enable the expression of GS in an organ and tissue specific manner, as well as in an environmental factor-dependent manner.
  • Plant glutamine synthetase consists of eight subunits, and the native enzyme in plants has a molecular mass ranging from 320 to 380 KD, each subunit having a molecular mass of between 38 and 45 k ⁇ .
  • Chloroplastic GS2 appears to be encoded by a single gene, while various cystoloic GS1 isoforms are encoded within m ⁇ ltigene families (Tingey et aL, 1987, supra; Sakamoto et al., 1989, Plant MoL BioL 13: 611-614; Brears et al, 1991, supra-, Li et al.. 1993, Plant MoI. Bio!., 23:401-407; Dubois et al.. 1996, Plant MoI. Biol., 31:803-817; Lam et al., 1996, supra).
  • GS1 multigene families appear to encode different subunits which may combine to form homo- or hetero-octamers.
  • a GS 1 gene coding sequence is employed to generate GS transgene constructs.
  • the Alfalfa or Arabidopsis GS1 gene coding sequence is used to generate a transgene construct that may be used to generate a transgenic plant expressing the GS1 transgene.
  • a construct may be used to transform Agrobacteria.
  • the transformed Agrobacte ⁇ a are then used to generate To transgenic plants.
  • Example 5 demonstrates the generation of To GS1 transgenic tobacco plants using this approach.
  • Examples 6 and 17 demonstrates the generation of To GS1 transgenic tomato plants
  • Example 8 demonstrates the generation of To GS1 transgenic pepper plants
  • Examples 9 and 10 demonstrate the generation of T 0 GS1 transgenic bean plants
  • Examples 11 and 12 demonstrate the generation of To GS1 transgenic cowpea plants
  • Example 13 demonstrates the generation of TQ GS1 transgenic alfalfa plants
  • Example 14 demonstrates the generation of T 0 GS 1 transgenic cantaloupe plants
  • Example 15 demonstrates the generation of T 0 GS 1 transgenic pumpkin plants
  • Example 16 demonstrates the generation of T 0 GS1 transgenic Arabidopsis plants
  • Example 18 demonstrates the generation of T 0 GS1 transgenic Cantaloupe plants.
  • a 3' transcription termination sequence is incorporated downstream of the transgene in order to direct the termination of transcription and permit correct polyadenylation of One mRNA transcript.
  • Suitable transcription terminators are those which are known to function in plants, including without limitation, the nopaline synthase (NOS) and octopine synthase (OCS) genes of Agrobacterium fomef ⁇ c/ens, the T7 transcript from the octopine synthase gene, the 3' end of the protease inhibitor I or Il genes from potato or tomato, the CaMV 35S terminator, the tml terminator and the pea rbcS E9 terminator.
  • a gene's native transcription terminator may be used. In specific embodiments, described by way of the Examples, infra, the nopaiine synthase transcription terminator is employed.
  • Selectable markers are typically included in transgene expression vectors in order to provide a means for selecting transformants. While various types of markers are available, various negative selection markers are typically utilized, including those which confer resistance to a selection agent that inhibits or kills ⁇ ntransformed cells, such as genes which impart resistance to an antibiotic (such as kanamycin, gentamycin, anamycin, hygromycin and hygromycinB) or resistance to a herbicide (such as sulfonylurea, gulfosinate, phosphinothricin and glyphosate). Screenable markers include, for example, genes encoding ⁇ - glucuronidase (Jefferson. 1987, Plant MoI. Biol.
  • transgene expression vector constructs of the invention into a plant or plant cell are well known to those skilled in the art, and any capable of transforming the target plant or plant cell may be utilized.
  • Agrobacterium-medtat ⁇ transformation is perhaps the most common method utilized in plant transgenics, and protocols for Agrobacteriurn-me ⁇ iateti transformation of a large number of plants are extensively described in the literature (see, for example, Agrobacterium Protocols, Wan, ed., Humana Press, 2 nd edition, 2006).
  • Agrobacterium tum ⁇ faciens is a Gram negative soil bacteria that causes tumors (Crown Gafl disease) in a great many dicot species, via the insertion of a small segment of tumor-inducing DNA ⁇ "T-DNA", transfer DNA') into the plant cell, which is incorporated at a semi-random location into the plant genome, and which eventually may become stably incorporated there.
  • Directly repeated DNA sequences, called T-DNA borders define the left and the right ends of the T-DNA.
  • the T-DNA can be physically separated from the remainder of the Ti-piasmid, creating a 'binary vector* system.
  • Agrobacterium transformation may be used for stably transforming dicots, monocots, and cells thereof (Rogers et al., 1986, Methods Enzymol., 118: 627- 641; Hernalsteen et a!., 1984, EMBO J., 3: 3039*3041; Hoykass-Van Siogteren et a!.. 1984, Nature. 311: 763-764; Grimsley et al., 1987, Nature 325: 167-1679; Boulton et al.. 1989, Plant MoI. Biol 12: 31-40; Gould et al., 1991, Plant Physiol. 95: 426-434).
  • Agrobacterium-mexiteted transformation may be used to obtain transient expression of a transgene via the transcriptional competency of unincorporated transgene construct molecules (Helens etai., 2005, Plant Methods 1:13).
  • Agrobacterium transformation vectors and methods have been described (Karimi et al., 2002, Trends Plant ScL 7(5): 193-5), and many such vectors may be obtained commercially ⁇ for example, Invitrogen).
  • a growing number of "open-source" Agrobacterium transformation vectors are available (for example, pCambia vectors; Cambia, Canberra, Australia). See, also, subsection herein on TRANSGENE CONSTRUCTS, supra.
  • a pMON316-based vector was used in the leaf disc transformation system of Horsch et. al. (Horsch et al.,1995, Science 227:1229-1231) to generate growth enhanced transgenic tobacco and tomato plants.
  • PEG polyethylene glycol
  • electroporation Paszkowski ⁇ t al., 1984, EMBO J. 3: 2727-2722
  • Potrykus et al. 1985, MoI. Gen. Genet 199: 169-177
  • ⁇ iolistic transformation involves injecting millions of DNA-coated metal particles into target cells or tissues using a biolistic device (or "gene gun"), several kinds of which are available commercially; once inside the cell, the DNA elutes off the particles and a portion may be stably incorporated into one or more of the cell's chromosomes (for review, see Kikkert et al., 2005, S&fcte Transformation of Plant Cells by Particle Bombardment/Biotistics, in: Methods in Molecular Biology, vol. 286: Transgenic Plants: Methods and Protocols, Ed. L. Pefla, Humana Press Inc., Totowa, NJ).
  • Electroporation is a technique that utilizes short, high-intensity electric fields to permeabilize reversibiy the lipid btlayers of ceil membranes (see, for example, Ftsk and Dandekar, 2005, Introduction and Expression of Transgenes in Plant Protoplasts, in: Methods in Molecular Biology, vol. 286: Transgenic Rants: Methods and Protocols, Ed. L. Pefia, Humana Press Inc., Totowa, NJ, pp. 79-90; Fromm et al.,1987, Electroporation of DNA and RNA into plant protoplasts, in Methods in Enzymology, Vol. 153, Wu and Grossman, eds., Academic Press, London, UK 1 pp.
  • the technique operates by creating aqueous pores in the bacterial membrane, which are of sufficiently large size to allow DNA molecuies (and other macromolecuies) to enter the ceil, where the transgene expression construct (as T-DNA) may be stably incorporated into plant genomic DNA, leading to the generation of transformed cells that can s ⁇ bseq ⁇ entiy be regenerated into transgenic plants.
  • Newer transformation methods include so-called "flora! dip” methods, which offer the promise of simplicity, without requiting plant tissue culture, as is the case with all other commonly used transformation methodologies (Bent et aL, 2006, Ar ⁇ bidopsis thahana Floral Dip Transformation Method, Methods MoI Biol, voi. 343: Agrobacte ⁇ um Protocols, 2/e, volume 1; Ed., Wang, Humana Press Inc., Totowa, NJ, pp. 87-103; Clough and Bent. 1998, Floral dip: a simplified method for Agrobacterium-mediated transformation of Arabidopsis thaliana, Plant J. 16: 735-743).
  • floral dip transformation is accomplished by dipping or spraying flowering plants in with an appropriate strain of Agrobacte ⁇ um tumefaciens. Seeds collected from these To plants are then germinated under selection to identify transgenic Ti individuals.
  • Example 16 demonstrated floral dip inoculation of Arabidopsis to generate transgenic Arabidopsis plants.
  • transformation methods include those in which the developing seeds or seedlings of plants are transformed using vectors such as Agrobacterium vectors.
  • vectors such as Agrobacterium vectors.
  • such vectors may be used to transform developing seeds by injecting a suspension or mixture of the vector (i.e., Agrobact ⁇ ria) directly into the seed cavity of developing pods (i.e., pepper pods, bean pods, pea pods and the like).
  • Seedlings may be transformed as described for Alfalfa in Example 13.
  • Germinating seeds may be transformed as described for Cameiina in Example 18.
  • Intra-fruft methods in which the vector is injected into fruit or developing fruit, may be used as described for Cantaloupe melons in Example 14 and pumpkins in Example 15.
  • Still other transformation methods include those in which the flower structure is targeted for vector inoculation, such as the flower inoculation methods described for beans in Examples 9 and 10, peas in ⁇ Examples 11 and 12 and tomatoes in Example 17.
  • the foregoing plant transformation methodologies may be used to introduce transgenes into a number of different plant cells and tissues, including without limitation, whole plants, tissue and organ explants including chloropfasts, flowering tissues and cells, protoplasts, meristem cells, callus, immature embryos and gametic cells such as microspores, pollen, sperm and egg ceils, tissue cultured ceils of any of the foregoing, any other cells from which a fertile regenerated transgenic plant may be generated.
  • Callus is initiated from tissue sources including, but not limited to. immature embryos, seedling apical meristems, microspores and the like. Cells capable of proliferating as callus are also recipient cells for genetic transformation.
  • transformed plantlets derived from transformed cells or tissues are cultured in a root-permissive growth medium supplemented with the selective agent used in the transformation strategy (i.e., and antibiotic such as kanamycin). Once rooted, transformed plantlets are then transferred to soil and allowed to grow to maturity. Upon fiowering, the mature plants are preferably seifed (self- fertiiized), and the resultant seeds harvested and used to grow subsequent generations. Examples 3 - 6 describe the regeneration of transgenic tobacco and tomato plants.
  • To transgenic plants may be used to generate subsequent generations (e.g., Ti, T 2 , etc.) by selfing of primary or secondary transformants, or by sexual crossing of primary or secondary transformants with other plants (transformed or untransformed).
  • subsequent generations e.g., Ti, T 2 , etc.
  • individual plants over expressing Hie Alfalfa GS1 gene and outperforming wildtype plants were crossed with individual plants over-expressing the Arabidopsis GPT gene and outperforming wiidtype plants, by simple sexual crossing using manual poiien transfer. Reciprocal crosses were made such that each plant served as the maie in a set of crosses and each plant served as the female in a second set of crosses.
  • the plants are typically examined for growth phenotype, CO 2 fixation rate, etc. (see following subsection).
  • Transgenic plants may be selected, screened and characterized using standard methodologies.
  • the preferred transgenic plants of the invention will exhibit one or more phenotypic characteristics indicative of enhanced growth and/or other desirable agronomic properties.
  • Transgenic plants are typically regenerated under selective pressure in order to select transforma ⁇ ts prior to creating subsequent transgenic plant generations.
  • the selective pressure used may be employed beyond T 0 generations in order to ensure the presence of the desired transgene expression construct or cassette.
  • calli, tissues or plants may be identified and isolated by selecting or screening for the genetic composition of and/or the phenotypic characteristics encoded by marker genes contained in the transgene expression construct used for the transformation. For example, selection may be conducted by growing potentially-transformed plants, tissues or cells in a growth medium containing a repressive amount of antibiotic or herbicide to which the transforming genetic construct can impart resistance. Further, the transformed plant cells, tissues and plants can be identified by screening for Hie activity of marker genes (such as ⁇ -glucuronidase) which may be present in the transgene expression construct.
  • marker genes such as ⁇ -glucuronidase
  • RNA transcription methods may be employed for identifying plants containing the desired transgene expression construct, as is well known. Examples of such methods include Southern blot analysis or various nucleic acid amplification methods (i.e., PCR) for identifying the transgene, transgene expression construct or elements thereof; Northern blotting, S1 RNase protection, reverse transcriptase PCR (RT-PCR) amplification for detecting and determining the RNA transcription products; and protein gel electrophoresis, Western blotting, immu ⁇ oprecipitatio ⁇ , enzyme immunoassay, and the like for identifying the protein encoded and expressed by the transgene.
  • PCR nucleic acid amplification methods
  • RT-PCR reverse transcriptase PCR
  • expression levels of genes, proteins and/or metabolic compounds that are know to be modulated by transgene expression in the target plant may be used to identify transforma ⁇ ts.
  • increased levels of the signal metabolite 2-oxoglutaramaie may be used to screen for desirable transformants, as exemplified in the Examples.
  • increased levels of GPT and/or GS activity may be assayed, as exemplified in the Examples.
  • the transformed plants of the invention may be screened for enhanced growth and/or other desirabie agronomic characteristics, indeed, some degree of phenotypic screening is generally desirabie in order to identify transformed lines with the fastest growth rates, the highest seed yieids, etc., particuiariy when identifying plants for subsequent selfing, cross-breeding and back-crossing.
  • Various parameters may be used for this purpose, including without limitation, growth rates, total fresh weights, dry weights, seed and fruit yields (number, weight), seed and/or seed pod sizes, seed pod yields (e.g., number, weight), leaf sizes, plant sizes, increased flowering, time to flowering, overall protein content (in seeds, fruits, plant tissues), specific protein content (i.e., GS), nitrogen content, free amino acid, and specific metabolic compound levels (i.e., 2-oxoglutaramate).
  • growth rates total fresh weights, dry weights, seed and fruit yields (number, weight), seed and/or seed pod sizes, seed pod yields (e.g., number, weight), leaf sizes, plant sizes, increased flowering, time to flowering, overall protein content (in seeds, fruits, plant tissues), specific protein content (i.e., GS), nitrogen content, free amino acid, and specific metabolic compound levels (i.e., 2-oxoglutaramate).
  • these phenotypic measurements are compared with those obtained from a parental identical or anaiogous plant line, an untransformed identicai or anaiogous plant, or an identical or anaiogous wild-type plant (i.e., a normal or parental plant).
  • the measurement of the chosen phenotypic characteristics) in the target transgenic plant is done in paraiiei with measurement of the same characteristtc(s) in a normal or parental plant.
  • multiple plants are used to establish the phenotypic desirability and/or superiority of the transgenic plant in respect of any particular phenotypic characteristic.
  • transformants are selected and then used to generate Ti and subsequent generations by selfing (self-fertilization), until the transgene genotype breeds true (i.e., the plant is homozygous for the transgene). In practice, this is accomplished by selfing for 3 or 4 generations, screening at each generation for the desired traits and setting those individuals.
  • transgenic plant Sines propagated through at least one sexual generation See tobacco, Arabidopsis, Tomato
  • tobacco, Arabidopsis, Tomato demonstrated higher transgene product activities compared to lines that did not have the benefit of sexual reproduction and the concomitant increase in transgene copy number.
  • Stable transgenic lines may be crossed and back-crossed to create varieties with any number of desired traits, including those with stacked transgenes, multiple copies of a transgene, etc. Additionally, stable transgenic plants may be further modified genetically, by transforming such plants with further transgenes or additional copies of the parental transgene. Also contemplated are transgenic plants created by single transformation events which introduce multiple copies of a given transgene or multiple transgenes. Various common breeding methods are well know to those skilled in the art (see, e.g., Breeding Methods for Cultivar Development, Wilcox J. ed., American Society of Agronomy, Madison Wis. (1987)).
  • the invention provides transgenic plants characterized by increased nitrogen use efficiency.
  • Nitrogen use efficiency may be expressed as plant yield per given amount of nitrogen.
  • the transgene and control plants all received the same nutrient solutions in the same amounts.
  • the transgenic plants were consistently characterized by higher yields, and thus have higher nitrogen use efficiencies.
  • the invention provides transgenic plants and seeds thereof with increased tolerance to high salt growth conditions.
  • This aspect of the invention is exemplified by Example 24, which describes the germination of transgenic tobacco plant seeds in very high salt conditions (200 mM NaCl). While counterpart wild type tobacco seeds germinated at a rate of only about 10%, on average, the transgenic tobacco seeds achieved nearly the same rate of germination obtained under no salt conditions for both transgenic and wild type seeds, or about 92%.
  • EXAMPLE 1 ISLOATION OF ARABtDOPSIS GLUAMfNE PHENYLPYRUVATE TRANSAMINASE (GPT) GENE:
  • cysteine conjugate & -lyase also referred in the literature as cysteine conjugate & -lyase, kyneurenine aminotransferase, giutamine phenyipyruvate transaminase, and other names
  • cysteine conjugate & -lyase had been shown to be involved in processing of cysteine conjugates of halogenated xenobiotics (Perry et al., 1995, FEBS Letters 360:277-280).
  • human cysteine conjugate ⁇ lyase Rather than having an activity involved in nitrogen metabolism, however, human cysteine conjugate ⁇ lyase has a detoxifying activity in humans, and in animals. Nevertheless, the potential involvement of this protein in the synthesis of 2- oxoglutaramate was of interest.
  • primers were designed to incorporate CIa I (ATCGAT) and Kpn I (GGTACC) restriction sites to facilitate subsequent subcloning into expression vectors for generating transgenic plants.
  • Takara ExTaq DNA polymerase enzyme was used lor high fidelity PCR using the following conditions: initial denaturing 94C for 4 minutes, 30 cycles of 94C 30 second, annealing at 55C for 30 seconds, extension at 72C for 90 seconds, with a final extension of 72C for 7 minutes.
  • the amplification product was digested with Cia I and Kpn 1 restriction enzymes, isolated from an agarose gel electrophoresis and ligated into vector pMon316 (Rogers, et at.
  • a 1.3 kb cDNA was isolated and sequenced, and found to encode a full length protein of 440 amino acids in length, including a putative chloropiast signal sequence.
  • EXAMPLE 2 PRODUCTION OF BIOLOGICALLY ACTIVE RECOMBINANT ARABIDOPSIS GLUTAMINE PHENYLPYRUVATE TRANSAMINASE (GPT):
  • the cDNA was expressed in E coll, purified, and assayed for its ability to synthesize 2-oxogi ⁇ taramate using a standard method
  • the products of the reaction are 2- oxogluiaramate and glycine, while the substrates (gi ⁇ tami ⁇ e and glyoxyiate) diminish in abundance.
  • the cyclic 2-oxogiutaramate gives rise to a distinctive signal allowing it to be readily distinguished from the open chain giutamine precursor.
  • An alternative assay for GPT activity uses HPLC to determine 2-oxoglutaramate production, following a modification of Calderon et al., 1985, J Bacterid 161(2): 807-809. Briefly, a modified extraction buffer consisting of 25 mM Tris-HCl pH 8.5, 1 mM EDTA, 20 ⁇ M FAO. 10 mM Cysteine, and -1.5% (v/v) Mercaptoethanol. Tissue samples from the test material ⁇ i.e., plant tissue) are added to the extraction buffer at approximately a 1/3 ratio (w/v), incubated for 30 minutes at 37 V C, and stopped with 200 ⁇ ! of 20% TCA.
  • the assay mixture is centrifug ⁇ d and the supernatant used to quantify 2-oxoglutaramate by HPLC, using an ION-300 7.8mm IO X 30 cm L column, with a mobile phase In 0.01 N h2SO4, a flow rate of approximately 0.2 ml/min, at 40*C. Injection volume is approximately 20 ⁇ l, and retention time between about 38 and 39 minutes. Detection is achieved with 210nm UV light.
  • test protein was able to catalyze the synthesis of 2- ⁇ xoglutaramate. Therefore, these data indicate that the isolated cDNA encodes a giutamine phenyipyruvate transaminase that is directly involved in the synthesis of 2-oxoglutaramate in plants. Accordingly, the test protein was designated Arabidopsis giutamine phenyipyruvate transaminase, or "GPT".
  • the nucleotide sequence of the Arabidopsis GPT coding sequence is shown in the Table of Sequences, SEQ ID NO. 1.
  • the translated amino acid sequence of the GPT protein is shown in SEQ ID NO.2.
  • EXAMPLE 3 CREATION OF TRANSGENIC TOBACCO PLANTS OVER- EXPRESSING ARABIDOPSIS GPT:
  • the plant expression vector pMon31 ⁇ -PJU was constructed as follows.
  • the isolated cDNA encoding Arabidopsis GPT (Example 1) was cloned into the Clal-Kpnl polylinker site of the pMON316 vector, which places the GPT gene under the contra! of the constitutive cauliflower mosaic virus (CaMV) 35S promoter and the nopa ⁇ ne synthase (NOS) transcriptional terminator, A kanarnycin resistance gene was included to provide a selectable marker.
  • CaMV constitutive cauliflower mosaic virus
  • NOS nopa ⁇ ne synthase
  • a ⁇ roftactem/m-Mediated Plant Transformations pMON-PJU and a control vector pMon316 (without inserted ONA) were transferred to Agrobacterium t ⁇ m ⁇ faciens strain p ⁇ iTT37ASE using a standard electroporation method (McCormac et al., 1998, Molecular Biotechnology 9:155- 159), followed by plating on LB plates containing the antibiotics spectinomycin (100 micro gm / ml) and kanarnycin (50 micro gm / ml). Antibiotic resistant colonies of Agrobacterium were examined by PCR to assure that they contained plasmid,
  • Nicotians tabac ⁇ m cv. Xanthi plants were transformed with pMON-PJU transformed Agrobacte ⁇ a using the ieaf disc transformation system of Horsch et. al. (Horsch et al.,1995, Science 227:1229-1231). Briefly, sterile leaf disks were inoculated and cultured for 2 days, then transferred to selective MS media containing 100 ⁇ g/ml kanarnycin and 500 ⁇ g/ml clafanm Transformants were confirmed by their ability to form roots in the selective media.
  • T1 and T2 Generation GPT Transgenic Plants Seeds harvested form the To generation of the transgenic tobacco plants were germinated on M&S media containing kanamycin (100 mg / L) to enrich for the transgene. At least one fourth of the seeds did not germinate on this media ⁇ kanamycin is expected to inhibit germination of the seeds without resistance that would have been produced as a result of normal genetic segregation of the gene) and more than half of the remaining seeds were removed because of demonstrated sensitivity (even mild) to the kanamycin.
  • Ti generation The surviving plants (Ti generation) were thriving and these plants were then seffed to produce seeds for the T 2 generation. Seeds from the Ti generation were germinated on MS media supplemented for the transformant lines with kanamycin (10mg/iiter). After 14 days they were transferred to sand and provided quarter strength Hoagiand's nutrient solution supplemented with 25 mM potassium nitrate. They were allowed to grow at 24°C with a photoperiod of 16 h light and 8 hr dark with a light intensity of 900 micromoles per meter squared per second They were harvested 14 days after being transferred to the sand culture.
  • the GPT transgenic tobacco plants showed enhanced growth characteristics.
  • the GPT transgenic plants exhibited a greater than 50% increase in the rate of CO 2 fixation, and a greater than two-fold increase in gl ⁇ tamine synthetase activity in leaf tissue, relative to wild type control plants.
  • the leaf-to-root GS ratio increased by almost three-fold in the transaminase transgenic plants relative to wild type control.
  • Fresh weight and total protein quantity also increased in the transgenic plants, by about 50% and 80% (leaf), respectively, reiative to the wild type control-
  • Transgenic Lycop ⁇ rsicon ⁇ sculent ⁇ m (Micro-Tom Tomato) plants carrying the Arabidopsis QPT transgene were generated using the vectors and methods described in Example 3.
  • initial growth characteristic data of the GPT transgenic tomato plants is presented in Table Ii.
  • the transgenic plants showed significant enhancement of growth rate, flowering, and seed yield in relatbn to wild type control plants, in addition, the transgenic plants developed multiple main stems, whereas wild type plants developed with a single main stem.
  • a photograph of a GPT transgenic tomato plant compared to a wild type plant is presented in FIG. 3 (together with GS1 transgenic tomato plants, see Example 6).
  • EXAMPLE 5 GENERATION OF TRANSGENIC TOBACCO PLANTS OVEREXPRESSING ALFALFA GS1 :
  • Transgenic tobacco plants overexpressing the Alfalfa GS 1 gene were generated as previously described (Temple et ai., 1993, Moi. Gen. Genetics 236: 315-325). Briefly, the plant expression vector pGS111 was constructed by inserting the entire coding sequence together with extensive regions of both the 5' and 3' untranslated regions of the Alfalfa GS1 gene (SEQ IO NO: 3] (DasSarma at ai.,
  • kanamycin resistance gene was included to provide a selectable marker.
  • GS1 Transformants pGS111 was transferred to Agrobact ⁇ rium tumefaciens strain pTiTT37ASE using triparental mating as described (Rogers et a!., 1987, supra; Unkefer et a)., U.S. Patent No. 6,555,500). Nicotiana tabac ⁇ m cv. Xanthi plants were transformed with pGS111 transformed Agrobacteria using the leaf disc transformation system of Horsch et. al. (Horsch et al.,1995, Science 227:1229-1231). Transformants were selected and regenerated on MS medium containing 100 ⁇ g/ml kanamycin.
  • Transgenic Lycopersicon esculentum plants carrying the Alfalfa GS 1 transgene were generated using the vector described in Example 5 and a transformation protocol essentially as described (Sun et al., 2006. Plant Cell
  • T 0 transgenic tomato plants were generated and grown to maturity.
  • Initial growth characteristic data of the GPT transgenic tomato plants is presented in Table III.
  • the transgenic plants showed significant enhancement of growth rate, flowering, and seed yield in relation to wild type control plants.
  • the transgenic plants developed multiple main stems, whereas wild type plants developed with a single main stem.
  • a photograph of a GS1 transgenic tomato plant compared to a wild type plant is presented in FIG. 3 (together with
  • EXAMPLE 7 GENERATION OF DOUBLE TRANSGENIC TOBACCO PLANTS CARRYING GS1 AND GPT TRANSGENES:
  • GPT activity was extracted from fresh plant tissue after grinding in cold 100 mM Trts-HCl, pH 7.6, containing 1 mm ethylenediaminetetraacetic, 200 mM pyrldoxal phosphate and 6 mM mercaptoethanol in a ratio of 3 ml per gram of tissue. The extract was clarified by centrif ⁇ gation and used in the assay.
  • GS activity was extracted from fresh plant tissue after grinding in cold 50 mM imidazole, pH 7.5 containing 10 mM MgCI2, and 12.5 mM mercaptoethanol in a ratio of 3 ml per gram of tissue. The extract was clarified by centrifugation and used in the assay.
  • GPT activity was assayed as described in Calderon and Mora, 1985, Journal Bacteriology 161:807-809. GS activity was measured as described in Shapiro and Stadtmann, 1970, Methods in Enzymology 17 A: 910-922. Both assays involve an incubation with substrates and cofactor at the proper pH. Detection was by HPLC.
  • FIG. 5 and FIG. 6 show much larger whole plants, larger leaves, and earlier and/or more abundant flowering In comparison to the parental singie-transgene plants and wild type control plants.
  • double-transgene progeny plants form these crosses showed tremendous increases total biomass (fresh weight), with fresh weights ranging from 45-89 grams per individual progeny plant, compared to a range of only 19-24 grams per individual wild type plant, representing on average, about a two- to three-fold increase over wild type plants, and representing at the high end, an astonishing four-fold increase in biomass over wild type plants.
  • fresh weights ranging from 45-89 grams per individual progeny plant, compared to a range of only 19-24 grams per individual wild type plant, representing on average, about a two- to three-fold increase over wild type plants, and representing at the high end, an astonishing four-fold increase in biomass over wild type plants.
  • the average individual plant biomass was about 2.75 times that of the average wild type control plant.
  • Four of the progeny lines showed approximately 2.5 fold greater average per plant fresh weights, whiie two lines showed over three-fold greater fresh weights in comparison to wild type plants.
  • the double-transgene progeny plants also showed far more than an additive growth enhancement.
  • GPT singie-transgene iines show as much as about a 50% increase over wild type biomass
  • GS1 singie-transgene iines as much as a 66% increase
  • progeny plants averaged almost a 200% increase over wild type plants.
  • the double transgene progeny plants flowered earlier and more prolificaity than either the wild type or singie transgene parental lines, and produced a far greater number of seed pods as well as total number of seeds per plant.
  • Table IV.B shows growth rate, biomass and yield, and biochemical characteristics of Line XX (Line 3 further selfed) compared to the single transgene line expressing GS1 and wild type control tobacco. All parameters are greatly increased in the double transgenic plant (Line XX). Notably, 2-oxoglutaramate activity was almost 17-fold higher, and seed yield and foliar biomass was three-fold higher, in Line XX plants versus control plants.
  • EXAMPLE 8 GENERATION OF DOUBLE TRANSGENIC PEPPER PLANTS CARRYING GS1 AND GPT TRANSGENES:
  • Big Jim chili pepper plants (New Mexico varietal) were transformed with the Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control of the CMV 35S promoter, and the Arabidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuBIsCo promoter, using Agrobacterium-mediated transfer to seed pods. After 3 days, seeds were harvested and used to generate TO plants and screened for transformants. The resulting double-transgenic plants showed higher pod yields, faster growth rates, and greater biomass yields in comparison to the control plants.
  • SUB ( ) aterials and Methods: ofanaceae Capisicum Pepper plants ("Big Jim” varietal) were transformed with the abidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control of e CMV 35S promoter within the expression vector pMON (see Example 3), and the abidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the Ru ⁇ isCo omoter within the expression vector pCambia 1201 (Tomato rubisco rbcS3C omoter: Kyozulka et al.. 1993, Plant Physiol.
  • the Cambia 1201 or 1305.1 vectors were nstructed according to standard cloning methods (Sambrook et a!., 1989, supra,aiki et al., 1988, Science 239: 487-491 ).
  • the vector is supplied with a 35S CaMV omoter; that promoter was replaced with RcbS-3C promoter from tomato to control e expression of the target gene.
  • the Cambia 1201 vectors contain bacterial iorophenicoi and plant hygromycin resistance selectable marker genes.
  • Theambia 1305.1 vectors contain bacteria!
  • he transgene expression vectors pMON (GPT transgene) and pCambia 1201 (GSansgene) were transferred to separate Agrotoacterium tutmfaciens strain LBA4404 ltures using a standard electroporation method (McCormac et al., 1998, Molecular otechnology 9:155-159).
  • Transformed Agrobacterium were selected on media ntaining 50 ⁇ g/ml of either streptamycin for pMON constructs or chloroamphenicol r the Cambia constructs.
  • Transformed Agrobacterium ceils were grown in LB lture media containing 25 ⁇ g/ml of antibiotic for 36 hours.
  • FIG. 7 shows a photograph of aPT+GS double transgenic pepper plant compared to a control plant grown for the me time under identical conditions. This photograph shows tremendous peppereld in the transgenic line compared to the control plant. able V presents biomass yield and GS activity, as well as transgene genotyping, in e transgenic lines compared to the wild type control.
  • XAMPLE 9 GENERATION OF DOUBLE TRANSGENIC BEAN PLANTS ARRYING ARABIDOPSiS GS1 AND GPT TRANSGENES:
  • yellow wax bean plants ⁇ Phaseolus vulgaris were transformed withe Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control the CMV 35S promoter within the expression vector pCambia 1201 , an ⁇ the abidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuBisCo omoter within the expression vector pCambia 1201 , using Agrobacterium-mediatedansfer into flowers.
  • pCambia 1201-GPT vector construct of SEQ IDO: 27
  • pCambia 1201 -GS vector construct of SEQ ID NO: 6
  • pCambia 1201 -GPT vector construct of SEQ IDO: 27
  • pCambia 1201 -GS vector construct of SEQ ID NO: 6
  • ansformed Agrobacterium were selected on media containing 50 ⁇ g/mt of foroampheniool.
  • Transformed Agrobacterium cells were grown in LB culture media ntaining 25 ⁇ g/ml of antibiotic for 36 hours.
  • Glutamine synthetase (GS) activity was assayed according the methods in Shapiro and Stadtmann, 1970, Methods in Enzymology 17A: 910-22; and, Glutamine phenyipyruvate transaminase (GPT) activity was assayed cording to the methods in Caideron et ai., 1985, J. Bacterioi. 161: 807-809. Seeetails in Example 7, Methods, supra, esults: he results are presented in FIG. 8, FIG. 9 and Table Vl.
  • G- 8 shows GPT+GS transgenic bean line A growth rate data relative to control ants, including plant heights on various days into cultivation, as well as numbers of were buds, flowers, and bean pods. These data show that the GPT+GS double ansgenic bean plants outgrew their counterpart control plants. The transgenic ants grew taller, flowered earlier and produced more flower buds and flowers, and eveloped bean pods and produced more bean pods that the wild type control plants.
  • abie Vl presents bean pod yield, GPT and GS activity, as weii as antibiotic sistance status, in the transgenic lines compared to the wiid type control (average several robust control plants; control plants that did not grow well were excluded om the analyses).
  • double-transgene progeny plants showed bstantial bean pod biomass increases (fresh pod weight) in comparison to the ntrol plants, with bean pod biomass yields consistently above 200 grams per dividual transgenic plant, compared to an average of 127 grams per wild type plant, presenting an over 60% increase in pod yield in the double transgene iines relative control piant(s). astly, FIG.
  • XAMPLE 10 GENERATION OF DOUBLE TRANSGENIC BEAN PLANTS ARRYING ARABIDOPSiS GS1 AND GRAPE GPT TRANSGENES;
  • yellow wax bean plants (Phaseolus vulgaris) were transformed with e Grape GPT full length coding sequence of SEQ ID NO: 8 under the control of theuBisCo promoter within the expression vector pCambia 1305.1, and the abidopsls GS1 coding sequence of SEQ ID NO: 6 under the control of the Ru ⁇ isCo omoter within the expression vector pCambia 1201 , using Agrobacterium-mediatedansfer into developing pods.
  • he transgene expression vectors pCambia 12G1-GPT(grape) (vector construct ofEQ ID NO: 8) and pCambia 1201 -GS (vector construct of SEQ ID NO: 6) wereansferred to separate Agrobacterium tumefaciens strain LBA4404 cultures using aandard electroporation method (McCormac et al., 1998, Molecular Biotechnology 155-159).
  • Transformed Agrobacterium were selected on media containing 50g/ml of chloramphenicol.
  • Transformed Agrobacterium cells were grown in LB lture media containing 25 ⁇ g/ml of antibiotic for 36 hours.
  • TABtE ViI TRANSGENIC BEANS LINE G: POD YIELDS ant type Bean Pod Yield FWt, g Antibiotic Resistance ild type, avg 157.9 Negative 1 200.5 + 2 178.3 + T Wildtype; FWt Fresh Weight; NM Not Measured able VH presents bean pod yield and antibiotic resistance status, in the transgenic es compared to the wild type control (average of several robust control plants; ntrol plants that did not grow well were excluded from the analyses).
  • FIG. 11 shows a photograph of a GPT+GS double transgenic bean plant mpared to a control plant grown for the same time under identical conditions. Theansgenic plant shows substantially increased size and biomass, larger leaves and a ore mature flowering compared to the control plant.
  • XAMPLE 11 GENERATiON OF DOUBLE TRANSGENIC COWPEA PLANTSARRYING ARABIDOPSiS GS1 AND GPT TRANSGENES:
  • FIG. 12 shows relative owth rates for the GPT+GS transgenic Cowpea line A and wild type controlowpea at several intervals during cultivation, including (FIG.
  • FIG. 12A height andngest leaf measurements, (FIG. 128) trifolate leafs and flower buds, and (FIG. 12C) wass, flower buds and pea pods.
  • Pea Pod GPT Activity GS Activity nmoles/h/gF umol/min/gF Antibiotic ant Type Yield, Wt Wt Resistance FWL g ildtype, avg 74.7 44.4 28.3
  • Negative A 112.8 NM 41.3 + B 113.8 736.2 54.9 + able VHi presents pea pod yield, GPT and GS activity, as weli as antibiotic sistance status, in the transgenic lines compared to the wiid type control (average several robust control plants; control plants that did not grow well were excluded om the analyses).
  • FIG. 13 shows a photograph of a GPT+GS double transgenic bean plant mpared to a control plant grown for the same time under identical conditions, owing increased biomass and pod yield in the transgenic plant relative to the wild pe control plant.
  • XAMPLE 12 GENERATION OF DOUBLE TRANSGENIC COWPEA PLANTS ARRYING ARABiDOPSIS GS1 AND GRAPE GPT TRANSGENES:
  • FIG. 14 shows relative growth rates for the GPT+GS transgenic Cowpea iine G and id type control Cowpea. These data show that the transgenic plants are nsistently higher (FIG. 14A), produce substantially more flowers, flower buds andea pods (FIG. 14B), and develop trifolates and leaf buds faster (FiG. 14C).
  • GPT Activity GS Activity Ana* GPT Activity GS Activity Ana*,,,- ant Type nmoles/h/gF umol/min/gF ⁇ WT Wt ildtype, ayg ! 59.7 ! 44.4 26.7 N£9MY e , . ⁇ ⁇ "" ⁇ ⁇ ——”— T W ⁇ dtype; TM able IX presents pea pod yield, GPT and GS activity, as weii as antibiotic resistanceatus, in the transgenic lines compared to the wild type control (average of several bust control plants; control plants that did not grow well were excluded from thenalyses).
  • FIG. 15 shows a photograph of a GPT+GS double transgenic pea plant mpared to a control plant grown for the same time under identical conditions, owing increased height, biomass and leaf size in the transgenic plant relative to e wild type control plant.
  • XAMPLE 13 GENERATiON OF DOUBLE TRANSGENIC ALFALFA PLANTSARRYING ARABIDOPSIS GS1 AND GPT TRANSGENES:
  • Alfalfa plants (Medicago sativa, var Ladak) were transformed with e Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control the CMV 358 promoter within the expression vector pMON316 (see Example 3,upra), and the Arabidopsis GS 1 coding sequence of SEQ ID NO: 6 under the control the RuBisCo promoter within the expression vector pCambia 1201 (vector nstruct of SEQ ID NO: 6), using Agrobacterium-mediated transfer into seedlingants.
  • Agrobacteri ⁇ m vectors and mixtures were prepared for seedling inoculations described in Example 11, supra.
  • Alfalfa seedlings were stili less than about 1/2 inch tail, they were soaked inaper toweling that had been flooded with the Agrobacteria mixture containing bothansgene constructs. The seedlings were left in the paper toweling for two to threeays, removed an ⁇ then planted in potting soil. Resulting TO and control plants were en grown for the first 30 days in a growth chamber, thereafter cultivated in a eenhouse, and then harvested 42 days after sprouting. At this point, only theansgenic Aifalfa line displayed dowers, as the wild type plants only displayed mature flower buds. The plants were characterized as to flowering status and total omass. esults: he results are presented in Tabie X> The data shows that the transgenic Alfalfa ants grew faster, flowered sooner, and yielded on average about a 62% biomass crease relative to the control plants.
  • XAMPLE 14 GENERATION OF DOUBLE TRANSGENIC CANTALOUPE LANTS CARRYING ARABiDOPSIS GS1 AND GPT TRANSGENES:
  • Cantaloupe plants (C ⁇ cumis melo var common) were transformed th the Arabidopsis GPT till length coding sequence of SEQ IO NO: 1 under the ntrol of the CMV 35S promoter within the expression vector pMON316 ⁇ see xample 3, supra), and the Arabidopsis GS1 coding sequence of SEQ ID NO: 6 nder the control of the RuBIsCo promoter within the expression vector pCambia 201 (vector construct of SEQ ID NO: 6), using Agrobacterium-mediated transfer via ection Into developing melons.
  • Agrobacterlum vectors and mixtures were prepared r tntra-meion inoculations as described in Example 3, supra, inoculations into eveloping melons were carried out essentially as described in Example 8.
  • the ants were characterized as to flowering status and total biomass relative to control elon plants grown under identical conditions. he results are presented in FIG. 16 &n ⁇ Table Xi. Referring to Table Xl, the ansgenic plants showed substantia! foliar piant biomass increases in comparison to e control plants, with an average increase in biomass of 63%. Moreover, a emendous increase in flower and flower bud yields was observed in ail five ansgenic lines. Control plants displayed no flowers and only 5 buds at sacrifice, on erage.
  • transgenic plants displayed between 2 and 5 flowers er plant, and between 21 and 30 flower buds, per piant, indicating a substantially gher growth rate and flower yield. Increased flower yield would be expected to anslate into correspondingly higher melon yields in the transgenic plants.
  • FIG. 16 a photograph comparing transgenic Cantaloupe plants to control antaloupe plants
  • the transgenic Cantaloupe plants show dramaticaiiy increased eight, overall biomass and flowering status relative to the control plants.
  • XAMPLE 15 GENERATION OF DOUBLE TRANSGENIC PUMPKIN PLANTS ARRYING ARABIOOPSiS GS1 AND GPT TRANSGENES:
  • FIG. 17 a photograph comparing transgenic pumpkin plants to control ants
  • the transgenic pumpkin plants show substantially increased plant size, erall biomass and leaf sizes and numbers relative to the control plants.
  • XAMPLE 16 GENERATION OF DOUBLE TRANSGENIC ARABIDOPSIS LANTS CARRYING ARABIDOPSIS GS1 AND GPT TRANSGENES: this example, Arabidopsis thatiana plants were transformed with the truncated abidopsis GPT coding sequence of SEQ ID NO: 18 under the control of the CMV5S promoter within the expression vector pMON316 (see Example 3, supra), andansgenic plants thereafter transformed with the Arabidopsis GS1 coding sequence SEQ ID NO: 6 under the control of the RuBisCo promoter within the expression ctor pCambia 1201 (vector construct of SEQ ID NO: 6), using Agrobacteri ⁇ m- ediated "floral dip" transfer as described (Harrison et al., 2006, Plant Methods
  • Agrobacterium vectors pMON316 rrying GPT and pCambia 1201 carrying GS1 were prepared as described inxamples 3 and 11. respectively.
  • Ansformation of two different cultures of Agrobacterium with either a pMon 316 + abidopsis GTP construct or with a Cambia 1201 + Arabidopsis GS construct wasone by electroporation using the method of Weigel and Glazebrook 2002. Theansformed Agrobacterium were then grown under antibiotic selection, collected by ntrifugation resuspended in LB broth with antibiotic and used in the floral dip of abidopsis inflorescence. Floral dipped Arabidopsis plants were taken to maturitynd self-fertilized and seeds were collected.
  • Seeds from twice dipped plants were st geminated on a media containing 20ug/mi of kanamycin and by following regular lection procedures surviving seedlings were transferred to media containing 20 ug hygromycin. Plants (3) surviving the selection process on both antibiotics were lf-fertilized and seeds were collected. Seeds from the T1 generation wereerminated on MS media containing 20 ug/mi of hygromycin and surviving seedlingsere taken to maturity, self-fertilized and seeds collected. This seed population the2 generation was then used for subsequent growth studies. he results are presented in FlG. 18 and Table XlIi.
  • XAMPLE 17 GENERATION OF TRANSGENIC TOMATO PLANTS CARRYINGRABIDOPSIS GPT AND GS1 TRANSG EN ES:
  • tomato plants (Solarium tycopersicon, "money Maker” variety) wereansformed with the Arabidopsis GPT full length coding sequence of SEQ ID NO: 1nder the control of the CMV 35S promoter within the expression vector pMON316 ee Example 3, supra), and the Arabidopsis GS1 coding sequence of SEQ ID NO: 6nder the control of the RuBisCo promoter within the expression vector pCambla201 (vector construct of SEQ ID NO: 6).
  • o ⁇ bie-transgene tomato plants showed substantial foliar plant biomass increases in mparison to the control plants, with an increase in average biomass yield of 45% er control. Moreover, as much as a 70% increase in tomato fruit yield was bserved in the transgenic lines compared to control plants (e.g., 51 tomatoes arvested from Line 4C 1 versus and average of approximately 30 tomatoes from ntrol plants). A much higher level of GPT activity was observed in the transgenic ants (e.g., line 4C displaying an approximately 32-fold higher GPT activity in mparison to the average GPT activity measured in control plants), GS activity was so higher in the transgenic plants relative to control plants (almost double in Line C).
  • the transgenic tomato ants displayed substantially larger leaves compared to control plants (FIG 19A).
  • the transgenic tomato plants were substantially larger, ler and of a greater overall biomass (see FiG. 19B).
  • Cameli ⁇ a plants ⁇ Camelina sativa, Var MT 303) were transformed th the Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the ntrol of the RuBisCo promoter within the expression vector pCambia 1201, and the abidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuBisCo omoter within the expression vector pCambia 1201 , using Agrobacterium-mediated ansfer into germinating seeds according to the method described in Chee et a!., 989, Plant Physiol. 91: 1212-1218.
  • Agrobacteri ⁇ m vectors and mixtures were epared for seed inoculations as described in Example 11 , supra.
  • ansgenic and control Camelina plants were grown under identical conditions (30 ays in a growth chamber and then moved to greenhouse cultivation) for 39 days, nd characterized as to biomass, growth characteristics and flowering stage. he results are presented in Table XX and FIG. 20. Referring to Table XX, it can be en that total biomass in the transgenic plants was, on average, almost double ntrol plant biomass. Canopy diameter was also significantly improved in the ansgenic plants.
  • FiG. 20 shows a photograph of transgenic Camelina compared to ntrol. The transgenic plant is noticeably larger and displays more advanced wering status.
  • the putative coding sequence for Barley GPT was isolated and pressed from a transgene construct using an in planta transient expression assay. ologically active recombinant Barley GPT was produced, and catalyzed thecreased synthesis of 2- oxogl ⁇ taramate, as confirmed by HPLC. he Bariey (Hord ⁇ um vulgare) GPT coding sequence was determined and nthesized.
  • the DNA sequence of the Barley GPT coding sequence used in this ample is provided in SEQ ID NO: 14, and the encoded GPT protein amino acid quence is presented in SEQ ID NO: 15.
  • he coding sequence for Barley GPT was inserted into the 1305.1 cambia vector,nd transferred to Agrobacteri ⁇ m tumefacmns strain LBA404 using a standardectroporation method (McCormac et at., 1998, Molecular Biotechnology 9:155-159), lowed by plating on LB plates containing hygromycin (50 micro gm / ml). Antibiotic sistant colonies of Agrobacterium were selected for analysis.
  • he transient tobacco leaf expression assay consisted of injecting a suspension ofansformed Agrobacterium (1.5-2.0 OD 650) into rapidly growing tobacco leaves.
  • XAMPLE 20 ISOtATiON AND EXPRESSION OF RECOMBINANT RICE GPTENE CODING SEQUENCE AND ANALYSIS OF BIOLOGICAL ACTIVITY
  • the putative coding sequence for rice GPT was isolated and pressed in E. coli.
  • Biologically active recombinant rice GPT was produced, and talyzed the increased synthesis of 2- oxogiutaramate, as confirmed by HPLC.
  • aterials and Methods ce GPT coding sequence and expression in E. colt he rice ⁇ Oryza sativia) GPT coding sequence was determined and synthesized,serted into a PET28 vector, and expressed in E. coli. Briefly, E.
  • coli ceils wereansformed with the expression vector and transformants grown overnight in LB oth diluted and grown to OD 0.4, expression induced with isopropyl-B-D- ogalactoside (0.4 micromoiar), grown for 3 hr and harvested. A total of 25 X 106 lls were then assayed for biological activity using the NMR assay, below.n transformed, wild type E. coli ceils were assayed as a control. An additional ntrol used E coli ceils transformed with an empty vector.
  • he DNA sequence of the rice GPT coding sequence used in this example is ovided in SEQ ID NO: 10, and the encoded GPT protein amino acid sequence is esented in SEQ ID NO: 11.
  • PLC Assay for 2-oxoQlutaramate PLC was used to determine 2-oxoglutaramate production in GPT-overexpressing E li cells, following a modification of CaWeron et ai., 1985, J Bacteriol 161(2): 807-09. Briefly, a modified extraction buffer consisting of 25 mM Tris-HCi pH 8.5, 1 mMDTA, 20 ⁇ M Pyridoxal phosphate, 10 mM Cysteine, and -1.5% (v/v) ercaptoethanoi was used. Samples (iysate from E.
  • the validation of the HPLC assay atso included monitoring e disappearance of the substrate giutamine and showing that there was a 1 :1 molaroechiometry between giutamine consumed to 2-oxoglutaramte produced.
  • the say procedure always included two controls, one without the enzyme added andne without the giutamine added. The first shows that the production of the 2- oglutaramate was dependent upon having the enzyme present, and the second ows that the production of the 2-oxogiutaramate was dependent upon the bstrate giutamine.
  • esults xpression of the rice GPT coding sequence of SEQ ID NO: 10 resulted in the over- pression of recombinant GPT protein having 2-oxoglutaramate synthesis- taiyzing bioactivity> Specifically, 1.72 rta ⁇ omoies of 2-oxoglutaramate activity wasbserved in the £. coli cells overexpressing the recombinant rice GPT, compared tonly 0.02 nanomoles of 2-oxogiutaramate activity in control E. cod cells, an 86-foid tivity level increase over control.
  • XAMPLE 21 ISOtATiON AND EXPRESSION OF RECOMBINANT SOYBEANPT GENE CODING SEQUENCE AND ANALYSIS OF BIOLOGICAL ACTIVITY
  • the putative coding sequence for soybean GPT was isolated and pressed in E. colL Biologically active recombinant soybean GPT was produced,nd catalyzed the increased synthesis of 2- oxoglutaramate, as confirmed by HPLC.
  • aterials and Methods oybean GPT coding sequence and expression in E. coli: he soybean (Glycine max) GPT coding sequence was determined and synthesized,serted into a PET28 vector, and expressed in E. coti. Briefly, E.
  • coli cells wereansformed with the expression vector and transformants grown overnight in LB oth diluted and grown to OD 0.4, expression induced with isopropyl-B-D- ogalactoside (0.4 micromolar), grown for 3 hr and harvested. A totai of 25 X 106 lls were then assayed for biological activity using the NMR assay, below.ntransformed, wild type E. coli cells were assayed as a control. An additional ntrol used E coll cells transformed with an empty vector.
  • he DNA sequence of the soybean GPT coding sequence used in this example is ovided in SEQ ID NO: 12, and the encoded GPT protein amino acid sequence is esented in SEQ ID NO: 13.
  • PLC Assay for 2-oxo ⁇ lutaramate PLC was used to determine 2-oxoglutaramate production in GPT-overexpressing E. // cells, as described in Example 20, s ⁇ pra. esults: xpression of the soybean GPT coding sequence of SEQ ID NO: 12 resulted in the er-expression of recombinant GPT protein having 2-oxoglutaramate synthesis- talyzing bioactivity. Specifically, 31.9 nanomoies of 2-oxoglutaramate activity wasbserved in the E coii DCis overexpressing the recombinant soybean GPT, mpared to only 0.02 nanomoies of 2-oxoglutaramate activity in control £. coii cells, neatly 1, 600-fold activity level increase over control.
  • XAMPLE 22 ISOLATION AND EXPRESSION OF RECOMBINANT ZEBRA FISHPT GENE CODING SEQUENCE AND ANALYSIS OF BIOLOGICAL ACTIVITY
  • the putative coding sequence for Zebra fish GPT was isolated and pressed in E. colt.
  • Biologically active recombinant Zebra fish GPT was produced,nd catalyzed the increased synthesis of 2- oxoglutaramate, as confirmed by NMR.
  • aterials and Methods ebra fish GPT coding sequence and expression in £. colt he Zebra fish (Danio rerh) GPT coding sequence was determined and synthesized,serted into a PET28 vector, and expressed in E. coli. Briefly, E.
  • coii celis wereansformed with the expression vector and transformants grown overnight in LB oth diluted and grown to OD 0.4, expression induced with isopropyl-B-D- ogalactoside (0.4 micromoiar), grown for 3 hr and harvested.
  • a totai of 25 X 106 iis were then assayed for biological activity using the NMR assay, below.ntransformed, wild type E coii ceils were assayed as a control.
  • he DNA sequence of the Zebra fish GPT coding sequence used in this example is ovided in SEQ ID NO: 16, and the encoded GPT protein amino acid sequence is esented in SEQ ID NO: 17.
  • PLC Assay for 2-oxoqlutaramate PLC was used to determine 2-oxoglutaramate production in GPT-overexpressing E. // cells, as described in Example 20, supra.
  • esults xpression of the Zebra fish GPT coding sequence of SEQ IO NO: 16 resulted in the er-expression of recombinant GPT protein having 2-oxoglutaramate synthesis- talyzing bioactivity.
  • 28.6 nanomoies of 2-oxoglutaramate activity wasbserved in the E.
  • coli cells overexpressing the recombinant Zebra fish QPT mpared to only 0.02 nanomoies of 2-oxoglutaramate activity in control E coli celts, more than 1,400-foid activity level increase over control.
  • XAMPLE 23 GENERATION AND EXPRESSION OF RECOMBINANT RUNCATED ARABIDOPStS GPT GENE CODING SEQUENCES AND ANALYSISF BIOLOGICAL ACTIVITY this example, two different truncations of the Arabidopsis GPT coding sequenceere designed and expressed in E.
  • coli he DNA coding sequence of a truncation of the Arabidopsis thaliana GPT coding quence of SEQ ID NO: 1 was designed, synthesized, inserted into a PET28 vector, nd expressed in E. cofi.
  • the DNA sequence of the truncated Arabidopsis GPT ding sequence used in this example is provided in SEQ ID NO: 20 (-45 AA nstruct), and the corresponding truncated GPT protein amino acid sequence is ovided in SEQ ID NO: 21.
  • coli DC coli
  • coli were transformed with the pression vector and transformants grown overnight in LB broth diluted and grown OD 0.4, expression induced with isopropyi-B-D-thiogatactoside (0.4 micromolar), own for 3 hr and harvested. A total of 25 X 10 6 cells were then assayed forological activity using HPLC as described in Example 20. Untransfbrmed, wild type coli DCis were assayed as a control. An additional control used E coli ceilsansformed with an empty vector.
  • the full length Arabidopsis gene coding sequence expressed in the me E coli assay generated 2.8 nanomoles of 2-oxoglutaramate activity, or roughlyss than one-fifth the activity observed from the truncated recombinant GPT protein.
  • seeds form the double transgene tobacco line XX-3 (Cross 3 inable 4, see Example 7) were tested in a seed germination assay designed to coe tolerance to high salt concentrations.
  • aterials and Methods obacco seeds from the wild type and XX-3 populations were surfaced sterilized (5% each solution for 5 minutes followed by a 10% ethanol wash for 3 minutes) and nsed with sterile distvetted water. The surface sterilized seeds were then spread on urashige and Skoog media (10% agarose) without sucrose and containing either 0 200 mM NaCl. The seeds were allowed to germinate in darkness for 2 days lowed by 6 days under a 16:8 photoperiod at 24C.
  • the rate of ermination was determined by measuring the percentage of seeds from the control transgene plants that had germinated. esults: he results are tabulated in Table XXI below, The rate of germination of the ansgenic plant line seeds under zero salt conditions was the same as observed with ld type control plant seeds, in stark contrast, the germination rate of the transgenic ant line seeds under very high salt conditions far exceeded the rate seen in wild pe control seeds. Whereas over 81% of the transgenic plant seeds had germinated nder the high salt conditions, only about 9% of the wild type control plant seeds had erminated by the same time point. These data indicate that the transgenic seeds e capable of germinating very well under high salt concentrations, an important trait r plant growth in areas of increasingly high water and/or soil salinity.
  • Vector sequences are italicized TGCATCATCACCATCACCATGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCA TTCTACGGAAAACCTGTA TTTTCAGGGAATTGATCCCTTCACCGCGAAACGLTGGAAAAATTTCAGACCACCATTTTTACCCAGATGAGCCTGCTGGCGATTAAACTGGCGCGATTAACCTGGGCCAGGGCTTTCCGAACTTTGATGGCCCGGAATTTTGAAAGAAGCGGCGATTCAGGCGATTCGTGATGGCAAAAACCAGTATGCGCGGGCTATGGCGTGCCGGATCTGAACATTGCGATTGCGGAACGTTTTAAAAAAGAACCGGCCTGGTGGTGGATCCGGAAAAAGAAATTACCGTGACCAGCGGCTGCACGAAGCGATTGCGGCGACCATGATTGGCCTGATTAACCCGGGCGATGAAGTGTTATGTTTGCGCCGTTTTATGATAGCTATGAAGCGACCCTGAGCATGGCGGGCCGAAAGTGAAAGGCATTACCCTCCTCGGTCTC
  • intron with rice GPT gene ambial 305.1 with (3 1 end of) rbcS3C+rice GPT.
  • Underlined ATG Is start site,arentheses are the catl intro ⁇ and the underlined actagt is the spei cloning site used splice in the rice gene.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Disclosed are transgenic plants exhibiting dramatically enhanced growth rates, greater seed and fruit/pod yields, earlier and more productive flowering, more efficient nitrogen utilization, increased tolerance to high salt conditions, and increased biomass yields Transgenic plants engineered to overexpress both glutamine phenylpyruvate transaminase (GPT), and glutamine synthetase (GS) are provided The GPT +GS double-transgenic plants consistently exhibit enhanced growth characteristics, with TO generation lines showing an increase in biomass over wild type counterparts of between 50% and 300% Generations that result from sexual crosses and/or selling typically perform even better, with some of the double-transgenic plants achieving an astounding four-fold biomass increase over wild type plants

Description

TRANSGENIC PLANTS WITH ENHANCED GROWTH CHARACTERISTICS
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSOREO RESEARCH OR DEVELOPMENT
This invention was made with government support under Contract No. W-7405- ENG-36 awarded by the United States Department of Energy to The Regents of The University of Caiifornia, and Contract No. DE-AC52-06NA25396, awarded by the United States Department of Energy to Los Alamos National Security, LLC. The government has certain rights in this invention.
RELATED APPLICATIONS
This application ciaims priority to United States Provisional Application No.
61/190.520 filed August 29.2008.
BACKGROUND OF THE INVENTION
As the human population increases worldwide, and available farmland continues to be destroyed or otherwise compromised, the need for more effective and sustainable agriculture systems is of paramount interest to the human race. improving crop yields, protein content, and plant growth rates represent major objectives in the development of agriculture systems that can more effectively respond to the challenges presented.
in recent years, the importance of improved crop production technologies has only increased as yields for many well-developed crops have tended to plateau. Many agricultural activities are time sensitive, with costs and returns being dependent upon rapid turnover of crops or upon time to market. Therefore, rapid plant growth is an economically important goaf for many agricultural businesses that involve high-value crops such as grains, vegetables, berries and other fruits.
Genetic engineering has and continues to play an increasingly important yet controversial role in the development of sustainable agriculture technologies. A large number of genetically modified piants and related technologies have been developed in recent years, many of which are in widespread use today (Factsheet: Genetically Modified Crops in the United States, Pew Initiative on Food and Biotechnology, August 2004, {pewagbtotech.org/resources/factsheets). The adoption of transgenic plant varieties is now very substantial and is on the rise, with approximately 250 million acres planted with transgenic plants in 2006.
While acceptance of transgenic plant technologies may be gradually increasing, particularly in the United States, Canada and Australia, many regions of the World remain slow to adopt genetically modified plants in agriculture, notably Europe. Therefore, consonant with pursuing the objectives of responsible and sustainable agriculture, there is a strong interest in the development of genetically engineered plants that do not introduce toxins or other potentially problematic substances into plants and/or the environment. There is also a strong interest in minimizing the cost of achieving objectives such as improving herbicide tolerance, pest and disease resistance, and overall crop yields. Accordingly, there remains a need for transgenic plants that can meet these objectives.
The goal of rapid piant growth has been pursued through numerous studies of various plant regulatory systems, many of which remain incompletely understood, in particular, the plant regulatory mechanisms that coordinate carbon and nitrogen metabolism are not fully elucidated. These regulatory mechanisms are presumed to have a fundamental impact on plant growth and development.
The metabolism of carbon and nitrogen in photosynthetic organisms must be regulated in a coordinated manner to assure efficient use of plant resources and energy. Current understanding of carbon and nitrogen metabolism includes details of certain steps and metabolic pathways which are subsystems of larger systems, in photosynthetic organisms, carbon metabolism begins with CO2 fixation, which proceeds via two major processes, termed C-3 and C-4 metabolism. In plants with C-3 metabolism, the enzyme ribulose bisphosphate carboxylase (RuBisCo) catalyzes the combination of CO2 with ribulose bisphosphate to produce 3- phosphogiycerate, a three carbon compound (C-3) that the plant uses to synthesize carbon-containing compounds. In plants with C-4 metabolism, CO2 is combined with phosphoenoi pyruvate to form acids containing four carbons (C-4), in a reaction catalyzed by the enzyme phosphoeno! pyruvate carboxylase. The acids are transferred to bundle sheath ceils, where they are decarboxylated to release CO2, which is then combined with ribυiose bisphosphate in the same reaction employed by C-3 piants.
Numerous studies have found that various metabolites are important in plant regulation of nitrogen metabolism. These compounds include the organic acid malate and the amino acids glutamate and glutamine. Nitrogen is assimilated by photosγnthetic organisms via the action of the enzyme glutamine synthetase (GS) which catalyzes the combination of ammonia with glutamate to form glutamine. GS plays a key role in the assimilation of nitrogen in plants by catalyzing the addition of ammonium to glutamate to form glutamine in an ATP-dependent reaction (Miflin and Habash, 2002, Journal of Experimental Botany, Vol. 53, No. 370, pp. 979-987), GS also reassimilates ammonia released as a result of photorespiration and the breakdown of proteins and nitrogen transport compounds. GS enzymes may be divided into two general classes, one representing the cytoplasmic form (GS1) and the other representing the piastidic (i.e., chloroplastic) form (GS2).
Previous work has demonstrated that increased expression levels of GS1 result in increased levels of GS activity and plant growth, although reports are inconsistent. For example. Fuentes et al. reported that CaMV S35 promoter driven overexpression of Alfalfa GS1 (cytoplasmic form) in tobacco resulted in increased levels of GS expression and GS activity in leaf tissue, increased growth under nitrogen starvation, but no effect on growth under optima) nitrogen fertilization conditions (Fuentes et al., 2001, J. Exp. Botany 52: 1071-81). Temple et al. reported that transgenic tobacco piants overexpressing the full length Alfalfa GS1 coding sequence contained greatly elevated levels of GS transcript, and GS polypeptide which assembled into active enzyme, but did not report phenotypic effects on growth (Temple et al., 1993, Molecular and General Genetics 236: 315- 325). Corruzi et al. have reported that transgenic tobacco overexpressing a pea cytosolic GS1 transgene under the control of the CaMV S35 promoter show increased GS activity, increased cytosolic GS protein, and improved growth characteristics (U.S. Patent No. 6,107,547). Unkefer et al. have more recently reported that transgenic tobacco plants overexpressing the Alfalfa GS1 in foliar tissues, which had been screened for increased leaf-to-root GS activity following genetic segregation by selfing to achieve increased GS1 transgene copy number, were found to produce increased 2-hydroxy-5-oxoproline levels in their foliar portions, which was found to lead to markedly increased growth rates over wildtype tobacco plants (see, U.S. Patent Nos. 6,555,500; 6,593,275; and 6,831,040).
Unkefer et al. have further described the use of 2-hydroxy-5-oxoproline (also known as 2-oxoglutaramate) to improve plant growth (U.S. Patent Nos. 6,555,500; 6,593,275; 6,831.040). In particular, Unkefer et al. disclose that increased concentrations of 2-hydroxy-5-oxoproiine in foliar tissues (relative to root tissues) triggers a cascade of events that result in increased plant growth characteristics. Unkefer et al. describe methods by which the foliar concentration of 2-hydroxy-5- oxoproline may be increased in order to trigger increased plant growth characteristics, specifically, by applying a solution of 2-hydroxy-5-oxoproltne directly to the foliar portions of the plant and over-expressing glutamine synthetase preferentially in leaf tissues.
A number of transaminase and hydrolyase enzymes known to be involved in the synthesis of 2-hydroxy-5-oxoproline in animals have been identified in animal liver and kidney tissues (Cooper and Meister, 1977, CRC Critical Reviews in Biochemistry, pages 281-303; Meister, 1952, J. Biochem. 197: 304). In plants, the biochemical synthesis of 2-hydroxy-5-oxoproline has been known but has been poorly characterized. Moreover, the function of 2-hydroxy-5-oxoproline in plants and the significance of its pool size (tissue concentration) are unknown. Finaily, the art provides no specific guidance as to precisely what transaminase(s) or hydrolase(s) may exist and/or be active in catalyzing the synthesis of 2- hydroxy-5-oxoproiine in plants, and no such plant transaminases have been reported, isolated or characterized. SUMMARY OF THE INVENTION
The invention relates to transgenic plants exhibiting dramatically enhanced growth rates, greater seed and fruit/pod yields, earlier and more productive flowering, more efficient nitrogen utilization, increased tolerance to high salt conditions, and increased biomass yields, in one embodiment, transgenic plants engineered to over-express both glυtamine phenylpyruvate transaminase (GPT) and giutamine synthetase (GS) are provided. The GPT+GS double-transgenic plants of the invention consistently exhibit enhanced growth characteristics, with T0 generation lines showing an increase in biomass over wild type counterparts of between 50% and 300%. Generations that result from sexual crosses and/or seifing typically perform even better, with some of the double-transgenic plants achieving an astounding four-fold biomass increase over wild type plants. Similarly, flower and fruit or pod yields are also tremendously improved, with T0 generation lines typically showing 50% to 70% increases over their wild type counterparts, and in some cases showing a 100% increase. Transgenic plants exhibiting such enhanced growth phenotyptc characteristics have been successfully generated across a spectrum of individual plant species, using various transformation methodologies, different expression vectors and promoters, and heterologous and homologous transgene sequences from a variety of species, as exemplified by the numerous working examples provided herein. This invention, therefore, provides a fundamental break-though technology that has the potential to transform virtually ail areas of agriculture.
Applicants have identified the enzyme giutamine phenylpyruvate transaminase (GPT) as a catalyst of 2-hydroxy-5-oxoproline (2-oxoglutaramate) synthesis in plants. 2-oxogiutaramate is a powerful signal metabolite which regulates the function of a large number of genes involved in the photosynthesis apparatus, carbon fixation and nitrogen metabolism. The invention provides isolated nucleic acid molecules encoding GPT, and discloses the novel finding that the encoded enzyme is directly involved in the synthesis of 2-hydroxy-5-oxoproline. This aspect of the invention is exemplified herein by the disclosure of GPT polynucleotides encoding GPTs from several species, including Arabidopsis. Grape, Rice, Soybean, Barley, Bamboo and a non-plant homolog from Zebra fish, most of which have been expressed as recombinant GPTs and confirmed as having GPT activity.
The invention further provides transgenic plants which express both a GPT transgene and a GS transgβne. The expression of these two transgenes in such "double-transgene" plants results in a substantially increased rate of carbon dioxide fixation and an extremely potent growth enhancing effect, as these plants exhibit very significantly and sometimes tremendously enhanced growth rates and flower/fruit/pod/seed yields. Methods for the generation of such growth-enhanced transgenic plants are provided.
By preferentially increasing the concentration of the signal metabolite 2- oxoglutaramate (i.e., in foliar tissues), the transgenic plants of the invention are capable of producing higher overall yields over shorter periods of time, and therefore may provide agricultural industries with enhanced productivity across a wide range of crops. Importantly, unlike many transgenic plants described to date, the invention utilizes natural plant genes encoding a natural plant enzyme. The enhanced growth characteristics of the transgenic plants of the invention is achieved essentially by introducing additional GPT and GS capacity into the plant. Thus, the transgenic plants of the invention do not express any toxic substances, growth hormones, viral or bacterial gene products, and are therefore free of many of the concerns that have heretofore impeded the adoption of transgenic plants in certain parts of the World.
in one embodiment, the invention provides a transgenic plant comprising a GPT transgene and a GS transgene, wherein said GPT transgene and said GS transgene are operably linked to a plant promoter. In a specific embodiment, the GS transgene is a GS1 transgene. In another specific embodiment, the GPT transgene encodes a polypeptide having an amino acid sequence selected from the group consisting of (a) SEQ ID NO: 2; SEQ ID NO: 9; SEQ ID NO: 15. SEQ IO NO: 19, SEQ ID NO: 21. SEQ ID NO 24, SEQ ID NO: 30, SEQ ID NO:31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34. SEQ ID NO: 35 and SEQ ID NO: 36. and (b) an amino acid sequence thai is at least 75% identical to any one of SEQ IO NO: 2; SEQ ID NO: 9; SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO 24, SEQ ID NO: 30, SEQ ID NO: 31. SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36 and has GPT activity. In yet another specific embodiment, the GS transgene encodes a polypeptide having an amino acid sequence selected form the group consisting of (a) SEQ ID NO: 4 and SEQ ID NO: 7 from residue 11, and (b) an amino acid sequence that is at least 75% identical to SEQ ID NO: 4 or SEQ ID NO: 7. In some embodiments, the GPT and GS transgenes are incorporated into the genome of the plant. The transgenic plant of the invention may be a monocotyledonous or a dicotyledonous plant.
The invention also provides progeny of any generation of the transgenic plants of the invention, wherein said progeny comprises a GPT transgene and a GS transgene, as well as a seed of any generation of the transgenic plants of the invention, wherein said seed comprises said GPT transgene and said GS transgene. The transgenic plants of the invention may display one or more enhanced growth characteristics rate when compared to an analogous wild-type or uniransformed plant, including without limitation increased growth rate, biomass yield, seed yield, flower or flower bud yield, fruit or pod yield, larger leaves, and may also display increased levels of GPT and/or GS activity, and/or increased levels of 2-oxogiutaramate, In some embodiments, the transgenic plants of the invention display increased nitrogen use efficiency or increased tolerance to salt or saline conditions.
Methods for producing the transgenic plants of the invention and seeds thereof are also provided, including methods for producing a plant having enhanced growth properties, increased nitrogen use efficiency and increased tolerance to germination or growth in salt or saline conditions, relative to an analogous wild type or untraπsformed plant. BRIEF DESCRIPTION OF THE DRAWINGS
The patent or application fife contains at least one drawing executed m color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary lee.
FIG. 1, Nitrogen assimilation and 2-oxogiυtaramate biosynthesis: schematic of metabolic pathway.
FIG. 2. Photograph showing comparison of transgenic tobacco piants over- expressing either GS1 or GPT, compared to wild type tobacco plant. From left to right: wild type plant, Alfalfa GS1 transgene, Arabidopsis GPT traπsgene. See Examples 3 and 5, infra.
FIG. 3. Photograph showing comparison of transgenic Micro-Tom tomato plants over-expressing either GS1 or GPT, compared to wild type tomato plant. From left to right: wild type plant, Alfalfa GS1 transgene, Arabidopsis GPT transgene. See Examples 4 and 6, infra.
FIG. 4. Photographs showing comparisons of leaf sizes between wiid type and GS1 or GPT transgenic tobacco piants. A: Comparison between leaves from GS1 transgenic tobacco (bottom leaf) and wild type (top leaf). B: Comparison between leaves from GPT transgenic tobacco (bottom leaf) and wild type (top leaf).
FIG. 5. Photographs showing comparisons of transgenic tobacco piants generated from various crosses between GS1 and GPT transgenic tobacco iines with wild type and single transgene plants. A-C: Cross 2, 3 and 7, respectively. See Example 7, infra.
FIG. 6. Photographs showing comparisons of leaf sizes between wild type and crosses between GS1 and GPT transgenic tobacco piants. A: Comparison between leaves from GSXGPT Cross 3 (bottom leaf) and wiid type (top leaf). B: Comparison between leaves from GSXGPT Cross 7 (bottom leaf) and wiid type (top leaf). See Example 7, infra. FIG. 7. Photograph of transgenic pepper plant (right) and wild type control pepper plant (left), showing larger pepper fruit yield in the transgenic plant relative to the wild type control plant. See Example 8, infra.
FIG. 8. Transgenic bean plants compared to wild type control bean plants (several transgenic lines expressing Arabidopsis GPT and GS transgenes). Upper Left: plant heights on various days; Upper right: flower bud numbers; Lower left: flower numbers; Lower right: bean pod numbers. Wildtype is the control, and lines 2A14A and 58 are all transgenic plant lines. See Example 9, infra.
FIG. 9. Photograph of transgenic bean plant (right) and wild type control bean plant (left), showing increased growth in the transgenic plant relative to the wild type control plant. Transgenic line expressing Arabidopsis GPT and GS transgenes. See Example 9, infra.
FIG. 10. Transgenic bean plants pods, flowers and flower buds compared to wild type control bean plants (transgenic line expressing grape GPT and Arabidopsis GS transgenes). See Example 10, infra.
FIG. 11. Photograph of transgenic bean plant (right) and wild type control bean plant (left), showing increased growth in the transgenic plant relative to the wild type control plant Transgenic line expressing Grape GPT and Arabidopsis GS transgenes. See Example 10, infra.
FIG. 12. Transgenic Cowpea Line A plants compared to wild type control Cowpea plants (transgenic line expressing Arabidopsis GPT and GS transgenes), showing that the transgenic plants grow faster and flower and set pods sooner than wild type control plants. (A) Relative height and longest leaf measurements as of May 21, (B) Relative trifolate leafs and flower buds as of June 18, (C) Relative numbers of flowers, flower buds and pea pods as of June 22. See Example 11, infra. FIG. 13. Photograph of transgenic Cowpea Line A plant (right) and wild type control Cowpea plant (left), showing increased growth in the transgenic plant relative to the wiid type control plant. Transgenic line expressing Arabidopsis GPT and GS transgenes. See Example 11, infra.
FIG. 14. Transgenic Cowpea Line G plants compared to wild type control Cowpea plants (transgenic line expressing Grape GPT and Arabidopsis GS transgenes), showing that the transgenic plants grow faster and flower and set pods sooner than wild type control plants. (A) plant heights, (B) flowers and pea pod numbers, (C) leaf bud and trifolate numbers. See Example 12, infra.
FIG. 15. Photograph of transgenic Cowpea Line G plant (right) and wiid type control Cowpea plant (left), showing increased growth in the transgenic plant relative to the wild type control plant. Transgenic line expressing Grape GPT and Arabidopsis GS transgenes. See Example 12, infra.
FIG. 16. Photograph of transgenic Cantaloupe plant (right) and wild type controi Cantaloupe plant (left), showing increased growth in the transgenic plant relative to the wiid type controi plant. Transgenic line expressing Arabidopsts GPT and GS transgenes. See Example 14, infra.
FIG. 17. Photograph of transgenic Pumpkin plants (right) and wild type control Pumpkin plants (left), showing increased growth in the transgenic plants relative to the wild type control plants. Transgenic lines expressing Arabidopsis GPT and GS transgenes. See Example 15, infra.
FIG. 18. Photograph of transgenic Arabidopsts plants (right) and wild type control Arabidopsis plants (left), showing increased growth in the transgenic plants relative to the wild type control plants. Transgenic lines expressing Arabidopsis GPT and GS transgenes. See Example 16, infra.
FIG. 19. Transgenic tomato plants expressing Arabidopsis GPT and GS transgenes compared to control tomato plants. (A) Photograph of transgenic tomato plant leaves (right) vs. wild type control leaves (left) showing larger leaves in the transgenic plant (B) Photograph of transgenic tomato plants (right) and wild type control plants (left), showing increased growth in the transgenic plants relative to the wild type control piants. See Example 17, infra.
FIG. 20. Photograph of transgenic Camelina plant (right) and wild type control Camelina plant (left), showing increased growth in the transgenic plant relative to the wild type control plant. Transgenic line expressing Arabidopsis GPT and GS transgenes. See Example 18, infra.
DETAILED DESCRIPTION OF THE INVENTION
DEFINITIONS Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodology by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et a!.. Molecular Cloning: A Laboratory Manual 3rd. edition (2001) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology (Aυsbel et al., eds., John Wiley & Sons, Inc. 2001; Transgenic Plants: Methods and Protocols (Leandro Pena, ed., Humana Press, 1st edition, 2004); and, Agrobacterium Protocols (Wan, ed., Humana Press, 2nd edition, 2006). As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.
The term "nucleic acid" refers to deoxyribonucleotides or ribonucleotides and polymers thereof ("polynucleotides") in either single- or double-stranded form. Unless specifically limited, the term "polynucleotide" encompasses nucleic adds containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof {e.g. degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (βatzer et at., 1991, Nucleic Acid Res. 19: 5081; Ohtsυka et al., 1985 J. Biol. Chem. 260: 2605-2608; and Cassol et a).. 1992; Rossolini et a!., 1994, MoI. Cell. Probes 8: 91-98). The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
The term "promoter" refers to an array of nucleic acid control sequences that direct transcription of an operably linked nucleic acid. As used herein, a "plant promoter" is a promoter that functions in plants. Promoters include necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase Il type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A "constitutive" promoter is a promoter that is active under most environmental and developmental conditions. An "inducible" promoter is a promoter that is active under environmental or developmental regulation. The term "operably linked" refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucieic acid corresponding to the second sequence.
The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and πon-πaturaliy occurring amino acid polymers.
The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline. γ-carboxygjutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have tie same basic chemical structure as a naturally occurring amino acid, i.e., an α carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyf suifonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-fetter codes.
The term "plant" includes whole plants, plant organs (e.g., leaves, stems, flowers, roots, etc.), seeds and plant cells and progeny thereof. The class of plants which can be used in the method of the invention is generally as broad as the class of higher plants amenable to transformation techniques, including angiosperms
(monocotyledonous and dicotyledonous plants), as well as gymnosperms. it includes plants of a variety of pioidy levels, including polyploid, diploid, haploid and hemizygous.
The terms "GPT polynucleotide" and "GPT nucleic acid" are used interchangeably herein, and refer to a full length or partial length polynucleotide sequence of a gene which encodes a polypeptide involved in catalyzing the synthesis of 2- oxoglutaramate, and includes polynucleotides containing both translated (coding) and un-transiated sequences, as well as the complements thereof. The term "GPT coding sequence" refers to the part of the gene which is transcribed and encodes a GPT protein. The term "targeting sequence" refers to the amino terminal part of a protein which directs the protein into a subcellular compartment of a cell, such as a chloropiast in a piant cell. GPT polynucleotides are further defined by their ability to hybridize under defined conditions to the GPT polynucleotides specifically disclosed herein, or to PCR products derived therefrom.
A "GPT transgene" is a nucleic acid molecule comprising a GPT polynucleotide which is exogenous to transgenic piant, or piant embryo, organ or seed, harboring the nucleic acid molecule, or which is exogenous to an ancestor piant, or piant embryo, organ or seed thereof, of a transgenic plant harboring the GPT polynucleotide.
The terms "GS polynucleotide" and "GS nucleic acid" are used interchangeably herein, and refer to a fuli length or partial length polynucleotide sequence of a gene which encodes a giutamine synthetase protein, and includes polynucleotides containing both translated (coding) and un-transiated sequences, as well as the complements thereof. The term "GS coding sequence* refers to the part of the gene which is transcribed and encodes a GS protein. The terms MGS1 polynucleotide" and "GS1 nucleic acid" are used interchangeably herein, and refer to a fuli length or partial length polynucleotide sequence of a gene which encodes a giutamine synthetase isoform 1 protein, and includes polynucleotides containing both translated (coding) and un-transiated sequences, as well as the complements thereof. The term "GS 1 coding sequence" refers to the part of the gene which is transcribed and encodes a GS1 protein.
A "GS transgene" is a nucleic acid molecule comprising a GS polynucleotide which is exogenous to transgenic piant, or plant embryo, organ or seed, harboring the nucleic acid molecule, or which is exogenous to an ancestor plant, or piant embryo, organ or seed thereof, of a transgenic plant harboring the GPT polynucleotide. A "GS1 transgene" is a nucleic acid molecule comprising a GS1 polynucleotide which is exogenous to transgenic plant, or plant embryo, organ or seed, harboring the nucleic acid molecule, or which is exogenous to an ancestor plant, or plant embryo, organ or seed thereof, of a transgenic plant harboring the GPT polynucleotide.
Exemplary GPT polynucleotides of the invention are presented herein, and include GPT coding sequences for Arabidopsis, Rice, Barley. Bamboo, Soybean, Grape, and Zebra Fish GPTs.
Partial length GPT polynucleotides include polynucleotide sequences encoding N- or C-terminai truncations of GPT, mature GPT (without targeting sequence) as well as sequences encoding domains of GPT. Exemplary GPT polynucleotides encoding N-terminal truncations of GPT include Arabidopsis -30, -45 and -56 constructs, in which coding sequences for the first 30, 45, and 56 respectively, amino acids of the full length GPT structure of SEQ ID NO: 2 are eliminated.
In employing the GPT polynucleotides of the invention in the generation of transformed ceils and transgenic plants, one of skill will recognize that the inserted polynucleotide sequence need not be identical, but may be only "substantially identical" to a sequence of the gene from which it was derived, as further defined below. The term "GPT polynucleotide" specifically encompasses such substantially identical variants. Similarly, one of skill will recognize that because of codon degeneracy, a number of polynucleotide sequences will encode the same polypeptide, and all such polynucleotide sequences are meant to be included in the term GPT polynucleotide, in addition, the term specifically includes those sequences substantially identical (determined as described below) with an GPT polynucleotide sequence disclosed herein and that encode polypeptides that are either mutants of wild type GPT polypeptides or retain the function of the GPT polypeptide (e.g., resulting from conservative substitutions of amino acids in a GPT polypeptide). The term "GPT polynucleotide" therefore also includes such substantially identical variants. The term "conservatively modified variants" applies to Ix)Ui amino acid and nucleic acid sequences. With respect to particular nucleic add sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic add, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in One substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are weii known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homoiogs, and alleles of the invention.
The following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K): 5) lsoleucine (I), Leucine (L), Methionine (M), Valine (V): 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g.. Creighton, Proteins (1984)).
Macromoiecυiar structures such as polypeptide structures can be described in terms of various levels of organization. For a general discussion of this organization, see, e.g., Alberts ef al., Molecular Biology of the Cell (3rd ed., 1994) and Cantor and Schimmel, Biophysical Chemistry Part f: The Conformation of Biological Macromolecυles (1980). "Primary structure" refers to the amino acid sequence of a particular peptide. "Secondary structure" refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains. Domains are portions of a polypeptide that form a compact unit of the polypeptide and are typically 25 to approximately 500 amino acids long. Typical domains are made up of sections of lesser organization such as stretches of β-sheet and «-helices. Tertiary structure" refers to the complete three dimensional structure of a polypeptide monomer. "Quaternary structure" refers to the three dimensional structure formed by the noncovalent association of independent tertiary units. Anisotropic terms are also known as energy terms.
The term "isolated" refers to material which is substantially or essentially free from components which normally accompany the material as it is found in its native or natural state. However, the term "isolated" is not intended refer to the components present in an eiectrophoretic gel or other separation medium. An isolated component is free from such separation media and in a form ready for use in another application or already in use in the new application/milieu. An "isolated" antibody is one that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceoυs or non-proteinaceous solutes. In preferred embodiments, the antibody will be purified (1 ) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain, isolated antibody includes the antibody in situ within recombinant ceils since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at feast one purification step.
The term "heterologous" when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not found in the same relationship to each other in nature. For instance, a nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a nucleic acid encoding a protein from one source and a nucleic acid encoding a peptide sequence from another source. Similarly, a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature {e.g., a fusion protein).
The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 70% identity, preferably 75%, 80%, 85%, 90%, or 95% identity over a specified region, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using a sequence comparison algorithms, or by manual alignment and visual inspection. This definition also refers to the complement of a test sequence, which has substantial sequence or subsequence complementarity when the test sequence has substantial identity to a reference sequence. This definition also refers to the complement of a test sequence, which has substantial sequence or subsequence complementarity when the test sequence has substantial identity to a reference sequence.
When percentage of sequence identity is used in reference to polypeptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions, where amino acids residues are substituted for other amino acid residues with similar chemical properties (e.g., charge or hydrophobicity) and therefore do not change the functional properties of the polypeptide. Where sequences differ in conservative substitutions, the percent sequence identity may be adjusted upwards to correct for the conservative nature of the substitution.
For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
A "comparison window", as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optima! alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981, Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. MoL Biol. 48:443, by the search for similarity method of Pearson & Lipman, 1988, Proc. Natl. Acad. ScL USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT. FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wl)1 or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et at., eds. 1995 supplement}). A preferred example of algorithm thai is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2,0 algorithms, which are described in Aitschut et a!., 1977, Nυc. Acids Res. 25:3389- 3402 and Aitschυl et al.. 1990, J. Mot. Biol. 215:403-410, respectively. BLAST and BLAST 2.0 are used, typically with the default parameters described herein, to determine percent sequence identity for the nucleic adds and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive- valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschυl et a/., supra). These initiai neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N {penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from Its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 11 , an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word length of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix {see Henikoff & Henikoff, Proc. Natl. Acad. ScL USA 89:10915 (1989)) alignments (B) of 50. expectation (E) of 10, M-5, N--4, and a comparison of both strands. The BLAST algorithm aiso performs a statistical analysis of the similarity between two sequences (see, e.g., Kariin & Altschυi, 1993, Proc. Nat'l. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001. The phrase "stringent hybridization conditions" refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acid, but to no other sequences. Stringent conditions are sequence- dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993). Generally, highly stringent conditions are selected to be about 5-10°C- lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH. Low stringency conditions are generally selected to be about 15-30°C. below the Tm. Tm is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium). Stringent conditions will be those in which the salt concentration is less than about 1.0M sodium ion, typically about 0.01 to 1.0M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides). Stringent conditions may aiso be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization. Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical. This occurs, for exampie, when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code, in such cased, the nucleic acids typically hybridize under moderately stringent hybridization conditions.
Genomic ONA or cDNA comprising GPT polynucleotides may be identified in standard Southern blots under stringent conditions using the GPT polynucleotide sequences disclosed here. For this purpose, suitable stringent conditions for such hybridizations are those which include a hybridization in a buffer of 40% formamide, 1M NaCl, 1% SDS at 37"C, and at least one wash in 0.2 X SSC at a temperature of at least about 50°C, usually about 55X to about 60*0, for 20 minutes, or equivalent conditions. A positive hybridization is at least twice background. Those of ordinary skill will readily recognize that alternative hybridization and wash conditions may be utilized to provide conditions of similar stringency.
A further indication that two polynucleotides are substantially identical is if the reference sequence, amplified by a pair of oligonucleotide primers, can then be used as a probe under stringent hybridization conditions to isolate the test sequence from a cDNA or genomic library, or to identify the test sequence in, e.g., a northern or Southern blot.
TRANSGENIC PLANTS:
The invention provides novel transgenic plants exhibiting substantially enhanced agronomic characteristics, including faster growth, greater mature plant fresh weight and total biomass, earlier and more abundant flowering, and greater fruit, pod and seed yields. The transgenic plants of the invention are generated by introducing into a plant one or more expressible genetic constructs capable of driving the expression of one or more polynucleotides encoding glutamine synthetase (GS) and glutamine phenylpyruvate transaminase (GPT). In an exemplary embodiment, single-transgene parental lines carrying either a GPT or GS1 transgeπe coding sequence are generated, preferably selfed until homozygous for the transgene, then crossed to generate progeny plants containing both transgβnes.
In stable transformation embodiments of the invention, one or more copies of the expressible genetic construct become integrated into Hie host plant genome, thereby providing increased GS and GPT enzyme capacity into the plant, which serves to mediate increased synthesis of 2-oxogiυtaramate, which in turn signals metabolic gene expression, resulting in increased plant growth and the enhancement other agronomic characteristics. 2-oxoglutaramate is a metabolite which is an extremely potent effector of gene expression, metabolism and plant growth (U.S. Patent No. 6,555,500), and which may play a pivotal roie in the coordination of the carbon and nitrogen metabolism systems (Lancien et al., 2000. Enzyme Redundancy and the Importance of 2-Oxoglutarate in Higher Plants Ammonium Assimilation, Plant Physiol. 123: 817-824). See, also, the schematic of the 2-oxogiutaramate pathway shown in FIG. 1.
in one aspect of the invention, applicants have isolated a nucleic acid molecule encoding the Arabidopsis giυtamine phenylpyruvate transaminase (GPT) enzyme (see Example 1 , infra), and have demonstrated for the first time that the expressed recombinant enzyme is active and capable of catalyzing the synthesis of the signal metabolite, 2-oxoglutaramate (Example 2, infra). Further, applicants have demonstrated for the first time that over-expression of tie Arabidopsis glutamine transaminase gene in a transformed heterologous plant results in enhanced CO2 fixation rates and increased growth characteristics (Example 3, infra).
Applicants' previous work demonstrated that over-expression of A/fa/fa GS1 gene under the control of a strong constitutive promoter results in transgenic tobacco plants with higher ieveis of GS activity in the leaves. These plants outgrow their wild-type counterparts, fix CO2 faster, contain increased concentrations of total protein, as well as increased concentrations of glutamine and 2-oxoglutaramate, and show increased rates of uptake of nitrate through their roots. As disclosed herein (see Example 3, infra), over-expression of a transgene comprising the full-length Arabidopsis GPT coding sequence in transgenic tobacco plants also results in faster CO2 fixation, and increased levels of total protein, glutamine and 2-oxoglυtaramate. These transgenic plants also grow faster than wild-type plants (FlG. 2). Similarly, in preliminary studies conducted with tomato plants (see Example 4, infra), tomato plants transformed with the
Arabidopsis GPT transgene showed significant enhancement of growth rate, flowering, and seed yield in relation to wild type control plants (FIG. 3 and Example 4, infra).
in one particular embodiment, exemplified herein by way of Examples 3, 5 and 7, infra, a first set of parentai singfe-transgene tobacco plant lines carrying the Alfalfa GS1 gene, including 5* and 3' untranslated regions, were generated using Agrobacterium mediated gene transformation, under selective pressure, together with screening for the fastest growing phenotype, and selflng to transgene/phenotype homozygosity (see Example 5, infra). A second set of parental single-transgene tobacco plant lines carrying the full length coding sequence of Arabidopsis GPT were generated in the same manner (Example 3, infra). High growth rate performing plants from each of the parental lines were then sexually crossed to yield progeny lines (Example 7, infra).
The resulting progeny from multiple crosses of Arabidopsis GS1 and GPT transgenic tobacco plants produce far better and quite surprising increases in growth rates over the single-transgene parental lines as well as wildtype plants. FIG. 5 shows photographs of double-transgene progeny from single-transgene GS1 X GPT plant crosses, relative to wild type and single-transgene parentai plants. FIG. 6 shows photographs comparing leaf sizes of double-transgene progeny and wild type plants. Experimentally observed growth rates in these double transgenic plants ranged between 200% and 300% over wild-type plants (Example 7, infra). Moreover, total biomass ieveis increased substantially in the double-transgene plants, with whole plant fresh weights typically being about two to three times the wild-type plant weights. Similarly, seed yields showed similar increases in the double-transgene plants, with seed pod production typically two to three times the wild type average, and overall seed yields exceeding wild-type plant yields by 300-400%.
In addition to the transgenic tobacco plants referenced above, various other species of transgenic plants comprising GPT and GS transgenes are specifically exemplified herein. As exemplified herein, transgenic plants showing enhanced growth characteristics have been generated in two species of Tomato (see Examples 4 and 17), Pepper (Example 8), Beans (Examples 9 and 10), Cowpea (Examples 11 and 12), Alfalfa (Example 13), Cantaloupe (Example 14), Pumpkin (Example 15), Arabidopsis (Example 16) and Camilena (Example 18). These transgenic plants of the invention were generated using a variety of transformation methodologies, including Agrobacteriυm-mediated callus, floral dip, seed inoculation, pod inoculation, and direct flower inoculation, as well as combinations thereof, and via sexual crosses of single transgene plants, as exemplified herein. Different GPT and GS transgenes were successfully employed in generating the transgenic plants of the invention, as exemplified herein.
The invention also provides methods of generating a transgenic plant having enhanced growth and other agronomic characteristics. In one embodiment, a method of generating a transgenic plant having enhanced growth and other agronomic characteristics comprises introducing into a plant ceil an expression cassette comprising a nucleic acid molecυie encoding a GPT transgene, under the control of a suitable promoter capable of driving the expression of the transgene, so as to yield a transformed plant ceil, and obtaining a transgenic plant which expresses the encoded GPT. In another embodiment, a method of generating a transgenic plant having enhanced growth and other agronomic characteristics comprises introducing into a plant ceil one or more nucleic acid constructs or expression cassettes comprising nucleic acid molecules encoding a GPT transgene and an GS transgene, under the control of one or more suitable promoters (and, optionally, other regulatory elements) capable of driving the expression of the transgenes, so as to yield a plant eel! transformed thereby, and obtaining a transgenic plant which expresses the GPT and GS transgenes.
Based on the results disclosed herein, it is clear that any number of GPT and GS polynucleotides may be used to generate the transgenic plants of the invention. Both GS1 and GPT proteins are highly conserved among various plant species, and it is evident from the experimental data disclosed herein that closely-related non-plant GPTs may be used as well (e.g., Danio rerio GPT). WiUi respect to GPT, numerous GPT polynucleotides derived from different species have been shown to be active and useful as GPT transgenes. Similarly, different GS polynucleotides may be used, including without limitation any plant GS1 encoding polynucleotide that generates GS activity in a host cell transformed with an expressible GS 1 construct.
In a specific embodiment, the GPT transgene is a GPT polynucleotide encoding an Arabidopsis derived GPT1 such as the GPT of SEQ ID NO: 2, SEQ ID NO: 21 and SEQ ID NO: 30, and the GS transgene is a GS polynucleotide encoding an Alfalfa derived GS1 (i,eM SEQ ID NO: 4) or an Arabidopsis derived GS1 (SEQ ID NO: 7). The GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 1 ; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 1, and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 2, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity; and a nucleotide sequence encoding the polypeptide of SEQ ID NO: 2 truncated at its amino terminus by between 30 to 56 amino acid residues, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity. The GS1 transgene may be encoded by the polynucleotide of SEQ ID NO: 3 or SEQ ID NO: 6 or a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 3 or SEQ ID NO: 6, and encoding a polypeptide having GPT activity; and a nucleotide sequence encoding the polypeptide of SEQ ID NO: 4 or 7, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GS activity. in another specific embodiment, the GPT transgene is a GPT polynucleotide encoding a Grape derived GPT1 such as the Grape GPTs of SEQ ID NO: 9 and SEQ ID NO: 31, and the GS transgene is a GS1 polynucleotide. The GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 8; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ IO NO: S, and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 9 or SEQ ID NO:
31, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity.
In yet another specific embodiment, the GPT transgene is a GPT polynucleotide encoding a Rice derived GPT, such as the Rice GPTs of SEQ ID NO: 11 and SEQ ID NO: 32, and the GS transgene is a GS1 polynucleotide. The GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 10; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 10. and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 11 or SEQ ID NO:
32, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity.
In yet another specific embodiment, the GPT transgene is a GPT polynucleotide encoding a Soybean derived GPT, such as the Soybean GPTs of SEQ ID NO: 13, SEQ IS NO: 33 or SEQ ID NO: 33 with a further lsoleucine at the N-terminus of the sequence, and the GS transgene is a GS1 polynucleotide. The GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 12; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 12, and encoding a polypeptide having GPT activity: a nucleotide sequence encoding the polypeptide of SEQ ID NO: 13 or SEQ ID NO: 33 or SEQ ID NO: 33 with a further lsoleucine at the N-terminus of the sequence, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity. in yet another specific embodiment, the GPT transgene is a GPT polynucleotide encoding a Barley derived GPT, such as the Barley GPTs of SEQ ID NO: 15 and SEQ ID NO: 34, and the GS transgene is a GS1 polynucleotide. The GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 14; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ iO NO: 10, and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ SO NO: 15 or SEQ ID NO:
34, or a polypeptide having at least 75% and more preferably at least 80% sequence identity thereto which has GPT activity.
In yet another specific embodiment, the GPT transgene is a GPT polynucleotide encoding a Zebra fish derived GPT, such as the Zebra fish GPTs of SEQ ID NO: 17 and SEQ ID NO: 35, and the GS transgene is a GS1 polynucleotide. The GPT transgene may be encoded by the nucleotide sequence of SEQ ID NO: 16; a nucleotide sequence having at least 75% and more preferably at least 80% identity to SEQ ID NO: 16. and encoding a polypeptide having GPT activity; a nucleotide sequence encoding the polypeptide of SEQ ID NO: 17 or SEQ ID NO:
35, or a polypeptide having at ieast 75% and more preferably at least 80% sequence identify thereto which has GPT activity.
In yet another specific embodiment, the GPT transgene is a GPT polynucleotide encoding a Bamboo derived GPT, such as the Bamboo GPT of SEQ ID NO: 36, and the GS transgene is a GS 1 polynucleotide. The GPT transgene may be encoded by a nucleotide sequence encoding the polypeptide of SEQ ID NO: 36, or a polypeptide having at least 75% and more preferably at ieast 80% sequence identity thereto which has GPT activity.
Other GPT polynucleotides suitable for use as GPT transgenes in the practice of the invention may be obtained by various means, as will be appreciated by one skilled in the art, tested for the ability to direct the expression of a GPT with GPT activity in a recombinant expression system (i.e., E. coli (see Examples 20-23), in a transient in pfanta expression system (see Example 19), or in a transgenic plant (see Examples 1-18). TRANSGENE CONSTRUCTS/EXPRESSION VECTORS
in order to generate the transgenic plants of the invention, the gene coding sequence for the desired transgene(s) must be incorporated into a nucleic acid construct (also interchangeably referred to herein as a (iransgene) expression vector, expression cassette, expression construct or expressible genetic construct) which can direct the expression of the transgene sequence in transformed piant celis. Such nucleic acid constructs carrying the transgene(s) of interest may be introduced into a piant cell or cells using a number of methods known in the art, including but not limited to electroporation, ONA bombardment or bioSistic approaches, microinjection, and via the use of various DNA-baεed vectors such as Agrobacteriυm tυmefaciens and Agrobacterium rhizogenes vectors. Once introduced into the transformed plant ceil, the nucleic acid construct may direct the expression of the incorporated transgene(s) (i.e., GPT), either in a transient or stable fashion. Stable expression is preferred, and is achieved by utilizing plant transformation vectors which are able to direct the chromosomal integration of the transgene construct. Once a piant cell has been successfully transformed, it may be cultivated to regenerate a transgenic piant.
A large number of expression vectors suitable for driving the constitutive or induced expression of inserted genes in transformed plants are known, in addition, various transient expression vectors and systems are known. To a large extent, appropriate expression vectors are selected for use in a particular method of gene transformation (see, infra). Broadiy speaking, a typical plant expression vector for generating transgenic plants wiii comprise the transgene of interest under the expression regulatory control of a promoter, a selectable marker for assisting in the selection of transformants, and a transcriptional terminator sequence.
More specifically, the basic elements of a nucleic acid construct for use in generating the transgenic plants of the invention are: a suitable promoter capable of directing the functional expression of the transgene(s) in a transformed plant cell, the transgene (s) (i.e., GPT coding sequence) operably linked to the promoter, preferably a suitable transcription termination sequence (i.e., nopafiπe synthetic enzyme gene terminator) operabiy linked to the transgene, and typically other elements useful for controlling the expression of the transgene, as well as one or more selectable marker genes suitable for selecting the desired transgenic product (i.e., antibiotic resistance genes).
As Agrobacterium tumefaciens is the primary transformation system used to generate transgenic plants, there are numerous vectors designed for Agrobacterium transformation. For stable transformation, Agrobacterium systems utilize "binary" vectors that permit plasmid manipulation in both £ coli and Agrobacterium, and typically contain one or more selectable markers to recover transformed plants (Heiiens et a!., 2000, Technical focus: A guide to Agrobacterium binary Ti vectors. Trends Rant Sci 5:446-451). Binary vectors for use in Agrobacterium transformation systems typically comprise the borders of T- DNA, multiple cloning sites, replication functions for Escherichia coli and A. tumefaciens, and selectable marker and reporter genes.
So-called "super-binary" vectors provide higher transformation efficiencies, and generally comprise additional virulence genes from a Ti (Komari et at., 2006, Methods MoI. βioi. 343: 15-41). Super binary vectors are typically used in plants which exhibit lower transformation efficiencies, such as cereals. Such additional virulence genes include without limitation WrS, virE, and virG (Vain et aL, 2004, The effect of additional virulence genes on transformation efficiency, transgene integration and expression in rice plants using the pGreen/pSoup dual binary vector system. Transgenic Res. 13: 593-603; Srivatanakul et ai., 2000, Additional virulence genes influence transgene expression: transgene copy number, integration pattern and expression. JL Plant Physiol. 157, 685-690; Park et al., 2000, Shorter T-DNA or additional virulence genes improve Agrobacterium- mediated transformation. Theor. Appi. Genet 101, 1015-1020; Jin et a!.. 1987, Genes responsible for the supervirulence phenotype of Agrobacterium tumefaciens A281. J. Bacterid. 169: 4417-4425). in the embodiments exemplified herein (see Examples, infra), expression vectors which place the inserted transgene(s) under the control of the constitutive CaMV 3SS promoter and the RuBisCo promoter are employed. A number of expression vectors which υtifize the CaMV 35S and RuBsCo promoter are known and/or commercially available and/or derivable using ordinary skill in the art.
PLANT PROMOTERS
The term 'promoter' is used to designate a region in the genome sequence upstream of a gene transcription start site (TSS), although sequences downstream of TSS may also affect transcription initiation as well. Promoter elements select the transcription initiation point, transcription specificity and rate. Depending on the distance from the TSS, the terms of 'proximal promoter' (several hundreds nucleotides around the TSS) and 'distal promoter' (thousands and more nucleotides upstream of the TSS) are also used. Both proximal and distal promoters include sets of various elements participating in the complex process of cell-, issue-, organ-, developmental stage and environmental factors- specific regulation of transcription. Most promoter elements regulating TSS selection are localized in the proximal promoter.
A large number of promoters which are functional in plants are known in the art. In constructing GPT and GS transgene constructs, the selected promoters) may be constitutive, non-specific promoters such as the Cauliflower Mosaic Virus 35S ribosomal promoter (CaMV 35S promoter), which is widely employed for the expression of traπsgenes in plants. Examples of other strong constitutive promoters include without limitation the rice actin 1 promoter, the CaMV 19S promoter, the Ti piasmid nopaiine synthase promoter, the alcohol dehydrogenase promoter and the sucrose synthase promoter.
Alternatively, in some embodiments, it may be desirable to select a promoter based upon the desired plant cells to be transformed by the transgene construct, the desired expression level of the transgene, the desired tissue or subcellular compartment for transgene expression, the developmental stage targeted, and the like.
For example, when expression in photosyπthetic tissues and compartments is desired, a promoter of the ribυiose bisphosphate carboxylase (RuBisCo) gene may be employed. In the Examples which follow, expressible nucleic acid constructs comprising QPT and GS1 transgenes under the control of a tomato RuBIsCo promoter were prepared and used in the generation of transgenic plants or to assay for GPT activity in μtanta or in E coll
When the expression in seeds is desired, promoters of various seed storage protein genes may be employed. For expression in fruits, a fruit-specific promoter such as tomato 2A11 may be used. {Examples of other tissue specific promoters include the promoters encoding lectin (Vodkin et alM 1983, Cell 34:1023-31: Lindstrom et aL, 1990, Developmental Genetics 11:160-167), com alcohol dehydrogenase 1 (Vogel et at, 1989, J. Cell. Biochem. (Suppl. 0) 13:Part D; Dennis et a!., 1984, Nucl. Acids Res., 12(9): 3983-4000), corn light harvesting complex (Simpson, 1986, Science, 233: 34-38; Bansal et al., 1992, Proc. Natl, Acad. Sci. USA, 89: 3654-3658), corn heat shock protein (Odell et al., 1985, Nature, 313: 810-812; Rochester et al., 1986, EMBO J., 5: 451-458), pea small subunit RuBP carboxylase (Poulsen et al., 1986, MoI. Gen. Genet., 205(2): 193- 200; Cashmore et al., 1983, Gen. Eng. Plants, Plenum Press, New York, pp 29- 38), Ti piasmid mannopine synthase and Ti plasmid nopaiine synthase (Langridge et al., 1989, Proc. Natl. Acad. Set. USA, 86: 3219-3223), petunia chaicone isomerase (Van Tunen et a!., 1988, EMBO J. 7(5): 1257-1263), bean glycine rich protein 1 (Keller et al., 1989, EMBO J. 8(5): 1309-1314), truncated CaMV 35s (Odel! et al, 1985, supra), potato patatin (Wenzler et al., 1989, Plant MoI. Biol. 12: 41-50), root cell (Conkiing et al., 1990, Plant Physiol. 93: 1203-1211), maize zein (Reina et al., 1990, Nucl. Acids Res. 18(21): 6426; Kriz et al., 1987, MoI. Gen. Genet. 207(1): 90-98; Wandelt and Feix, 1989, Nuc. Acids Res. 17(6): 2354; Langridge and Feix, 1983, Cell 34: 1015-1022; Reina et al., 1990, Nuci. Acids Res. 18(21): 6426), gJobulin-1 (Belanger and Kriz, 1991, Genetics 129: 863-872), α-tubulin (Carpenter et al., 1992. Plant Cell 4(5): 557-571; Uribe et al., 1998, Plant MoI. Biol. 37(6): 1069-1078), cab (Sullivan, et a!., 1989, MoI. Gen. Genet. 215(3): 431-440}, PEPCase (Hudspeth and Grula, 1989, Rant MoI. Biol. 12: 579-589), R gene complex (Chandler et al., 1989, The Plant Cell 1: 1175-1183), chalcone synthase (Franken et a!., 1991, EMBO J. 10(9): 2605-2612) and glutamine synthetase promoters (U.S. Pat. No. 5,391,725; Edwards et al., 1990, Proc. Natl. Acad. Sci. USA 87: 3459-3463; Brears et aL. 1991 , Plant J. 1 (2): 235-244).
in addition to constitutive promoters, various inducible promoter sequences may be employed in cases where it is desirable to regulate transgene expression as the transgenic plant regenerates, matures, flowers, etc. Examples of such inducible promoters include promoters of heat shock genes, protection responding genes (i.e., phenylalanine ammonia lyase: see, for example Bevan et al., 1989, EMBO J. 8(7): 899-906), wound responding genes (i.e., cell wall protein genes), chemically inducible genes (i.e., nitrate reductase, chitinase) and dark inducible genes (i.e., asparagine synthetase; see, for example U.S. Patent No. 5,256,558). Also, a number of plant nuclear genes are activated by light, including gene families encoding the major chlorophyll a/b binding proteins (cab) as well as the small subunit of ribuiose-1 ,5-bisphosphate carboxylase {rbcS) (see, for example, Tobin and Silverthorne, 1985, Annu. Rev. Plant Physiol. 36: 569-593; Dean et al., 1989, Annu. Rev. Plant Physiol.40: 415-439.).
Other inducible promoters include ABA- and turgor-inducible promoters, the auxin-binding protein gene promoter (Schwob et al., 1993, Plant J. 4(3): 423-432), the UDP glucose flavonoid giycosyf-transferase gene promoter (Ralston et aL, 1988, Genetics 119(1): 185-197); the MPI proteinase inhibitor promoter (Cordero et al., 1994, Plant J. 6(2): 141-150), the glyceraidehyde-3-phosphate dehydrogenase gene promoter (Kohler et a!., 1995, Plant MoI. Biol. 29(6): 1293- 1298; Quigiey et aL, 1989, J. MoL Evot. 29(5): 412-421; Martinez et al.,1989, J. MoL Biol. 208(4): 551-565) and light inducible piastid glutamine synthetase gene from pea (U.S. Pat. No.5,391 ,725; Edwards et al., 1990, supra).
For a review of plant promoters used in plant transgenic plant technology, see Potenza et al., 2004, In Vitro Cell. Devel. Biol - Plant, 40(1): 1-22. For a review of synthetic plant promoter engineering, see, for example, Venter, M., 2007, Trends Plant ScL1 12(3): 118-124.
GLUTAMINE FHENYLFYRUVATE TRANSAMINASE (GPT) TRANSGENE
The present invention discloses for the first time that plants contain a glutamine phenylpyruvate transaminase (GPT) enzyme which is directly functional in the synthesis of the signal metabolite 2-hydroxy-5-oxoproline. Until now, no plant transaminase with a defined function has been described. Applicants have isolated and tested GPT polynucleotide coding sequences derived from several plant and animal species, and have successfully incorporated the gene into heterologous transgenic host plants which exhibit markedly improved growth characteristics, including faster growth, higher foliar protein content, increased glutamine synthetase activity in foliar tissue, and faster CCfe fixation rates,
In the practice of the invention, the GPT gene functions as one of at least two transgenes incorporated into the transgenic plants of the invention, the other being the glutamine sythetase gene (see infra).
It is expected that ali piant species contain a GPT which functions in the same metabolic pathway, involving the biosynthesis of the signal metabolite 2-hydroxy- 5-oxoproline. Thus, in the practice of the invention, any plant gene encoding a GPT homolog or functional variants thereof may be useful in the generation of transgenic plants of this invention. Moreover, given the structural similarity between various piant GPT protein structures and the putative ( and biologically active) GPT homolog from Danio rerio (Zebra fish) (see Example 22), other non- plant GPT homologs may be used in preparing GPT transgenes for use in generating the transgenic plants of the invention.
When individually compared (by BLAST alignment) to the Arabidopsis mature protein sequence provided in SEQ ID NO: 30, the following sequence identities and homologies (BLAST "positives", including similar amino acids) were obtained for the following mature GPT protein sequences; (SEQ ID] or FIG. NO. ORIGiN % IDENTITY %POSITIVE
[31] Grape 84 93
[32] Rice 83 91 [33] Soybean 83 93
[34) Barley 82 91
[35] Zebra fish 83 92
[36] Bamboo 81 90
FIG.2 Corn 79 90 FIG.2 Castor 84 93
FIG.2 Poplar 85 93
Underscoring the conserved nature of the structure of the GPT protein across most plant species, the conservation seen within the above plant species extends to the non-human putative GPTs from Zebra fish and Chlamydomonas. In the case of Zebra fish, the extent of identity is very high (83% amino acid sequence identiy with the mature Arabklopsis GPT of SEQ ID NO: 30, and 92% homologous taking similar amino acid residues into account). The Zebra fish mature GPT was confirmed by expressing it in E colt and demonstrating biological activity (synthesis of 2-oxogiutaramate).
In order to determine whether putative GPT homologs would be suitable for generating the growth-enhanced transgenic plants of the invention, one need initially express the coding sequence thereof in E coli or another suitable host and determine whether the 2-oxogiutaramate signal metabolite is synthesized at increased levels (see Exampies 19*23). Where such an increase is demonstrated, the coding sequence may then be introduced into both homologous plant hosts and heterologous plant hosts, and growth characteristics evaluated. Any assay that is capable of detecting 2-oxoglutaramate with specificity may be used for this purpose, including without iimitation the NMR and HPLC assays described in Example 2, infra. In addition, assays which measure GPT activity directly may be empioyed, such as the GPT activity assay described in Example 7. Any plant GPT with 2-oxoglutaramate synthesis activity may be used to transform plant ceils in order to generate transgenic plants of the invention. There appears to be a high ievel of structural homology among plant species, which appears to extend beyond plants, as evidenced by the ciose homology between various plant GPT proteins and the putative Zebra fish QPT homolog. Therefore, various piant GPT genes may be used to generate growth-enhanced transgenic plants in a variety of heterologous plant species. In addition, GPT transgenes expressed in a homologous piant would be expected to resυit in the desired enhanced-growth characteristics as weli (i.e., rice giutamine transaminase over-expressed in transgenic rice plants), although it is possible that regulation within a homologous celi may attenuate the expression of the transgene in some fashion that may not be operable in a heterologous cell.
GLUTAMiNE SYNTHETASE (GS) TRANSGENE:
in the practice of the invention, the giutamine synthetase (GS) gene functions as one of at least two transgenes incorporated into the transgenic plants of the invention (GPT being the other of the two).
Giutamine synthetase plays a key role in nitrogen metabolism in plants, as well as in animals and bacteria. The GS enzyme catalyzes the addition of ammonium to glυtamate to synthesize giutamine in an ATP-dependent reaction. GS enzymes from assorted species show highly conserved amino acid residues considered to be important for active site function, indicating that GS enzymes function similarly (for review, see Eisenberg et ai., Biochimtca et Biophysica Acta, 1477:122 145, 2000).
GS is distributed in different subcellular locations (chloroplast and cytoplasm) and is found in various plant tissues, including leaf, root, shoot, seeds and fruits. There are two major isoforms of plant GS: the cystolic isoform (GS1) and the plastidic (chloroplastic) isoform (GS2). GS2 is principally found in leaf tissue and functions in the assimilation of ammonia produced by photorespiraiion or by nitrate reductton. GS1 is mainly found in leaf and root tissue, typically exists in a number of different isofcrms in higher plants, and functions to assimilate ammonia produced by all other physiological processes (Coruzzi, 1991, Plant Science 74: 145-155; McGrath and Coruzzi, 1991, Plant J. 1(3): 275-280; Lam et al, 1996, Ann. Rev. Plant Physiol. Plant MoI. Biol. 47: 569-593; Stitt, 1999. Curr. Op. Plant Biol. 2: 178-186; Oiiveira et at., 2001, Brazilian J. Med. Bioi. Res. 34: 567-575). Multiple QS genes are associated with a complex promoter repertoire which enable the expression of GS in an organ and tissue specific manner, as well as in an environmental factor-dependent manner.
Plant glutamine synthetase consists of eight subunits, and the native enzyme in plants has a molecular mass ranging from 320 to 380 KD, each subunit having a molecular mass of between 38 and 45 kθ. The GS1 genes of several plants, especially legumes, have been cloned and sequenced (Tischer et a!., 1986, MoI Gen Genet 203: 221-229; Gebhardt et al., 1986, EMBO J. 5: 1429-1435; Tingey et at., 1987, EMBO J. 6: 1-9; Tingey et al., 1988, J Biol Chem. 263: 9651-9657; Bennett et al., 1989, Rant MoI Biol. 12: 553-565; Boron and Legocki, 1993« Gene 136: 95-102; Roche et al., 1993, Plant MoI Biol. 22: 971-983; Marsolier et a!.. 1995, Plant MoI Biol. 27: 1-15; Temple et al., 1995, MoI Plant-Microbe Interact. 8: 218-227). Ail have been found to be encoded by nuclear genes (for review, see, Morey etal., 2002, Plant Physiol. 128(1): 182-193).
Chloroplastic GS2 appears to be encoded by a single gene, while various cystoloic GS1 isoforms are encoded within mυltigene families (Tingey et aL, 1987, supra; Sakamoto et al., 1989, Plant MoL BioL 13: 611-614; Brears et al, 1991, supra-, Li et al.. 1993, Plant MoI. Bio!., 23:401-407; Dubois et al.. 1996, Plant MoI. Biol., 31:803-817; Lam et al., 1996, supra). GS1 multigene families appear to encode different subunits which may combine to form homo- or hetero-octamers. and the different members show a unique expression pattern suggesting that the gene members are differentially regulated, which may relate to the various functional roles of glutamine synthetase plays in overall nitrogen metabolism (Gebhardt et al., 1986, supra; Tingey et al., 1987, supra; Bennett et al., 1989, supra: Walker and Coruzzi, 1989, supra; Peterman and Goodman, 1991. Moi Gen Genet. 1991 ;330:145-154.; Marsoiier et al., 1995, supra', Temple et al., 1995, supra; Dubois et al., 1996, supra).
in one embodiment, a GS 1 gene coding sequence is employed to generate GS transgene constructs. In particular embodiments, further described in the Examples, Infra, the Alfalfa or Arabidopsis GS1 gene coding sequence is used to generate a transgene construct that may be used to generate a transgenic plant expressing the GS1 transgene. As an example, such a construct may be used to transform Agrobacteria. The transformed Agrobacteπa are then used to generate To transgenic plants. Example 5 demonstrates the generation of To GS1 transgenic tobacco plants using this approach. Similarly, Examples 6 and 17 demonstrates the generation of To GS1 transgenic tomato plants, Example 8 demonstrates the generation of To GS1 transgenic pepper plants, Examples 9 and 10 demonstrate the generation of T0 GS1 transgenic bean plants, Examples 11 and 12 demonstrate the generation of To GS1 transgenic cowpea plants, Example 13 demonstrates the generation of TQ GS1 transgenic alfalfa plants, Example 14 demonstrates the generation of T0 GS 1 transgenic cantaloupe plants, Example 15 demonstrates the generation of T0 GS 1 transgenic pumpkin plants, Example 16 demonstrates the generation of T0 GS1 transgenic Arabidopsis plants, and Example 18 demonstrates the generation of T0 GS1 transgenic Cantaloupe plants.
TRANSCRIPTION TERMINATORS:
In preferred embodiments, a 3' transcription termination sequence is incorporated downstream of the transgene in order to direct the termination of transcription and permit correct polyadenylation of One mRNA transcript. Suitable transcription terminators are those which are known to function in plants, including without limitation, the nopaline synthase (NOS) and octopine synthase (OCS) genes of Agrobacterium fomeføc/ens, the T7 transcript from the octopine synthase gene, the 3' end of the protease inhibitor I or Il genes from potato or tomato, the CaMV 35S terminator, the tml terminator and the pea rbcS E9 terminator. In addition, a gene's native transcription terminator may be used. In specific embodiments, described by way of the Examples, infra, the nopaiine synthase transcription terminator is employed.
SELECTABLE MARKERS:
Selectable markers are typically included in transgene expression vectors in order to provide a means for selecting transformants. While various types of markers are available, various negative selection markers are typically utilized, including those which confer resistance to a selection agent that inhibits or kills υntransformed cells, such as genes which impart resistance to an antibiotic (such as kanamycin, gentamycin, anamycin, hygromycin and hygromycinB) or resistance to a herbicide (such as sulfonylurea, gulfosinate, phosphinothricin and glyphosate). Screenable markers include, for example, genes encoding β- glucuronidase (Jefferson. 1987, Plant MoI. Biol. Rep 5: 387-405), genes encoding luciferase (Ow et a!., 1986, Science 234: 856-859) and various genes encoding proteins involved in the production or control of anthocyanin pigments (See, for example, U.S. Patent 6,573,432). The £ coli glucuronidase gene (gus, gusA or uidA) has become a widely used selection marker m plant transgenics, largely because of the glucuronidase enzyme's stability, high sensitivity and ease of detection (e.g., fluorometric, spectrophotometry, various histochemical methods). Moreover, there is essentially no detectable glucuronidase in most higher plant species.
TRANSFORMATION METHODOLOGIES AND SYSTEMS:
Various methods for introducing the transgene expression vector constructs of the invention into a plant or plant cell are well known to those skilled in the art, and any capable of transforming the target plant or plant cell may be utilized.
Agrobacterium-medtatβά transformation is perhaps the most common method utilized in plant transgenics, and protocols for Agrobacteriurn-meάiateti transformation of a large number of plants are extensively described in the literature (see, for example, Agrobacterium Protocols, Wan, ed., Humana Press, 2nd edition, 2006). Agrobacterium tumβfaciens is a Gram negative soil bacteria that causes tumors (Crown Gafl disease) in a great many dicot species, via the insertion of a small segment of tumor-inducing DNA { "T-DNA", transfer DNA') into the plant cell, which is incorporated at a semi-random location into the plant genome, and which eventually may become stably incorporated there. Directly repeated DNA sequences, called T-DNA borders, define the left and the right ends of the T-DNA. The T-DNA can be physically separated from the remainder of the Ti-piasmid, creating a 'binary vector* system.
Agrobacterium transformation may be used for stably transforming dicots, monocots, and cells thereof (Rogers et al., 1986, Methods Enzymol., 118: 627- 641; Hernalsteen et a!., 1984, EMBO J., 3: 3039*3041; Hoykass-Van Siogteren et a!.. 1984, Nature. 311: 763-764; Grimsley et al., 1987, Nature 325: 167-1679; Boulton et al.. 1989, Plant MoI. Biol 12: 31-40; Gould et al., 1991, Plant Physiol. 95: 426-434). Various methods for introducing DNA into Agrobacteria are known, including electroporation, freeze/thaw methods, and triparenta! mating. The most efficient method of placing foreign DNA into Agrobacterium is via electroporation (Wise et al., 2006, Three Methods for the Introduction of Foreign DNA into Agrobacterium, Methods in Molecular Biology, vol. 343: Agrobacterium Protocols, 2/e, volume 1; Ed., Wang, Humana Press Inc., Totowa, NJ, pp. 43-53). In addition, given that a large percentage of T-DNAs do not integrate, Agrobacterium-mexiteted transformation may be used to obtain transient expression of a transgene via the transcriptional competency of unincorporated transgene construct molecules (Helens etai., 2005, Plant Methods 1:13).
A large number of Agrobacterium transformation vectors and methods have been described (Karimi et al., 2002, Trends Plant ScL 7(5): 193-5), and many such vectors may be obtained commercially {for example, Invitrogen). In addition, a growing number of "open-source" Agrobacterium transformation vectors are available (for example, pCambia vectors; Cambia, Canberra, Australia). See, also, subsection herein on TRANSGENE CONSTRUCTS, supra. In a specific embodiment described further in the Examples, a pMON316-based vector was used in the leaf disc transformation system of Horsch et. al. (Horsch et al.,1995, Science 227:1229-1231) to generate growth enhanced transgenic tobacco and tomato plants. Other commonly used transformation methods that may be employed in generating the transgenic plants of the invention include without limitation microprojectiie bombardment, or btoltsttc transformation methods, protoplast transformation of naked DNA by calcium, polyethylene glycol (PEG) or electroporation (Paszkowski βt al., 1984, EMBO J. 3: 2727-2722; Potrykus et al., 1985, MoI. Gen. Genet 199: 169-177; Fromm et aL, 1985, Proc. Nat. Acad. Sci. USA 82: 5824-5828; Shimamoto et al., 1989, Nature, 338: 274-276.
βiolistic transformation involves injecting millions of DNA-coated metal particles into target cells or tissues using a biolistic device (or "gene gun"), several kinds of which are available commercially; once inside the cell, the DNA elutes off the particles and a portion may be stably incorporated into one or more of the cell's chromosomes (for review, see Kikkert et al., 2005, S&fcte Transformation of Plant Cells by Particle Bombardment/Biotistics, in: Methods in Molecular Biology, vol. 286: Transgenic Plants: Methods and Protocols, Ed. L. Pefla, Humana Press Inc., Totowa, NJ).
Electroporation is a technique that utilizes short, high-intensity electric fields to permeabilize reversibiy the lipid btlayers of ceil membranes (see, for example, Ftsk and Dandekar, 2005, Introduction and Expression of Transgenes in Plant Protoplasts, in: Methods in Molecular Biology, vol. 286: Transgenic Rants: Methods and Protocols, Ed. L. Pefia, Humana Press Inc., Totowa, NJ, pp. 79-90; Fromm et al.,1987, Electroporation of DNA and RNA into plant protoplasts, in Methods in Enzymology, Vol. 153, Wu and Grossman, eds., Academic Press, London, UK1 pp. 351-366; Joersbo and Brunstedt, 1991, Electroporation: mechanism and transient expression, stable transformation and biological effects in plant protoplasts. Physiol. Plant. 81, 256-264; Bates, 1994, Genetic transformation of plants by protoplast electroporation. MoI. Biotech. 2: 135-145; Dillen et aL, 1998, Eiectroporation-mediated DNA transfer to plant protoplasts and intact plant tissues for transient gene expression assays, in Cell Biology, Vol. 4, ed., Celis, Academic Press, London, UK, pp. 92-99). The technique operates by creating aqueous pores in the bacterial membrane, which are of sufficiently large size to allow DNA molecuies (and other macromolecuies) to enter the ceil, where the transgene expression construct (as T-DNA) may be stably incorporated into plant genomic DNA, leading to the generation of transformed cells that can sυbseqυentiy be regenerated into transgenic plants.
Newer transformation methods include so-called "flora! dip" methods, which offer the promise of simplicity, without requiting plant tissue culture, as is the case with all other commonly used transformation methodologies (Bent et aL, 2006, Arβbidopsis thahana Floral Dip Transformation Method, Methods MoI Biol, voi. 343: Agrobacteήum Protocols, 2/e, volume 1; Ed., Wang, Humana Press Inc., Totowa, NJ, pp. 87-103; Clough and Bent. 1998, Floral dip: a simplified method for Agrobacterium-mediated transformation of Arabidopsis thaliana, Plant J. 16: 735-743). However, with the exception of Arabidopsis, these methods have not been widely used across a broad spectrum of different plant species. Briefly, floral dip transformation is accomplished by dipping or spraying flowering plants in with an appropriate strain of Agrobacteήum tumefaciens. Seeds collected from these To plants are then germinated under selection to identify transgenic Ti individuals. Example 16 demonstrated floral dip inoculation of Arabidopsis to generate transgenic Arabidopsis plants.
Other transformation methods include those in which the developing seeds or seedlings of plants are transformed using vectors such as Agrobacterium vectors. For example, as exemplified in Example 8, such vectors may be used to transform developing seeds by injecting a suspension or mixture of the vector (i.e., Agrobactβria) directly into the seed cavity of developing pods (i.e., pepper pods, bean pods, pea pods and the like). Seedlings may be transformed as described for Alfalfa in Example 13. Germinating seeds may be transformed as described for Cameiina in Example 18. Intra-fruft methods, in which the vector is injected into fruit or developing fruit, may be used as described for Cantaloupe melons in Example 14 and pumpkins in Example 15.
Still other transformation methods include those in which the flower structure is targeted for vector inoculation, such as the flower inoculation methods described for beans in Examples 9 and 10, peas in {Examples 11 and 12 and tomatoes in Example 17.
The foregoing plant transformation methodologies may be used to introduce transgenes into a number of different plant cells and tissues, including without limitation, whole plants, tissue and organ explants including chloropfasts, flowering tissues and cells, protoplasts, meristem cells, callus, immature embryos and gametic cells such as microspores, pollen, sperm and egg ceils, tissue cultured ceils of any of the foregoing, any other cells from which a fertile regenerated transgenic plant may be generated. Callus is initiated from tissue sources including, but not limited to. immature embryos, seedling apical meristems, microspores and the like. Cells capable of proliferating as callus are also recipient cells for genetic transformation.
Methods of regenerating individual plants from transformed plant cells, tissues or organs are known and are described for numerous plant species.
As an illustration, transformed plantlets (derived from transformed cells or tissues) are cultured in a root-permissive growth medium supplemented with the selective agent used in the transformation strategy (i.e., and antibiotic such as kanamycin). Once rooted, transformed plantlets are then transferred to soil and allowed to grow to maturity. Upon fiowering, the mature plants are preferably seifed (self- fertiiized), and the resultant seeds harvested and used to grow subsequent generations. Examples 3 - 6 describe the regeneration of transgenic tobacco and tomato plants.
To transgenic plants may be used to generate subsequent generations (e.g., Ti, T2, etc.) by selfing of primary or secondary transformants, or by sexual crossing of primary or secondary transformants with other plants (transformed or untransformed). For example, as described in Example 7, infra, individual plants over expressing Hie Alfalfa GS1 gene and outperforming wildtype plants were crossed with individual plants over-expressing the Arabidopsis GPT gene and outperforming wiidtype plants, by simple sexual crossing using manual poiien transfer. Reciprocal crosses were made such that each plant served as the maie in a set of crosses and each plant served as the female in a second set of crosses. During the mature piant growth stage, the plants are typically examined for growth phenotype, CO2 fixation rate, etc. (see following subsection).
SELECTION OF GROWTH-ENHANCED TRANSGENIC PLANTS:
Transgenic plants may be selected, screened and characterized using standard methodologies. The preferred transgenic plants of the invention will exhibit one or more phenotypic characteristics indicative of enhanced growth and/or other desirable agronomic properties. Transgenic plants are typically regenerated under selective pressure in order to select transformaπts prior to creating subsequent transgenic plant generations. In addition, the selective pressure used may be employed beyond T0 generations in order to ensure the presence of the desired transgene expression construct or cassette.
To transformed plant cells, calli, tissues or plants may be identified and isolated by selecting or screening for the genetic composition of and/or the phenotypic characteristics encoded by marker genes contained in the transgene expression construct used for the transformation. For example, selection may be conducted by growing potentially-transformed plants, tissues or cells in a growth medium containing a repressive amount of antibiotic or herbicide to which the transforming genetic construct can impart resistance. Further, the transformed plant cells, tissues and plants can be identified by screening for Hie activity of marker genes (such as β-glucuronidase) which may be present in the transgene expression construct.
Various physical and biochemical methods may be employed for identifying plants containing the desired transgene expression construct, as is well known. Examples of such methods include Southern blot analysis or various nucleic acid amplification methods (i.e., PCR) for identifying the transgene, transgene expression construct or elements thereof; Northern blotting, S1 RNase protection, reverse transcriptase PCR (RT-PCR) amplification for detecting and determining the RNA transcription products; and protein gel electrophoresis, Western blotting, immuπoprecipitatioπ, enzyme immunoassay, and the like for identifying the protein encoded and expressed by the transgene.
in another approach, expression levels of genes, proteins and/or metabolic compounds that are know to be modulated by transgene expression in the target plant may be used to identify transformaπts. In one embodiment of the present invention, increased levels of the signal metabolite 2-oxoglutaramaie may be used to screen for desirable transformants, as exemplified in the Examples. Similarly, increased levels of GPT and/or GS activity may be assayed, as exemplified in the Examples.
Ultimately, the transformed plants of the invention may be screened for enhanced growth and/or other desirabie agronomic characteristics, indeed, some degree of phenotypic screening is generally desirabie in order to identify transformed lines with the fastest growth rates, the highest seed yieids, etc., particuiariy when identifying plants for subsequent selfing, cross-breeding and back-crossing. Various parameters may be used for this purpose, including without limitation, growth rates, total fresh weights, dry weights, seed and fruit yields (number, weight), seed and/or seed pod sizes, seed pod yields (e.g., number, weight), leaf sizes, plant sizes, increased flowering, time to flowering, overall protein content (in seeds, fruits, plant tissues), specific protein content (i.e., GS), nitrogen content, free amino acid, and specific metabolic compound levels (i.e., 2-oxoglutaramate). Generally, these phenotypic measurements are compared with those obtained from a parental identical or anaiogous plant line, an untransformed identicai or anaiogous plant, or an identical or anaiogous wild-type plant (i.e., a normal or parental plant). Preferably, and at least initially, the measurement of the chosen phenotypic characteristics) in the target transgenic plant is done in paraiiei with measurement of the same characteristtc(s) in a normal or parental plant. Typically, multiple plants are used to establish the phenotypic desirability and/or superiority of the transgenic plant in respect of any particular phenotypic characteristic. Preferably, initia! transformants are selected and then used to generate Ti and subsequent generations by selfing (self-fertilization), until the transgene genotype breeds true (i.e., the plant is homozygous for the transgene). In practice, this is accomplished by selfing for 3 or 4 generations, screening at each generation for the desired traits and setting those individuals. As exemplified herein, transgenic plant Sines propagated through at least one sexual generation (Tobacco, Arabidopsis, Tomato) demonstrated higher transgene product activities compared to lines that did not have the benefit of sexual reproduction and the concomitant increase in transgene copy number.
Stable transgenic lines may be crossed and back-crossed to create varieties with any number of desired traits, including those with stacked transgenes, multiple copies of a transgene, etc. Additionally, stable transgenic plants may be further modified genetically, by transforming such plants with further transgenes or additional copies of the parental transgene. Also contemplated are transgenic plants created by single transformation events which introduce multiple copies of a given transgene or multiple transgenes. Various common breeding methods are well know to those skilled in the art (see, e.g., Breeding Methods for Cultivar Development, Wilcox J. ed., American Society of Agronomy, Madison Wis. (1987)).
In a another aspect, the invention provides transgenic plants characterized by increased nitrogen use efficiency. Nitrogen use efficiency may be expressed as plant yield per given amount of nitrogen. In the Examples provided herein, the transgene and control plants all received the same nutrient solutions in the same amounts. The transgenic plants were consistently characterized by higher yields, and thus have higher nitrogen use efficiencies.
In yet another aspect, the invention provides transgenic plants and seeds thereof with increased tolerance to high salt growth conditions. This aspect of the invention is exemplified by Example 24, which describes the germination of transgenic tobacco plant seeds in very high salt conditions (200 mM NaCl). While counterpart wild type tobacco seeds germinated at a rate of only about 10%, on average, the transgenic tobacco seeds achieved nearly the same rate of germination obtained under no salt conditions for both transgenic and wild type seeds, or about 92%.
EXAMPLES
Various aspects of the invention are further described and illustrated by way of the several examples which foiiow, none of which are intended to limit the scope of the invention.
EXAMPLE 1 : ISLOATION OF ARABtDOPSIS GLUAMfNE PHENYLPYRUVATE TRANSAMINASE (GPT) GENE:
in an attempt to locate a plant enzyme that is directly involved in the synthesis of the signal metabolite 2-oxoglutaramate, applicants hypothesized that the putative plant enzyme might bear some degree of structural relationship to a human protein that had been characterized as being involved in the synthesis of 2- oxoglutaramate. The human protein, giutamine transaminase K (E.C. 2.6.1.64) (also referred in the literature as cysteine conjugate & -lyase, kyneurenine aminotransferase, giutamine phenyipyruvate transaminase, and other names), had been shown to be involved in processing of cysteine conjugates of halogenated xenobiotics (Perry et al., 1995, FEBS Letters 360:277-280). Rather than having an activity involved in nitrogen metabolism, however, human cysteine conjugate β~lyase has a detoxifying activity in humans, and in animals. Nevertheless, the potential involvement of this protein in the synthesis of 2- oxoglutaramate was of interest.
Using the protein sequence of human cysteine conjugate β-lyase, a search against the TIGR Arabidopsis plant database of protein sequences identified one potentially related sequence, a polypeptide encoded by a partial sequence at the Arabidopsis gene locus at At1q77670, sharing approximately 36% sequence homoiogy/identity across aligned regions. The full coding region of the gene was then amplified from an Arabidopsis cDNA library (Stratagene) with the following primer pair:
5'-CCCATCGATGTACC TGGACATAAATGGTGTGATG^' 51- GATGGTACCTCAGACTTTTCTCTTAAGCTTCTGCTTOS'
These primers were designed to incorporate CIa I (ATCGAT) and Kpn I (GGTACC) restriction sites to facilitate subsequent subcloning into expression vectors for generating transgenic plants. Takara ExTaq DNA polymerase enzyme was used lor high fidelity PCR using the following conditions: initial denaturing 94C for 4 minutes, 30 cycles of 94C 30 second, annealing at 55C for 30 seconds, extension at 72C for 90 seconds, with a final extension of 72C for 7 minutes. The amplification product was digested with Cia I and Kpn 1 restriction enzymes, isolated from an agarose gel electrophoresis and ligated into vector pMon316 (Rogers, et at. 1987 Methods in Enzymoiogy 153:253-277) which contains the cauliflower mosaic virus (CaMV, also CMV) 35S constitutive promoter and the nopatine synthase (NOS) 3' terminator. The ligation was transformed into DHSu cells and transformants sequenced to verify the insert.
A 1.3 kb cDNA was isolated and sequenced, and found to encode a full length protein of 440 amino acids in length, including a putative chloropiast signal sequence.
EXAMPLE 2: PRODUCTION OF BIOLOGICALLY ACTIVE RECOMBINANT ARABIDOPSIS GLUTAMINE PHENYLPYRUVATE TRANSAMINASE (GPT):
To test whether the protein encoded by the cDNA isolated as described in Example 1 , supra, is capable of catalyzing the synthesis of 2- oxogiutaramate, the cDNA was expressed in E coll, purified, and assayed for its ability to synthesize 2-oxogiυtaramate using a standard method,
NMR Assay for 2-oxoαlutaramate:
Briefly, the resulting purified protein was added to a reaction mixture containing
150 mM Tris-HCl, pH 8.5, 1 mM beta mercaptoethanol, 200 mM glutamine, 100 mM glyoxylate and 200 microM pyridoxal 5'-phosphate. The reaction mixture without added test protein was used as a control. Test and control reaction mixtures were incubated at 37°C for 20 hours, and then clarified by centrifυgation to remove precipitated material. Supernatants were tested for the presence and amount of 2-oxoglutaramate using 13C NMR with authentic chemically synthesized 2-oxoglutaramatβ as a reference. The products of the reaction are 2- oxogluiaramate and glycine, while the substrates (giυtamiπe and glyoxyiate) diminish in abundance. The cyclic 2-oxogiutaramate gives rise to a distinctive signal allowing it to be readily distinguished from the open chain giutamine precursor.
HPLC Assay for 2-oxoσ.lutaramate:
An alternative assay for GPT activity uses HPLC to determine 2-oxoglutaramate production, following a modification of Calderon et al., 1985, J Bacterid 161(2): 807-809. Briefly, a modified extraction buffer consisting of 25 mM Tris-HCl pH 8.5, 1 mM EDTA, 20 μM FAO. 10 mM Cysteine, and -1.5% (v/v) Mercaptoethanol. Tissue samples from the test material {i.e., plant tissue) are added to the extraction buffer at approximately a 1/3 ratio (w/v), incubated for 30 minutes at 37VC, and stopped with 200μ! of 20% TCA. After about 5 minutes, the assay mixture is centrifugβd and the supernatant used to quantify 2-oxoglutaramate by HPLC, using an ION-300 7.8mm IO X 30 cm L column, with a mobile phase In 0.01 N h2SO4, a flow rate of approximately 0.2 ml/min, at 40*C. Injection volume is approximately 20 μl, and retention time between about 38 and 39 minutes. Detection is achieved with 210nm UV light.
Results Using NMR Assav:
This experiment revealed that the test protein was able to catalyze the synthesis of 2- σxoglutaramate. Therefore, these data indicate that the isolated cDNA encodes a giutamine phenyipyruvate transaminase that is directly involved in the synthesis of 2-oxoglutaramate in plants. Accordingly, the test protein was designated Arabidopsis giutamine phenyipyruvate transaminase, or "GPT". The nucleotide sequence of the Arabidopsis GPT coding sequence is shown in the Table of Sequences, SEQ ID NO. 1. The translated amino acid sequence of the GPT protein is shown in SEQ ID NO.2.
EXAMPLE 3: CREATION OF TRANSGENIC TOBACCO PLANTS OVER- EXPRESSING ARABIDOPSIS GPT:
Generation of Plant Expression Vector PMON-PJU: Briefly, the plant expression vector pMon31δ-PJU was constructed as follows. The isolated cDNA encoding Arabidopsis GPT (Example 1) was cloned into the Clal-Kpnl polylinker site of the pMON316 vector, which places the GPT gene under the contra! of the constitutive cauliflower mosaic virus (CaMV) 35S promoter and the nopaϋne synthase (NOS) transcriptional terminator, A kanarnycin resistance gene was included to provide a selectable marker.
Aαroftactem/m-Mediated Plant Transformations: pMON-PJU and a control vector pMon316 (without inserted ONA) were transferred to Agrobacterium tυmβfaciens strain pϊiTT37ASE using a standard electroporation method (McCormac et al., 1998, Molecular Biotechnology 9:155- 159), followed by plating on LB plates containing the antibiotics spectinomycin (100 micro gm / ml) and kanarnycin (50 micro gm / ml). Antibiotic resistant colonies of Agrobacterium were examined by PCR to assure that they contained plasmid,
Nicotians tabacυm cv. Xanthi plants were transformed with pMON-PJU transformed Agrobacteήa using the ieaf disc transformation system of Horsch et. al. (Horsch et al.,1995, Science 227:1229-1231). Briefly, sterile leaf disks were inoculated and cultured for 2 days, then transferred to selective MS media containing 100 μg/ml kanarnycin and 500 μg/ml clafanm Transformants were confirmed by their ability to form roots in the selective media.
Generation of GPT Transgenic Tobacco Plants:
Sterile leaf segments were allowed to develop callus on Murashige & Skoog (M&S) media from which the transformant plantlets emerged. These piaπtlets were then transferred to the rooting-permissive selection medium (M&S medium with kanamycin as the selection agent). The healthy, and now rooted, transformed tobacco plantlets were then transferred to soil and allowed to grow to maturity and upon flowering the plants were selfed and the resultant seeds were harvested. During the growth stage the plants had been examined for growth phenotype and the COz fixation rate was measured for many of the young transgenic plants.
Production of T1 and T2 Generation GPT Transgenic Plants: Seeds harvested form the To generation of the transgenic tobacco plants were germinated on M&S media containing kanamycin (100 mg / L) to enrich for the transgene. At least one fourth of the seeds did not germinate on this media {kanamycin is expected to inhibit germination of the seeds without resistance that would have been produced as a result of normal genetic segregation of the gene) and more than half of the remaining seeds were removed because of demonstrated sensitivity (even mild) to the kanamycin.
The surviving plants (Ti generation) were thriving and these plants were then seffed to produce seeds for the T2 generation. Seeds from the Ti generation were germinated on MS media supplemented for the transformant lines with kanamycin (10mg/iiter). After 14 days they were transferred to sand and provided quarter strength Hoagiand's nutrient solution supplemented with 25 mM potassium nitrate. They were allowed to grow at 24°C with a photoperiod of 16 h light and 8 hr dark with a light intensity of 900 micromoles per meter squared per second They were harvested 14 days after being transferred to the sand culture.
Characterization of GPT Transgenic Rants:
Harvested transgenic plants (both GPT transgenes and vector control transgenes) were analyzed for glutamine sythetase activity in root and leaf, whole plant fresh weight, total protein in root and leaf, and CO2 fixation rate (Knight et at., 1988, Plant Physiol. 88: 333). Non-transformed, wild-type Λ. tumefaciens plants were also analyzed across the same parameters in order to establish a baseline control. Growth characteristic results are tabulated below in Table I. Additionally, a photograph of the GPT transgenic plant compared to a wild type control plant is shown in FiG. 2 (together with GS1 transgenic tobacco plant, see Example 5). Across ail parameters evaluated, the GPT transgenic tobacco plants showed enhanced growth characteristics. In particular, the GPT transgenic plants exhibited a greater than 50% increase in the rate of CO2 fixation, and a greater than two-fold increase in glυtamine synthetase activity in leaf tissue, relative to wild type control plants. In addition, the leaf-to-root GS ratio increased by almost three-fold in the transaminase transgenic plants relative to wild type control. Fresh weight and total protein quantity also increased in the transgenic plants, by about 50% and 80% (leaf), respectively, reiative to the wild type control- These data demonstrate that tobacco plants overexpressing the Arabidopsis GPT transgene achieve significantly enhanced growth and CQz fixation rates.
EXAMPLE 4: GENERATION OF TRANSGENIC TOMATO PLANTS CARRYING ARABIDOPSiS GPT TRANSGENE:
Transgenic Lycopβrsicon βsculentυm (Micro-Tom Tomato) plants carrying the Arabidopsis QPT transgene were generated using the vectors and methods described in Example 3. To transgenic tomato plants were generated and grown to maturity, initial growth characteristic data of the GPT transgenic tomato plants is presented in Table Ii. The transgenic plants showed significant enhancement of growth rate, flowering, and seed yield in relatbn to wild type control plants, in addition, the transgenic plants developed multiple main stems, whereas wild type plants developed with a single main stem. A photograph of a GPT transgenic tomato plant compared to a wild type plant is presented in FIG. 3 (together with GS1 transgenic tomato plants, see Example 6).
TABLE Ii
EXAMPLE 5: GENERATION OF TRANSGENIC TOBACCO PLANTS OVEREXPRESSING ALFALFA GS1 :
Generation of Plant Expression Vector PGS111 :
Transgenic tobacco plants overexpressing the Alfalfa GS 1 gene were generated as previously described (Temple et ai., 1993, Moi. Gen. Genetics 236: 315-325). Briefly, the plant expression vector pGS111 was constructed by inserting the entire coding sequence together with extensive regions of both the 5' and 3' untranslated regions of the Alfalfa GS1 gene (SEQ IO NO: 3] (DasSarma at ai.,
1986. Science, VoI 232, Issue 4755, 1242-1244) into pMON316 (Rogers et al.,
1987, supra), placing the transgene under the control of the constitutive cauliflower mosaic virus (CaMV) 35S promoter and the nopaline synthase (NOS) transcriptional terminator A kanamycin resistance gene was included to provide a selectable marker.
Generation of GS1 Transformants: pGS111 was transferred to Agrobactβrium tumefaciens strain pTiTT37ASE using triparental mating as described (Rogers et a!., 1987, supra; Unkefer et a)., U.S. Patent No. 6,555,500). Nicotiana tabacυm cv. Xanthi plants were transformed with pGS111 transformed Agrobacteria using the leaf disc transformation system of Horsch et. al. (Horsch et al.,1995, Science 227:1229-1231). Transformants were selected and regenerated on MS medium containing 100μg/ml kanamycin. Shoots were rooted on the same medium (with kanamycin, absent hormones) and transferred to potting soii:perlite:vermtcu!ite (3:1:1), grown to maturity, and allowed to self. Seeds were harvested from this T0 generation, and subsequence generations produced by selling and continuing selection with kanamycin. The best growth performers were used to yield a T3 for crossing with the best performing GPT over-expressing tines identified as described in Example 3. A photograph of the GS1 transgenic plant compared to a wild type control plant is shown in FiG. 2 (together with GPT transgenic tobacco plant, see Example 3)
EXAMPLE 6: GENERATION OF TRANSGENIC TOMATO PLANTS CARRYING ALFALFA GS1 TRANSGENE:
Transgenic Lycopersicon esculentum (Micro-Tom Tomato) plants carrying the Alfalfa GS 1 transgene were generated using the vector described in Example 5 and a transformation protocol essentially as described (Sun et al., 2006. Plant Cell
Physiol 46(3) 426-31). T0 transgenic tomato plants were generated and grown to maturity. Initial growth characteristic data of the GPT transgenic tomato plants is presented in Table III. The transgenic plants showed significant enhancement of growth rate, flowering, and seed yield in relation to wild type control plants. In addition, the transgenic plants developed multiple main stems, whereas wild type plants developed with a single main stem. A photograph of a GS1 transgenic tomato plant compared to a wild type plant is presented in FIG. 3 (together with
GPT transgenic tomato plant, see Example 4). TABLE SIf
EXAMPLE 7: GENERATION OF DOUBLE TRANSGENIC TOBACCO PLANTS CARRYING GS1 AND GPT TRANSGENES:
In an effort to determine whether the combination of GS1 and GPT transgenes in a single transgenic plant might improve the extent to which growth and other agronomic characteristics may be enhanced, a number of sexual crosses between high producing fines of the ssngle transgene (GS1 or GPT) transgenic plants were carried out. The results obtained are dramatic, as these crosses repeatedly generated progeny plants having surprising and heretofore unknown increases in growth rates, biomass yield, and seed production.
Materials and Methods:
Single-transgene, transgenic tobacco plants overexpressing GPT or GS1 were generated as described m Examples 3 and 4, respectively. Several of fastest growing T? generation GPT transgenic plant lines were crossed with the fastest growing T3 generation GS1 transgenic plant lines using reciprocal crosses. The progeny were then selected on kanamycin containing M&S media as described in Example 3, and their growth, flowering and seed yields examined.
Tissue extractions for GPT and GS activities: GPT activity was extracted from fresh plant tissue after grinding in cold 100 mM Trts-HCl, pH 7.6, containing 1 mm ethylenediaminetetraacetic, 200 mM pyrldoxal phosphate and 6 mM mercaptoethanol in a ratio of 3 ml per gram of tissue. The extract was clarified by centrifυgation and used in the assay. GS activity was extracted from fresh plant tissue after grinding in cold 50 mM imidazole, pH 7.5 containing 10 mM MgCI2, and 12.5 mM mercaptoethanol in a ratio of 3 ml per gram of tissue. The extract was clarified by centrifugation and used in the assay. GPT activity was assayed as described in Calderon and Mora, 1985, Journal Bacteriology 161:807-809. GS activity was measured as described in Shapiro and Stadtmann, 1970, Methods in Enzymology 17 A: 910-922. Both assays involve an incubation with substrates and cofactor at the proper pH. Detection was by HPLC.
Results:
The resuits are presented in two ways. First, specific growth characteristics are tabulated in Tables IV.A and IV.B {biomass, seed yields, growth rate, GS activity,
GPT activity, 2-oxoglutaramate activity, etc). Second, photographs of progeny plants and their leaves are shown in comparison to singie-transgene and wild type plants and leaves are presented in FIG. 5 and FIG. 6, which show much larger whole plants, larger leaves, and earlier and/or more abundant flowering In comparison to the parental singie-transgene plants and wild type control plants.
Referring to Table IV.A, double-transgene progeny plants form these crosses showed tremendous increases total biomass (fresh weight), with fresh weights ranging from 45-89 grams per individual progeny plant, compared to a range of only 19-24 grams per individual wild type plant, representing on average, about a two- to three-fold increase over wild type plants, and representing at the high end, an astounding four-fold increase in biomass over wild type plants. Taking the 24 individual doubie-transgene progeny plants evaluated, the average individual plant biomass was about 2.75 times that of the average wild type control plant. Four of the progeny lines showed approximately 2.5 fold greater average per plant fresh weights, whiie two lines showed over three-fold greater fresh weights in comparison to wild type plants.
in comparison to the singie-transgene parental lines, the double-transgene progeny plants also showed far more than an additive growth enhancement. Whereas GPT singie-transgene iines show as much as about a 50% increase over wild type biomass, and GS1 singie-transgene iines as much as a 66% increase, progeny plants averaged almost a 200% increase over wild type plants. Similarly, the double transgene progeny plants flowered earlier and more prolificaity than either the wild type or singie transgene parental lines, and produced a far greater number of seed pods as well as total number of seeds per plant. Referring again to Table IV.A, on average, the double-transgene progeny produced over twice the number of seed pods produced by wild type plants, with two of the high producer plants generating over three times the number of seed pods compared to wild type. Total seed yield in progeny plants, measured on a pet plant weight basis, ranged from about double to nearly quadruple the number produced in wild type plants.
59
60 Table IV.B shows growth rate, biomass and yield, and biochemical characteristics of Line XX (Line 3 further selfed) compared to the single transgene line expressing GS1 and wild type control tobacco. All parameters are greatly increased in the double transgenic plant (Line XX). Notably, 2-oxoglutaramate activity was almost 17-fold higher, and seed yield and foliar biomass was three-fold higher, in Line XX plants versus control plants.
TABLE IV.B
NM Not Measured
EXAMPLE 8: GENERATION OF DOUBLE TRANSGENIC PEPPER PLANTS CARRYING GS1 AND GPT TRANSGENES:
In this example., Big Jim chili pepper plants (New Mexico varietal) were transformed with the Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control of the CMV 35S promoter, and the Arabidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuBIsCo promoter, using Agrobacterium-mediated transfer to seed pods. After 3 days, seeds were harvested and used to generate TO plants and screened for transformants. The resulting double-transgenic plants showed higher pod yields, faster growth rates, and greater biomass yields in comparison to the control plants.
61
SUB ( ) aterials and Methods: ofanaceae Capisicum Pepper plants ("Big Jim" varietal) were transformed with the abidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control of e CMV 35S promoter within the expression vector pMON (see Example 3), and the abidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuβisCo omoter within the expression vector pCambia 1201 (Tomato rubisco rbcS3C omoter: Kyozulka et al.. 1993, Plant Physiol. 103: 991-1000; SEQ ID NO: 22; ctor construct of SEQ ID NO: 6), using Agrobacterium-mediated transfer to seedods. or this and all subsequent examples, the Cambia 1201 or 1305.1 vectors were nstructed according to standard cloning methods (Sambrook et a!., 1989, supra,aiki et al., 1988, Science 239: 487-491 ). The vector is supplied with a 35S CaMV omoter; that promoter was replaced with RcbS-3C promoter from tomato to control e expression of the target gene. The Cambia 1201 vectors contain bacterial iorophenicoi and plant hygromycin resistance selectable marker genes. Theambia 1305.1 vectors contain bacteria! chlorophenicoi and hygromycin resistance lectable marker genes. he transgene expression vectors pMON (GPT transgene) and pCambia 1201 (GSansgene) were transferred to separate Agrotoacterium tutmfaciens strain LBA4404 ltures using a standard electroporation method (McCormac et al., 1998, Molecular otechnology 9:155-159). Transformed Agrobacterium were selected on media ntaining 50 μg/ml of either streptamycin for pMON constructs or chloroamphenicol r the Cambia constructs. Transformed Agrobacterium ceils were grown in LB lture media containing 25 μg/ml of antibiotic for 36 hours. At the end of the 36 hr owth period cells were collected by centrifυgation and cells from eachansformation were resuspended in 100 ml LB broth without antibiotic. epper plants were then transformed with a mixture of the resulting Agrobacterium l! suspensions using a transformation protocol in which the Agrobacterium is ected directly into the seed cavity of developing pods. Briefly, developing podsere injected with the 200 mi mixture in order to inoculate immature seeds with thegrobacteria essentially as described (Wang and Waterhouse, 1997, Plant MoI. BIoI.eporter 15: 209-215). in order to induce Agrobacteria virulence and improveansformation efficiencies, 10 μg/ml acetosyringonone was added to thegrobacteria cultures prior to pod inoculations (see, Sheikhoiesiam and Weeks,986, Plant MoI. Biol. 8: 291-298). sing a syringe, pods were injected with a liberal quantity of the Agrobacterium ctor mixture, and left to incubate for about 3 days. Seeds were then harvested anderminated, and developing plants observed for phenotypic characteristics including owth and antibiotic resistance. Plants carrying the transgenes were green, whereasntransformed plants showed signs of chlorosis in leaf tips. Vigorous growingansformants were grown and compared to wild type pepper plants grown underentical conditions. esults: he resυits are presented in FIG. 7 and Table V. FIG. 7 shows a photograph of aPT+GS double transgenic pepper plant compared to a control plant grown for the me time under identical conditions. This photograph shows tremendous peppereld in the transgenic line compared to the control plant. able V presents biomass yield and GS activity, as well as transgene genotyping, in e transgenic lines compared to the wild type control. Referring to Table V, double*ansgene progeny plants showed tremendous increases total biomass (fresheight), with fresh weights, ranging from 393 - 662 grams per individual transgenicant, compared to an average of 328 grams per wild type plant. Transgenic line A5 oduced more than twice the total biomass of the controls. Moreover, pepper yields the transgenic lines were greatly improved over wild type plants, and were 50% eater than control plants (on average). Notabiy, one of the transgene lines oduced twice as many peppers as the control plant average. ABLE V: TRANSGENIC PEPPER GROWTH/BIOMASS AND REPRODUCTION
Biomass, Yield GS activity Transgene
Plant type Foliar Fresh Peppers, g Umoles/min Presence Wt, g DWt /gFWt Assay
Wiidtype, avg 328.2 83.7 1.09 Negative
Line A2 457.3 184.2 1.57 GPT - Yes
Line A5 661.7 148.1 ■"' 18 GPT - Yes
Line BI 493,4 141.0 1.3 GPT - Yes
Line B4 393.1 136.0 1.6 GPT - Yes Line CΪ 509.4 152.9 1.55 GPT - YesWt Fresh Weight; DWt Dry Weight
XAMPLE 9: GENERATION OF DOUBLE TRANSGENIC BEAN PLANTS ARRYING ARABIDOPSiS GS1 AND GPT TRANSGENES:
this example, yellow wax bean plants {Phaseolus vulgaris) were transformed withe Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control the CMV 35S promoter within the expression vector pCambia 1201 , anά the abidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuBisCo omoter within the expression vector pCambia 1201 , using Agrobacterium-mediatedansfer into flowers. aterials and Methods: he transgene expression vectors pCambia 1201-GPT (vector construct of SEQ IDO: 27) anά pCambia 1201 -GS (vector construct of SEQ ID NO: 6) were transferred separate Agrobacterium tumefacieπs strain LBA4404 cultures using a standard ectroporation method (McCormac et al., 1998, Molecular Biotechnology 9:155-159). ansformed Agrobacterium were selected on media containing 50 μg/mt of foroampheniool. Transformed Agrobacterium cells were grown in LB culture media ntaining 25 μg/ml of antibiotic for 36 hours. At the end of the 36 hr growth period lls were collected by centrifugation and cells from each transformation were suspended in 100 ml LB broth without antibiotic. ean plants were then transformed with a mixture of the resulting Agrobacterium ceil spensions using a transformation protocol in which the Agrobacteria is injectedrectly into the flower structure (Yasseem, 2009, Plant MoI. Biol. Reporter 27: 20-8). In order to induce Agrobacteria virulence and improve transformation ficiencies, 10 μg/ml acetosyringonone was added to the Agrobacteria cultures prior flower inoculation. Briefly, once flowers bloomed, the outer structurencapsulating the reproductive organs was gently opened with forceps in order toermit the introduction of the Agrobacteria mixture, which was added to the flowerructure sufficient to flood the anthers. ants were grown until bean pods developed, and seeds were harvested and used generate transgenic plants. Transgenic plants were then grown together with ntrol bean plants under identical conditions, photographed and phenotypically aracterized. Growth rates were measured for both transgenic and control plants, this and all examples, Glutamine synthetase (GS) activity was assayed according the methods in Shapiro and Stadtmann, 1970, Methods in Enzymology 17A: 910-22; and, Glutamine phenyipyruvate transaminase (GPT) activity was assayed cording to the methods in Caideron et ai., 1985, J. Bacterioi. 161: 807-809. Seeetails in Example 7, Methods, supra, esults: he results are presented in FIG. 8, FIG. 9 and Table Vl. G- 8 shows GPT+GS transgenic bean line A growth rate data relative to control ants, including plant heights on various days into cultivation, as well as numbers of wer buds, flowers, and bean pods. These data show that the GPT+GS double ansgenic bean plants outgrew their counterpart control plants. The transgenic ants grew taller, flowered earlier and produced more flower buds and flowers, and eveloped bean pods and produced more bean pods that the wild type control plants.
TABLEVl: TRANSGENIC BEANS LfNE A
T Wiidtype; FWt Fresh Weight; NM Not Measured
abie Vl presents bean pod yield, GPT and GS activity, as weii as antibiotic sistance status, in the transgenic lines compared to the wiid type control (average several robust control plants; control plants that did not grow well were excluded om the analyses). Referring to Table Vl, double-transgene progeny plants showed bstantial bean pod biomass increases (fresh pod weight) in comparison to the ntrol plants, with bean pod biomass yields consistently above 200 grams per dividual transgenic plant, compared to an average of 127 grams per wild type plant, presenting an over 60% increase in pod yield in the double transgene iines relative control piant(s). astly, FIG. 9 shows a photograph of a GPT+GS double transgenic bean plant mpared to a control plant grown for the same time under identical conditions, owing increased growth in the transgenic plant. XAMPLE 10: GENERATION OF DOUBLE TRANSGENIC BEAN PLANTS ARRYING ARABIDOPSiS GS1 AND GRAPE GPT TRANSGENES;
this example, yellow wax bean plants (Phaseolus vulgaris) were transformed with e Grape GPT full length coding sequence of SEQ ID NO: 8 under the control of theuBisCo promoter within the expression vector pCambia 1305.1, and the abidopsls GS1 coding sequence of SEQ ID NO: 6 under the control of the RuβisCo omoter within the expression vector pCambia 1201 , using Agrobacterium-mediatedansfer into developing pods. aterials and Methods: he transgene expression vectors pCambia 12G1-GPT(grape) (vector construct ofEQ ID NO: 8) and pCambia 1201 -GS (vector construct of SEQ ID NO: 6) wereansferred to separate Agrobacterium tumefaciens strain LBA4404 cultures using aandard electroporation method (McCormac et al., 1998, Molecular Biotechnology 155-159). Transformed Agrobacterium were selected on media containing 50g/ml of chloramphenicol. Transformed Agrobacterium cells were grown in LB lture media containing 25 μg/ml of antibiotic for 36 hours. At the end of the 36 hr owth period cells were collected by centrifugation and cells from eachansformation were resuspended in 100 ml LB broth without antibiotic. ean plants were then transformed with a mixture of the resulting Agrobacterium cell spensions using a transformation protocol in which the Agrøbacteria is injectedrectly into the flower structure. In order to induce Agrobacteria virulence and prove transformation efficiencies, 10 μg/ml acetosyringonone was added to the grobacteria cultures prior to flower inoculation. Briefly, once flowers bloomed, the uter structure encapsulating the reproductive organs was gently opened with rceps in order to permit the introduction of the Agrobacteria mixture, which was dded to the flower structure sufficient to flood the anthers. ants were grown until bean pods developed, and seeds were harvested and used generate transgenic plants. Transgenic plants were then grown together with ntrol bean plants under identical conditions, photographed and phenotypicaliy aracterized. Growth rates were measured for both transgenic and control plants. esults: he results are presented in FIG. 10, FIG. 11 and Table VIL G. 10 shows GPT+GS transgenic bean line G growth rate data relative to control ants, specifically including numbers of flower buds, flowers, and bean pods. These ata show that the GPT+GS double transgenic bean plants outgrew their counterpart ntrol plants. Notably, the transgenic plants produced substantially more bean pods at the wild type control plants.
TABtE ViI: TRANSGENIC BEANS LINE G: POD YIELDS ant type Bean Pod Yield FWt, g Antibiotic Resistance ild type, avg 157.9 Negative 1 200.5 + 2 178.3 + T Wildtype; FWt Fresh Weight; NM Not Measured able VH presents bean pod yield and antibiotic resistance status, in the transgenic es compared to the wild type control (average of several robust control plants; ntrol plants that did not grow well were excluded from the analyses). Referring to able VIi1 double-transgene progeny plants showed substantial bean pod biomass creases (fresh pod weight) in comparison to the control plants, with bean podomass yields of 200.5 (line G1) and 178 grams (Sine G2) per individual transgenicant, compared to an average of 158 grams per individual wild type plant, presenting approximately a 27% increase in pod yield in the double transgene lines lative to control plants. astly. FIG. 11 shows a photograph of a GPT+GS double transgenic bean plant mpared to a control plant grown for the same time under identical conditions. Theansgenic plant shows substantially increased size and biomass, larger leaves and a ore mature flowering compared to the control plant. XAMPLE 11: GENERATiON OF DOUBLE TRANSGENIC COWPEA PLANTSARRYING ARABIDOPSiS GS1 AND GPT TRANSGENES:
this example, common Cowpea plants were transformed with the Arabidopsis GPT l length coding sequence of SEQ ID NO: 1 under the control of the CMV 35S omoter within the expression vector pMON, and the Arabidopsis GS1 coding quence of SEQ IO NO: 6 under the control of the RuBisCo promoter within the pression vector pCambia 1201, using Agrobacterium-mediated transfer into wers. Materials and methods were as in Example 9, supra. esults: he results are presented in FIGS. 12 and 13, and Table Vl. FIG. 12 shows relative owth rates for the GPT+GS transgenic Cowpea line A and wild type controlowpea at several intervals during cultivation, including (FIG. 12A) height andngest leaf measurements, (FIG. 128) trifolate leafs and flower buds, and (FIG. 12C) wers, flower buds and pea pods. These data show that the GPT+GS doubleansgenic Cowpea plants outgrew their counterpart control plants. The transgenic ants grew faster anό taller, had longer leaves, and set flowers and pods sooner an wild type control plants.
TABLE ViIi: TRANSGENIC COWPEA LINE A
Pea Pod GPT Activity GS Activity nmoles/h/gF umol/min/gF Antibiotic ant Type Yield, Wt Wt Resistance FWL g ildtype, avg 74.7 44.4 28.3 Negative A 112.8 NM 41.3 + B 113.8 736.2 54.9 + able VHi presents pea pod yield, GPT and GS activity, as weli as antibiotic sistance status, in the transgenic lines compared to the wiid type control (average several robust control plants; control plants that did not grow well were excluded om the analyses). Referring to Table VIII, double-transgene progeny plants showed bstantial pea pod biomass increases (fresh pod weight) in comparison to the ntrol plants, with average transgenic plant pea pod biomass yields nearly 52% eater than the yields measured in control plant(s). astly, FIG. 13 shows a photograph of a GPT+GS double transgenic bean plant mpared to a control plant grown for the same time under identical conditions, owing increased biomass and pod yield in the transgenic plant relative to the wild pe control plant.
XAMPLE 12: GENERATION OF DOUBLE TRANSGENIC COWPEA PLANTS ARRYING ARABiDOPSIS GS1 AND GRAPE GPT TRANSGENES:
this example, common Cowpea plants were transformed with the Grape GPT full ngth coding sequence of SEQ ID NO: 8 under the control of the RuBisCo promoter thin the expression vector pCambia 1305.1 (vector construct of SEQ ID NO: 8), nd the Arabidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of theuBisCo promoter within the expression vector pCambia 1201 (vector construct ofEQ ID NO: 6), using Agrobacterium-mediated transfer into flowers. Materials and ethods were as in Example 11 , supra. esults: he results are presented in FIGS. 14 and 15, and Table IX. G. 14 shows relative growth rates for the GPT+GS transgenic Cowpea iine G and id type control Cowpea. These data show that the transgenic plants are nsistently higher (FIG. 14A), produce substantially more flowers, flower buds andea pods (FIG. 14B), and develop trifolates and leaf buds faster (FiG. 14C).
TABLE iX: TRANSGENIC COWPEA LfNE G
GPT Activity GS Activity Ana*,,,- ant Type nmoles/h/gF umol/min/gF ^ WT Wt ildtype, ayg ! 59.7 ! 44.4 26.7 N£9MYe ,. θ "" ■ ■ ——"— T WΪΪdtype; ™ able IX presents pea pod yield, GPT and GS activity, as weii as antibiotic resistanceatus, in the transgenic lines compared to the wild type control (average of several bust control plants; control plants that did not grow well were excluded from thenalyses). Referring to Table IX1 doubie-transgenβ progeny plants showed bstantial pea pod biomass increases (fresh pod weight) in comparison to the ntrol plants, with average pea pod biomass yields 70% greater in the transgenicants compared to control piant(s). astly, FIG. 15 shows a photograph of a GPT+GS double transgenic pea plant mpared to a control plant grown for the same time under identical conditions, owing increased height, biomass and leaf size in the transgenic plant relative to e wild type control plant.
XAMPLE 13: GENERATiON OF DOUBLE TRANSGENIC ALFALFA PLANTSARRYING ARABIDOPSIS GS1 AND GPT TRANSGENES:
this example, Alfalfa plants (Medicago sativa, var Ladak) were transformed with e Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control the CMV 358 promoter within the expression vector pMON316 (see Example 3,upra), and the Arabidopsis GS 1 coding sequence of SEQ ID NO: 6 under the control the RuBisCo promoter within the expression vector pCambia 1201 (vector nstruct of SEQ ID NO: 6), using Agrobacterium-mediated transfer into seedlingants. Agrobacteriυm vectors and mixtures were prepared for seedling inoculations described in Example 11, supra. eedling inoculations: hen Alfalfa seedlings were stili less than about 1/2 inch tail, they were soaked inaper toweling that had been flooded with the Agrobacteria mixture containing bothansgene constructs. The seedlings were left in the paper toweling for two to threeays, removed anά then planted in potting soil. Resulting TO and control plants were en grown for the first 30 days in a growth chamber, thereafter cultivated in a eenhouse, and then harvested 42 days after sprouting. At this point, only theansgenic Aifalfa line displayed dowers, as the wild type plants only displayed mature flower buds. The plants were characterized as to flowering status and total omass. esults: he results are presented in Tabie X> The data shows that the transgenic Alfalfa ants grew faster, flowered sooner, and yielded on average about a 62% biomass crease relative to the control plants.
TABLE X: TRANSGENIC ALFALFA VS. CONTROL ant Type Biomass at Sacrifice, g Flowering Stage
Small defined buds ildtype, avg 6.03 No buds swelling. No flowers ansgene #5 10.38 4 Open flowers ansgene # ϊ ϊ 9.03 Flower buds swelling ansgene #13 9.95 Fiower buds swelling
XAMPLE 14: GENERATION OF DOUBLE TRANSGENIC CANTALOUPE LANTS CARRYING ARABiDOPSIS GS1 AND GPT TRANSGENES:
this example, Cantaloupe plants (Cυcumis melo var common) were transformed th the Arabidopsis GPT till length coding sequence of SEQ IO NO: 1 under the ntrol of the CMV 35S promoter within the expression vector pMON316 {see xample 3, supra), and the Arabidopsis GS1 coding sequence of SEQ ID NO: 6 nder the control of the RuBIsCo promoter within the expression vector pCambia 201 (vector construct of SEQ ID NO: 6), using Agrobacterium-mediated transfer via ection Into developing melons. Agrobacterlum vectors and mixtures were prepared r tntra-meion inoculations as described in Example 3, supra, inoculations into eveloping melons were carried out essentially as described in Example 8. The ants were characterized as to flowering status and total biomass relative to control elon plants grown under identical conditions. he results are presented in FIG. 16 &nό Table Xi. Referring to Table Xl, the ansgenic plants showed substantia! foliar piant biomass increases in comparison to e control plants, with an average increase in biomass of 63%. Moreover, a emendous increase in flower and flower bud yields was observed in ail five ansgenic lines. Control plants displayed no flowers and only 5 buds at sacrifice, on erage. In sharp contrast, the transgenic plants displayed between 2 and 5 flowers er plant, and between 21 and 30 flower buds, per piant, indicating a substantially gher growth rate and flower yield. Increased flower yield would be expected to anslate into correspondingly higher melon yields in the transgenic plants. Referring FIG. 16 (a photograph comparing transgenic Cantaloupe plants to control antaloupe plants), the transgenic Cantaloupe plants show dramaticaiiy increased eight, overall biomass and flowering status relative to the control plants.
TABLE Xl: TRANGENiC CANTALOUPE VERSUS CONTROL
Biomass Flowers / Flower Antibiotic ant Type Foliar FWt, g Buds at Sacrifice Resistance iidtype, avg 22.8 075 Negative ne 1 37.0 3/21 + ne 2 35.0 2/30 ne 3 37.1 3/27 ne 4 40.6 5/26 ne 5 35.7 4/30 + Wt Fresh Weight
XAMPLE 15: GENERATION OF DOUBLE TRANSGENIC PUMPKIN PLANTS ARRYING ARABIOOPSiS GS1 AND GPT TRANSGENES:
tiiis example, common Pumpkin plants {Qucurbita maxima) were transformed with e Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the control the CMV 3SS promoter within the expression vector pMON316 (see Example 3, upra), and the Arabidopsis GS 1 coding sequence of SEQ ID NO: 6 under the control the RuBisCo promoter within the expression vector pCambia 1201 (vector nstruct of SEQ ID NO: 6), using Agrobacterium-mediated transfer via injection into eveloping pumpkins, essentially as described in Example 14, supra. The transgenic nd control pumpkin plants were grown under identical conditions until the mergence of flower buds in the control plants, then ali plants were characterized as flowering status and total biomass. he results are presented in FIG. 17 and Table XII. Referring to Table XH, the ansgenic plants showed substantia! foliar plant biomass increases in comparison to e control plants, with an increase in average biomass yield of 67% over control ants. Moreover, an increase in flower bud yields was observed in four of the five ansgenic lines in comparison to control. Control plants displayed only 4 buds at crifice (average). In contrast, four transgenic piant lines displayed between 8 and 5 flowers buds per plant, representing a two- to nearly four-fold yield increase.
TABLE XiI: TRANGENIC PUMPKIN VERSUS CONTROL
Wt Fresh Weight; eferring to FIG. 17 (a photograph comparing transgenic pumpkin plants to control ants), the transgenic pumpkin plants show substantially increased plant size, erall biomass and leaf sizes and numbers relative to the control plants. XAMPLE 16: GENERATION OF DOUBLE TRANSGENIC ARABIDOPSIS LANTS CARRYING ARABIDOPSIS GS1 AND GPT TRANSGENES: this example, Arabidopsis thatiana plants were transformed with the truncated abidopsis GPT coding sequence of SEQ ID NO: 18 under the control of the CMV5S promoter within the expression vector pMON316 (see Example 3, supra), andansgenic plants thereafter transformed with the Arabidopsis GS1 coding sequence SEQ ID NO: 6 under the control of the RuBisCo promoter within the expression ctor pCambia 1201 (vector construct of SEQ ID NO: 6), using Agrobacteriυm- ediated "floral dip" transfer as described (Harrison et al., 2006, Plant Methods 2:19-3; Clough and Bent, 1998, Plant J. 16:735-743). Agrobacterium vectors pMON316 rrying GPT and pCambia 1201 carrying GS1 were prepared as described inxamples 3 and 11. respectively. ansformation of two different cultures of Agrobacterium with either a pMon 316 + abidopsis GTP construct or with a Cambia 1201 + Arabidopsis GS construct wasone by electroporation using the method of Weigel and Glazebrook 2002. Theansformed Agrobacterium were then grown under antibiotic selection, collected by ntrifugation resuspended in LB broth with antibiotic and used in the floral dip of abidopsis inflorescence. Floral dipped Arabidopsis plants were taken to maturitynd self-fertilized and seeds were collected. Seeds from twice dipped plants were st geminated on a media containing 20ug/mi of kanamycin and by following regular lection procedures surviving seedlings were transferred to media containing 20 ug hygromycin. Plants (3) surviving the selection process on both antibiotics were lf-fertilized and seeds were collected. Seeds from the T1 generation wereerminated on MS media containing 20 ug/mi of hygromycin and surviving seedlingsere taken to maturity, self-fertilized and seeds collected. This seed population the2 generation was then used for subsequent growth studies. he results are presented in FlG. 18 and Table XlIi. Referring to Table XiII, which ows data from 6 wild type and δ transgenic Arabidopsis plants (averaged), the ansgenic plants displayed increased levels of both GPT and GS activity. GPT tivity was over twenty-fold higher than the control plants. Moreover, tine transgenicant fresh foliar weight average was well over four-fold that of the wild type controlant average. A photograph of young traπsgene Arabidopsls plants in comparison wild type control Arabidopsis plants grown under identical conditions is shown in G. 18, and reveals a consistent and very significant increase in transgenic plants lative to the control plants.
TABLE XIII: TRANSGENIC ARABIDOPSIS VERSUS CONTROL βiomass, g ant type GPT Activity ^SIΑ Antibiotic Fresh foliar wt nmol/h/gFWt ^^t^ Resistance
Wt
18.4 7.0 395.6 18.2 Positive
XAMPLE 17: GENERATION OF TRANSGENIC TOMATO PLANTS CARRYINGRABIDOPSIS GPT AND GS1 TRANSG EN ES:
this example, tomato plants (Solarium tycopersicon, "money Maker" variety) wereansformed with the Arabidopsis GPT full length coding sequence of SEQ ID NO: 1nder the control of the CMV 35S promoter within the expression vector pMON316 ee Example 3, supra), and the Arabidopsis GS1 coding sequence of SEQ ID NO: 6nder the control of the RuBisCo promoter within the expression vector pCambla201 (vector construct of SEQ ID NO: 6). Single transgene (GPT) transgenic tomatoants were generated and grown to flowering essentially as described in Example 4.he Arabidopsis GS 1 transgene was then introduced into the single-transgene TOants using Agrobacterium-mediated transfer via injection directly into flowers (asescribed in Example 8). The transgenic and control tomato plants were grownnder identical conditions and characterized as to growth phenotype characteristics.esulting TO double-transgene plants were then grown to maturity, photographedong with control tomato plants, and phenotypicaiiy characterized. he results are presented in FIG. 19 and in Table IXX. Referring to Table IXX, oυbie-transgene tomato plants showed substantial foliar plant biomass increases in mparison to the control plants, with an increase in average biomass yield of 45% er control. Moreover, as much as a 70% increase in tomato fruit yield was bserved in the transgenic lines compared to control plants (e.g., 51 tomatoes arvested from Line 4C1 versus and average of approximately 30 tomatoes from ntrol plants). A much higher level of GPT activity was observed in the transgenic ants (e.g., line 4C displaying an approximately 32-fold higher GPT activity in mparison to the average GPT activity measured in control plants), GS activity was so higher in the transgenic plants relative to control plants (almost double in Line C). ith respect to growth phenotype, and referring to FiG. 19, the transgenic tomato ants displayed substantially larger leaves compared to control plants (FIG 19A). In ddition, it can be seen that the transgenic tomato plants were substantially larger, ler and of a greater overall biomass (see FiG. 19B).
TABLE IXX: TfIANSQENIC TOMATO GROWTH AND REPRODUCTION
Total GPT GS Activity
Biomass Tomatoes Activity umoies/mi Transgene ant Type Foliar FWt, Harvested nmoles/h n Presence
3 until /gFWt /gFWt Assay Sacrifice ildtype, 891 30.2 287 14.27 Negative g ne 6C 1288 43 9181 18.3 + ne 4C 26.4
1146 51 1718 + XAMPLE 18: GENERATION OF TRANSGENIC CAMItENA PLANTS CARRYING RABIDOPSIS GPT AND GS1 TRANSGENES:
this example, Cameliπa plants {Camelina sativa, Var MT 303) were transformed th the Arabidopsis GPT full length coding sequence of SEQ ID NO: 1 under the ntrol of the RuBisCo promoter within the expression vector pCambia 1201, and the abidopsis GS1 coding sequence of SEQ ID NO: 6 under the control of the RuBisCo omoter within the expression vector pCambia 1201 , using Agrobacterium-mediated ansfer into germinating seeds according to the method described in Chee et a!., 989, Plant Physiol. 91: 1212-1218. Agrobacteriυm vectors and mixtures were epared for seed inoculations as described in Example 11 , supra. ansgenic and control Camelina plants were grown under identical conditions (30 ays in a growth chamber and then moved to greenhouse cultivation) for 39 days, nd characterized as to biomass, growth characteristics and flowering stage. he results are presented in Table XX and FIG. 20. Referring to Table XX, it can be en that total biomass in the transgenic plants was, on average, almost double ntrol plant biomass. Canopy diameter was also significantly improved in the ansgenic plants. FiG. 20 shows a photograph of transgenic Camelina compared to ntrol. The transgenic plant is noticeably larger and displays more advanced wering status.
TABLE XX: TRANSGENIC CAMELINA VERSUS CONTROL
Height / Canopy Biomass j ant Type Flowering Stage Diameter, Inches g L ildtype, avg 14 / 4 8.35 ! Partial flowering ansgene C-1 15.5 / 5 Ϊ6.54 ! Full flowering ansgene C-3 14 / 7 14.80 ! initial flowering XAMPLE 19: ACTiVtTY OF BARLEY GPT TRANSGENE IN PLANTA
this example, the putative coding sequence for Barley GPT was isolated and pressed from a transgene construct using an in planta transient expression assay. ologically active recombinant Barley GPT was produced, and catalyzed thecreased synthesis of 2- oxoglυtaramate, as confirmed by HPLC. he Bariey (Hordβum vulgare) GPT coding sequence was determined and nthesized. The DNA sequence of the Barley GPT coding sequence used in this ample is provided in SEQ ID NO: 14, and the encoded GPT protein amino acid quence is presented in SEQ ID NO: 15. he coding sequence for Barley GPT was inserted into the 1305.1 cambia vector,nd transferred to Agrobacteriυm tumefacmns strain LBA404 using a standardectroporation method (McCormac et at., 1998, Molecular Biotechnology 9:155-159), lowed by plating on LB plates containing hygromycin (50 micro gm / ml). Antibiotic sistant colonies of Agrobacterium were selected for analysis. he transient tobacco leaf expression assay consisted of injecting a suspension ofansformed Agrobacterium (1.5-2.0 OD 650) into rapidly growing tobacco leaves. tradermal injections were made in a grid across the leaf surface to assure that agnificant amount of the leaf surface would be exposed to the Agrobacterium. Theant was then allowed to grow for 3-5 days when the tissue was extracted asescribed for all other tissue extractions and the GPT activity measured. PT activity in the inoculated leaf tissue (1217 nanomoles/gFVWh) was three-fold thevel measured in the control plant leaf tissue (407 nanomoles/gFWt/h), indicating at the Hordeυm GPT construct can direct the expression of functional GPT in aansgenic plant. XAMPLE 20: ISOtATiON AND EXPRESSION OF RECOMBINANT RICE GPTENE CODING SEQUENCE AND ANALYSIS OF BIOLOGICAL ACTIVITY this example, the putative coding sequence for rice GPT was isolated and pressed in E. coli. Biologically active recombinant rice GPT was produced, and talyzed the increased synthesis of 2- oxogiutaramate, as confirmed by HPLC. aterials and Methods: ce GPT coding sequence and expression in E. colt he rice {Oryza sativia) GPT coding sequence was determined and synthesized,serted into a PET28 vector, and expressed in E. coli. Briefly, E. coli ceils wereansformed with the expression vector and transformants grown overnight in LB oth diluted and grown to OD 0.4, expression induced with isopropyl-B-D- ogalactoside (0.4 micromoiar), grown for 3 hr and harvested. A total of 25 X 106 lls were then assayed for biological activity using the NMR assay, below.n transformed, wild type E. coli ceils were assayed as a control. An additional ntrol used E coli ceils transformed with an empty vector. he DNA sequence of the rice GPT coding sequence used in this example is ovided in SEQ ID NO: 10, and the encoded GPT protein amino acid sequence is esented in SEQ ID NO: 11. PLC Assay for 2-oxoQlutaramate: PLC was used to determine 2-oxoglutaramate production in GPT-overexpressing E li cells, following a modification of CaWeron et ai., 1985, J Bacteriol 161(2): 807-09. Briefly, a modified extraction buffer consisting of 25 mM Tris-HCi pH 8.5, 1 mMDTA, 20 μM Pyridoxal phosphate, 10 mM Cysteine, and -1.5% (v/v) ercaptoethanoi was used. Samples (iysate from E. coli ceils, 25 X 106 cells) weredded to the extraction buffer at approximately a 1/3 ratio (w/v), incubated for 30 nutes at 37°C, and stopped with 20Ou! of 20% TCA. After about 5 minutes, the say mixture is centrifuged and the supernatant used to quantify 2-oxoglutaramate HPLC, using an ION-300 7.8mm ID X 30 cm L column, with a mobile phase in 01 N h2SO4, a flow rate of approximately 0.2 ml/min, at 40cC. Injection volume ispproximately 20 μi, and retention time between about 38 and 39 minutes. Detection achieved with 21 Onm UV ilght. MR analysis comparison with authentic 2-oxogiutaramate was used to establish at the Arabidopisis fuli length sequence expresses a GPT with 2-oxoglutaramate nthesis activity. Briefly, authentic 2-oxoglutarmate (structure confirmed with NMR) ade by chemical synthesis to validate the HPLC assay, above, by confirming that e product of the assay (molecule synthesized in response to the expressed GPT)nd the authentic 2-oxoglutaramate elute at the same retention time. In addition,hen mixed together the assay product and the authentic compound elute as angle peak. Furthermore, the validation of the HPLC assay atso included monitoring e disappearance of the substrate giutamine and showing that there was a 1 :1 molaroechiometry between giutamine consumed to 2-oxoglutaramte produced. The say procedure always included two controls, one without the enzyme added andne without the giutamine added. The first shows that the production of the 2- oglutaramate was dependent upon having the enzyme present, and the second ows that the production of the 2-oxogiutaramate was dependent upon the bstrate giutamine. esults: xpression of the rice GPT coding sequence of SEQ ID NO: 10 resulted in the over- pression of recombinant GPT protein having 2-oxoglutaramate synthesis- taiyzing bioactivity> Specifically, 1.72 rtaπomoies of 2-oxoglutaramate activity wasbserved in the £. coli cells overexpressing the recombinant rice GPT, compared tonly 0.02 nanomoles of 2-oxogiutaramate activity in control E. cod cells, an 86-foid tivity level increase over control. XAMPLE 21: ISOtATiON AND EXPRESSION OF RECOMBINANT SOYBEANPT GENE CODING SEQUENCE AND ANALYSIS OF BIOLOGICAL ACTIVITY this example, the putative coding sequence for soybean GPT was isolated and pressed in E. colL Biologically active recombinant soybean GPT was produced,nd catalyzed the increased synthesis of 2- oxoglutaramate, as confirmed by HPLC. aterials and Methods: oybean GPT coding sequence and expression in E. coli: he soybean (Glycine max) GPT coding sequence was determined and synthesized,serted into a PET28 vector, and expressed in E. coti. Briefly, E. coli cells wereansformed with the expression vector and transformants grown overnight in LB oth diluted and grown to OD 0.4, expression induced with isopropyl-B-D- ogalactoside (0.4 micromolar), grown for 3 hr and harvested. A totai of 25 X 106 lls were then assayed for biological activity using the NMR assay, below.ntransformed, wild type E. coli cells were assayed as a control. An additional ntrol used E coll cells transformed with an empty vector. he DNA sequence of the soybean GPT coding sequence used in this example is ovided in SEQ ID NO: 12, and the encoded GPT protein amino acid sequence is esented in SEQ ID NO: 13. PLC Assay for 2-oxoαlutaramate: PLC was used to determine 2-oxoglutaramate production in GPT-overexpressing E. // cells, as described in Example 20, sυpra. esults: xpression of the soybean GPT coding sequence of SEQ ID NO: 12 resulted in the er-expression of recombinant GPT protein having 2-oxoglutaramate synthesis- talyzing bioactivity. Specifically, 31.9 nanomoies of 2-oxoglutaramate activity wasbserved in the E coii ceiis overexpressing the recombinant soybean GPT, mpared to only 0.02 nanomoies of 2-oxoglutaramate activity in control £. coii cells, neatly 1, 600-fold activity level increase over control.
XAMPLE 22: ISOLATION AND EXPRESSION OF RECOMBINANT ZEBRA FISHPT GENE CODING SEQUENCE AND ANALYSIS OF BIOLOGICAL ACTIVITY this example, the putative coding sequence for Zebra fish GPT was isolated and pressed in E. colt. Biologically active recombinant Zebra fish GPT was produced,nd catalyzed the increased synthesis of 2- oxoglutaramate, as confirmed by NMR. aterials and Methods: ebra fish GPT coding sequence and expression in £. colt he Zebra fish (Danio rerh) GPT coding sequence was determined and synthesized,serted into a PET28 vector, and expressed in E. coli. Briefly, E. coii celis wereansformed with the expression vector and transformants grown overnight in LB oth diluted and grown to OD 0.4, expression induced with isopropyl-B-D- ogalactoside (0.4 micromoiar), grown for 3 hr and harvested. A totai of 25 X 106 iis were then assayed for biological activity using the NMR assay, below.ntransformed, wild type E coii ceils were assayed as a control. An additional ntrol used E coli ceils transformed with an empty vector. he DNA sequence of the Zebra fish GPT coding sequence used in this example is ovided in SEQ ID NO: 16, and the encoded GPT protein amino acid sequence is esented in SEQ ID NO: 17. PLC Assay for 2-oxoqlutaramate: PLC was used to determine 2-oxoglutaramate production in GPT-overexpressing E. // cells, as described in Example 20, supra. esults: xpression of the Zebra fish GPT coding sequence of SEQ IO NO: 16 resulted in the er-expression of recombinant GPT protein having 2-oxoglutaramate synthesis- talyzing bioactivity. Specifically, 28.6 nanomoies of 2-oxoglutaramate activity wasbserved in the E. coli cells overexpressing the recombinant Zebra fish QPT, mpared to only 0.02 nanomoies of 2-oxoglutaramate activity in control E coli celts, more than 1,400-foid activity level increase over control. XAMPLE 23: GENERATION AND EXPRESSION OF RECOMBINANT RUNCATED ARABIDOPStS GPT GENE CODING SEQUENCES AND ANALYSISF BIOLOGICAL ACTIVITY this example, two different truncations of the Arabidopsis GPT coding sequenceere designed and expressed in E. coil, in order to evaluate the activity of GPT oteins in which the putative chloroplast signal peptide is absent or truncated.ecombinant truncated GPT proteins corresponding to the full length ArabidopsisPT amino add sequence SEQ ID NO: 1, truncated to delete either the first 30mino-terminal amino acid residues, or the first 45 amino-terminai amino acid sidues, were successfully expressed and showed biological activity in catalyzing e increased synthesis of 2- oxoglutaramate, as confirmed by NMR. aterials and Methods: uncated Arabidoosis GPT coding sequences and expression in E. coli: he DNA coding sequence of a truncation of the Arabidopsis thaliana GPT coding quence of SEQ ID NO: 1 was designed, synthesized, inserted into a PET28 vector, nd expressed in E. cofi. The DNA sequence of the truncated Arabidopsis GPT ding sequence used in this example is provided in SEQ ID NO: 20 (-45 AA nstruct), and the corresponding truncated GPT protein amino acid sequence is ovided in SEQ ID NO: 21. Briefly, E. coli ceiis were transformed with the pression vector and transformants grown overnight in LB broth diluted and grown OD 0.4, expression induced with isopropyi-B-D-thiogatactoside (0.4 micromolar), own for 3 hr and harvested. A total of 25 X 106 cells were then assayed forological activity using HPLC as described in Example 20. Untransfbrmed, wild type coli ceiis were assayed as a control. An additional control used E coli ceilsansformed with an empty vector. xpression of the truncated -45 Arabidopsis GPT coding sequence of SEQ ID NO: 20 sulted in the over-expression of biologically active recombinant GPT protein (2- ogiutaramate synthesis-catalyzing bioactivity), Specifically, 16.1 nanomoles of 2- ogiutaramate activity was observed in the E. coli cells overexpressing theuncated -45 GPT5 compared to only 0.02 nanomoles of 2-oxoglutaramate activity in ntrol E. coll cells, a more than 800-fold activity level increase over control. For mparison, the full length Arabidopsis gene coding sequence expressed in the me E coli assay generated 2.8 nanomoles of 2-oxoglutaramate activity, or roughlyss than one-fifth the activity observed from the truncated recombinant GPT protein.
XAMPLE 24: 6PT + GS TRANSGENIC TOBACCO SEED GERMINATIONOLERATES HIGH SALT CONCENTRATIONS
this example, seeds form the double transgene tobacco line XX-3 (Cross 3 inable 4, see Example 7) were tested in a seed germination assay designed to aluate tolerance to high salt concentrations. aterials and Methods: obacco seeds from the wild type and XX-3 populations were surfaced sterilized (5% each solution for 5 minutes followed by a 10% ethanol wash for 3 minutes) and nsed with sterile distiiled water. The surface sterilized seeds were then spread on urashige and Skoog media (10% agarose) without sucrose and containing either 0 200 mM NaCl. The seeds were allowed to germinate in darkness for 2 days lowed by 6 days under a 16:8 photoperiod at 24C. On day eight the rate of ermination was determined by measuring the percentage of seeds from the control transgene plants that had germinated. esults: he results are tabulated in Table XXI below, The rate of germination of the ansgenic plant line seeds under zero salt conditions was the same as observed with ld type control plant seeds, in stark contrast, the germination rate of the transgenic ant line seeds under very high salt conditions far exceeded the rate seen in wild pe control seeds. Whereas over 81% of the transgenic plant seeds had germinated nder the high salt conditions, only about 9% of the wild type control plant seeds had erminated by the same time point. These data indicate that the transgenic seeds e capable of germinating very well under high salt concentrations, an important trait r plant growth in areas of increasingly high water and/or soil salinity.
TABLE XXi:
TRANSGENIC TOBACCO PLANTS GERMINATE AND TOLERATE HiGH SALT
! publications, patents, and patent applications cited in this specification are hereincorporated by reference as if each individuai publication or patent application were ecifically and individually indicated to be incorporated by reference. he present invention is not to be limited in scope by the embodiments disclosederein, which are intended as singie illustrations of individual aspects of thevention, and any which are functionally equivalent are within the scope of thevention. Various modifications to the models and methods of the invention, inddition to those described herein, will become apparent to those skilled in the artom the foregoing description and teachings, and are similarly intended to fail within e scope of the invention. Such modifications or other embodiments can be acticed without departing from the true scope and spirit of the invention.
TABLE OF SEQUENCES: EQ ID NO: 1 Arabidopsis giυtamine phenylpyrυvate transaminase DNA coding quence: TGTACCTGGACATAAATGGTGTGATGATCAAACAGTTTAGCTTCAAAGCCTCTCTCTCCCATTCTCTTCTAATTTCCGACAAAGCTCCGCCAAAATCCATCGTCCTATGGAGCCACCATGACCACAGTTTCGACTCAGAACGAGTCTACTCAAAAACCCGTCAGGTGGCGAAGAGATTAGAGAAGTTCAAGACTACTATTTTCACTCAAATGAGATATTGGCAGTTAAACATGGAGCGATCAATTTAGGCCAAGGCTTTCCCAATTTCACGGTCCTGATTTTGTTAAAGAAGCTGCGATCCAAGCTATTAAAGATGGTAAAACCAGTATGCTCGTGGATACGGCATTCCTCAGCTCAACTCTGCTATAGCTGCGCGTTTCGTGAAGATACGGGTCTTGTTGTTGATCCTGAGAAAGAAGTTACTGTTACTCTGGTTGCACAGAAGCCATAGCTGCAGCTATGTTGGGTTTAATAAACCCTGGGATGAAGTCATTCTCTTTGCACCGTTTTATGATTCCTATGAAGCAACACTCTCTAGGCTGGTGCTAAAGTAAAAGGAATCACTTTACGTCCACCGGACTTCTCCATCCTTTGGAAGAGCTTAAAGCTGCGGTAACTAACAAGACTCGAGCCATCCTTATGACACTCCGCACAACCCGACCGGGAAGATGTTCACTAGGGAGGAGCTTGAAACCTTGCATCTCTCTGCATTGAAAACGATGTGCTTGTGTTCTCGGATGAAGTATACGTAAGCTTGCGTTTGAAATGGATCACATTTCTATAGCTTCTCTTCCCGGTATGTAGAAAGAACTGTGACCATGAATTCCCTGGGAAAGACTTTCTCTTTAACCGGATGAAGATCGGCTGGGCGATTGCGCCGCCTCATCTGACTTGGGGAGTTCGACAAGACACTCTTACCTCACATTCGCCACATCAACACCAGCACAATGGGCAGCCGTTGAGCTCTCAAGGCACCAGAGTCTTACTTCAAAGAGCTGAAAAGAGATTACAATGGAAAAAGGAGACTCTGGTTAAGGGTTTGAAGGAAGTCGGATTTACAGTGTTCCATCGAGCGGGACTTACTTTGTGGTTGCTGATCACACTCCATTTGGAATGGAGACGATGTTGCTTTCTGTGAGTATCTTATTGAAGAAGTTGGGGTCGTTGCGATCCAACGAGCGTCTTTTATCTGAATCCAGAAGAAGGGAAGAATTTGGTTAGGTTTGGTTCTGTAAAGACGAAGAGACGTTGCGTGGTGCAATTGAGAGGATGAAGCAGAGCTTAAGAGAAAAGTCTGA EQ ID NO: 2 Arabidopsis GPT amino add sequence YLDiNGVMIKQFSFKASLLPFSSNFRQSSAKiHRPIGATMTTVSTQNESTQKPVQVKRLEKFKTTIFTQMSILAVKHGAINLGQGFPNFDGPDFVKEAAIQAIKDGKNQYARGGIPQLNSAIAARFREDTGLWDPEKEVTVTSGCTEAiAAAMLGLINPGDEVILFAPFYSYEATLSMAGAKVKGITLRPPDFSIPLEELKAAVTNKTRAILMNTPHNPTGKMFTRELETIASLCIENDVLVFSDEVYDKLAFEMDHISIASLPGMYERTVTMNSLGKTFSLTG KIGWAiAPPHLTWGVRQAHSYLTFATSTPAQWAAVAALKAPESYFKELKRDYNVKETLVKGLKEVGFTVFPSSGTYFWADHTPFGMENDVAFCEYLIEEVGWAIPTSVFLNPEEGKNLVRFAFCKDEETLRGAIERMKQKLKRKV EQ ID NO: 3 Alfalfa GS1 DNA coding sequence (upper case) with 5' and 3'ntranslated sequences (indicated in lower case). ttccgttttcgttttcatttgattcattgaatcaaatcgaatcgaatctttaggattcaatacag tccttagattttactaagtttgaaaccaaaaccaaaacATGTCTCTCCTTTCAGATTTATCAACCTTGACCTCTCCGAAACCACCGAGAAAATCATCGCCGATACATATGGATTGGTGGATCTGGTTTGGACTTGAGGAGCAAAGCAGGACTCTACCAGGACCAGTTACTGACCCTTCACAGCTTCCCAAGGGAACTATGATG GTTCCAGCACAGGTCAAGCTCCTGGAGAAGATGTGAAGTTATTATCTACCCACAAGCCATTTTCAAGGACCCATTTA AAG GGGTAACAATATCTTGGTTATGTGTGATGCATACACTCCAGCGGAGAGCCCATTCCCACCAACAAGAGACATGCAGCTGCCAAGATTTCAGCCATCCTGATGTTGTTGCTGAAGTACCATGGTATGGTATT AGCAAGAATACACCTTGTTGCAGAAAGACATCAATTGGCCTCTTG TTGGCCAGTTGGTGGTTTTCCTG GACCTCAGG GACCATACTATTGGGAGCTGGTGCTGACAAGGCATTTGGCCGTGACATTGTTGACTCCATTACAAAGCCTGTCTTTATGCCGGCATCAACATCAGTGGAATCATGGTGAAGTGATGCCTGGTCAATGGGAATTCCAAGTTGGTCCCT AGTTGGTATCTCTGCTGGTGATGAGATATGGGTTGCTCGTTACATTTGGAGAGGATCACTGAGGTTGCTGGTGTGGTGCTTTCCTTTGAC CAAAACCAATTAAGGGTGATTGGAATGGTGCTGGTGCTCACACAATTACAGCACCAAGTCTATGAGAGAAGATGGTGGCTATGAAGTCAT TTGAAAGCAATTGAGAAGCTTGGGAAGAAGCACAAG GAGCACATGCTGCTTATGGAGAAGGCAACGAGCGTAGATTGACAGGGCGACAGAGACAGCTGACATTAACACCTTCTTATGGGGTGTTGCAAACCGT GTGCGTCGATTAGAGTTGGAAGGGACACAGAGAAAGCAGGGAAA GTTATTTCGAGGATAGGAGGCCATCATCTAACATGGATCCATATGTGTTACTTCCATGATTGCAGACACCACCATTCTCTGGAAACCATAgccaccacacacacatgcattgaagtatttgaaagtcattgttgattccgcattagaatttgg attgttttttctaggatttggatttgtgttattgttatggttcacactttgtttgtttgaatttgagg c tgttataggtttcatatttctttctcttgttctaagtaaatgtcagaataataatgtaat EQ ID NO: 4 Alfalfa GS1 amino acid sequence SLLSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSTGQAPGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHDWAEVPWYGIEQEYTLLQKDINWPLGWPVGGFPGPQGPYYCGAGADKAFGRDIDSHYKACLYAGiNISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYILERITEVAWLSFDPKPIKGDWNGAGAHTNYSTKSMREDGGYEVILKAIEKLGKKHKEHIAAYGGNERRLTGRHETADiNTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPSSNMDPWTSMIADTTILWKP EQ ID NO: 5 Alfalfa GS 1 DNA coding sequence (upper case) with 5' and 3'ntranslated sequences (indicated in iower case) and vector sequences from CIaI tomal/Sspi and Sspl/Smal to Sait/Xhoi (lower case, underlined). caataaattcaaactcaatacccatttccattttcattttcatttaattcattaaatcaaatcaa cgaatctttag gattcaatacagattccttagattttactaagtttgaaaccaaaaccaaaaATGTCTCTCCTTTCAGATCTTATCAACCTTGACCTCTCCGAAACCA CGAGAAAATCATCGCCGAATACATATGGATTGGTGGATCTGGTTT GACTTGAGGAGCAAAGCAAG GACTCTACCAGGACCAGTTACTGA CCTTCACAGCTTCCCAAGTGGAACTATGATGGTTCCAGCACAGGTAAGCTCCTGGAGAAGATAGTGAAGTTATTATCTACCCACAAGCCATTTCAAGGACCCATTTAGAAGGGGTAACAATATCTTGGTTATGTGGATGCATACACTCCAGCTGGAGAGCCCATTCCCACCAACAAGAGCATGCAGCTGCCAAGATTTTCAGCCATCCTGATGTTGTTGCTGAA TACCATGGTATGGTATTGAGCAAGAATACACCTTGTTGCAGAAAGCATCAATTGGCCTCTTGGTTGGCCAGTTGGTGGTTTTCCTGGACCCAGGGACCATACTATTGTGGAGCTGGTGCTGACAAGGCATTTGG CGTGACATTGTTGACTCACATTACAAAGCCTGTCTTTATGCCGGCTCAACATCAGTGGAATCAATGGTGAAGTGATGCCTGGTCAATGGGATTCCAAGTTGGTCCCTCAGTTGGTATCTCTGCTGGTGATGAGATTGGGTTGCTCGTTACATTTTGGAGAGGATCACTGAGGTTGCTGGT TGGTGCTTTCCTTTGACCCAAAACCAATTAAGGGTGATTGGAATG TGCTGGTGCTCACACAAATTACAGCACCAAGTCTATGAGAGAAGAGGTGGCTATGAAGTCATCTTGAAAGCAATTGAGAAGCTTGGGAAGAGCACAAGGAGCACATTGCTGCTTATGGAGAAG GCAACGAGCGTGATTGACAGGGCGACATGAGACAGCTGACATTAACACCTTCTTAT GGGTGTTGCAAACCGTGGTGCGTCGATTAGAGTTGGAAGGGACAAGAGAAAGCAGGGAAAGGTTATTTCGAGGATAGGAGGCCATCAT TAACATGGATCCATATGTTGTTACTTCCATGATTGCAGACACCAC ATTCTCTGG AAAC CAT AAgccaccacacacacatgcattgaagtatttgaaagtc tgttgattccgcattagaatttggtcattgttttttctaggatttggatttgtgttattgttatggttccactttgtttgtttgaatttgaggccttgttataggtttcatatttctttctcttgttctaagtaaatg aαaataataatαtaatααααatcctctaαaαtcαaQ EQ ID NO: 6 Arabidopsis GS1 coding sequence ambia 1201 vector + rbcS3C+arabidopsis GSIBoId ATG is the start site. AAAMGAAAAAAAAMCATATCTΠ'GTTTGTCAGTATGGGAAGTTTGAGATAAGGCGAGTGAGGGGTTAAAATTCAGTGGCCATTGATTTTGTAATGCCAAGAACCACAMTCCMTGGTTACCATRCCTGTMGATGAGGTRRGCTMCTCTTTTTGTCCGTAGATAGGAAGCCTTATCACTATATATACAAGGCGTCCTAATAACCTCTTAGTACCAATTATTTCAGCACCA TGTCTCTGCTCTCAGATCTCGTTAACCTCAACCTCACGATGCCACCGGGAAAATCATCGCCGAATACATATGGATCGGTGGATCTGGA TGGATATCAGAAGCAAAGCCAGGACACTACCAGGACCAGTGACTGATCCATCAAGCTTCCCAAGTGGAACTACGACGGATCCAGCACCGGTCAGGCTGCTGGAGAGACAGTGAAGTCATTCTATACCCTCAGGCAATATTCAAGGATCCCTTCAGGAAAGCAACAACATCCTGGTGATGTGTGATGCTTACACACCAGCTGGTGATCCTATTCAACCAACAAGAGGCACAACGCTGCTAAGATCTTCAGCCACCCCGACGTTGCAAGGAGGAGCCTTGGTATGGGATTGAGCAAGAATACACTTTGATGCAAAAGGAGTGAACTGGCCAATTGGTTGGCCTGTTGGTGGCTACCCTGGCCCTCAGGGACTTACTACTGTGGTGTGGGAGCTGACAAAGCCATTGGTCGTGACATTGTGGATGTCACTACAAGGCCTGTCTTTACGCCGGTATTGGTATTTCTGGTATCAATGGAGAGTCATGCCAGGCCAGTGGGAGTTCCAAGTCGGCCCTGTTGAGGGTATTAGTTTGGTGATCAAGTCTGGGTTGCTCGATACCTTCTCGAGAGGATCACTGAGATCTTGGTGTAATTGTCAGCTTCGACCCGAAACCAGTCCCGGGTGACTGGAATGGACTGGAGCTCACTGCAACTACAGCACTAAGACAATGAGAAACGATGGAGGATTAAAGTGATCAAGAAAGCGATAGGGAAGCTTCAGCTGAAACACAAAGAACACATTCTGCTTACGGTGAAGGAAACGAGCGTCGTCTCACTGGAAAGCACGAAACCGCGACATCAACACATTCTCTTGGGGAGTCGCGAACCGTGGAGCGTCAGTGAGAGGGGACGTGACACAGAGAAGGAAGGTAAAGGGTACTTCGAAGACAGAAGGCCACTTCTMCATGGATCCTTACGTTGTCACCTCCATGATCGCTGAGACGACCATATCGGTTGA EQ ID NO: 7 Arabidopsis GS1 amino acid sequence ector sequences at N-terminus in Italics W)LRWRRrSMSLLSDLVNLNLTDATGKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSLPKWNYDGSSTGQAAGEDSEVILYPQAIFKDPFRKGNNILVMCDAYTPAGDPIPTNRHNAAKIFSHPDVAKEEPWYGIEQEYTLMQKDVNWPIGWPVGGYPGPQGPYYCVGADKAIGRDIVDAHYKACLYAGIGISGINGEVMPGQWEFQVGPVEGISSGDQVWARYLLERITEISGVIVSFDPKPVPGDWNGAGAHCNYSTKTMRNDGGLEVIKKAIGKQLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASVRVGRDTEKEGKGFEDRRPASNMDPYWTSMIAETTILG EQ ID NO: 8 Grape GPT DNA sequence howing Cambia 1305.1 with (3( end of) rbcS3C+Vitis (Grape). Bold ATG is theart site, parentheses are the catl intron and the underlined actagt is the spel cloning e used to splice in the hordeum gene. AAAAAGAAAAAAAAAACATATCTTGTTTGTCAGTATGGGAAGTTTGAGATAAGGCGAGTGAGGGGTTAAAATTCAGTGGCCATTGATTTTGTAATGCCAAGAACCACAAATCCAATGGTTACCATTCCTGTAAGATGAGGTTTGCTAACTCTTTTTGTCCGTAGATAGGAAGCCTTATCACTATATATACAAGGCGTCCTAATAACCTCTTAGTACCAATTATTTCAGCACC-AT-GGTAGATCTGAGGfGTAAATTTCTAGTTTTTCTCCT CATTTTCTTGGTTAGGACCCTTTTCTCTTTTTATTTTTTTGAGCTTTGATCTTTCTTAMCTGATCTATTTΓTTTAATTGATTGGTTATGGTGTAAATATTACATAGCTTTAATGATAATCTGATTACTTTATTTCGTGTGTCTATGATGATGATGATAGTTACAG)ACCGACGAACΓΛGTATGCAGCTCTCTCAATGTACCTGGACATTCCCAGAGTTGCTAAAAGACCAGCCTTTTTAAGGAGGAGTATTGATAGTATTTCGAGTAGAAGTAGTCCAGCTCCAAGTATCCATCTTTCATGGCGTCCGCATCAACGGTCTCCGCTCCAATACGGAGGCTGAGCAGACCCATAACCCCCCTCAACCTCTACAGGTTGCAAACGCTTGGAGAAATTCAAAACAACAATCTTTACTCAAATGAGCATGCTTGCCATCAACATGGAGCAATAAACCTTGGCCAAGGGTTTCCCAACTTTGATGGTCCTGAGTTGTCAAAGAAGCAGCAATTCAAGCCATTAAGGATGGGAAAAACCAATATGCTCTGGATATGGAGTTCCTGATCTCAACTCTGCTGTTGCTGATAGATTCAAGAAGGTACAGGACTCGTGGTGGACCCCGAGAAGGAAGTTACTGTTACTTCTGGATGTAAGAAGCAATTGCTGCTACTATGCTAGGCTTGATAAATCCTGGTGATGAGGTGACCTCTTTGCTCCATΠTATGATTCCTATGAAGCCACTCTATCCATGGCTGGTGCCAAATAAAATCCATCACTTTACGTCCTCCGGATTTTGCTGTGCCCATGGATGAGTCAAGTCTGCAATCTCAAAGAATACCCGTGCAATCCTTATAAACACTCCCCATACCCCACAGGAAAGATGTTCACAAGGGAGGAACTGAATGTGATTGCATCCCTCTCATTGAGMTGATGTGTTGGTGTTTACTGATGMGTTTACGACAAGTTGGCTTTGAMTGGATCACATTTCCATGGCTTCTCTTCCTGGGATGTACGAGAGGACCGTACTATGAATTCCTTAGGGAAAACTTTCTCCCTGACTGGATGGAAGATTGGTTGACAGTAGCTCCCCCACACCTGACATGGGGAGTGAGGCMGCCCACTCATTCCCACGTTTGCTACCTGCACCCCMTGCMTGGGCAGCTGCMCAGCCCTCCGGCCCCAGACTCTTACTATGMGAGCTAMGAGAGATTACAGTGCAMGAAGGCATCCTGGTGGAGGGATTGMGGCTGTCGGTTTCAGGGTATACCCATCMGTGGACCTATTTTGTGGTGGTGGATCACACCCCATTTGGGTTGAMGACGATATTGCTTTTGTGAGTATCTGATCMGGMGTTGGGGTGGTAGCMTTCCGACMGCGTTTCTACTTACACCCAGMGATGGAMGMCCTTGTGAGGTTTACCTTCTGTAMACGAGGGAACTCTGAGAGCTGCAGTTGAAAGGATGAAGGAGAMCTGAAGCCAMCMTAGGGGCACGTGA EQ ID NO: 9 Grape GPT amino acid sequence VDLRNRRTSMQLSQCTWTFPELLKRPAFLRRSIOSISSRSRSSSKYPSFMASASTSAPNTEAEQTHNPPQPLQVAKRLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPFVKEMIQAIKDGKNQYARGYGVPDLNSAVADRFKKDTGLWDPEKEVTVTSGCTAIMTMLGLINPGDEVILFAPFYDSYEATLSMAGAQIKSITLRPPDFAVPMDELKSAIKNTRAILINTPHNPTGKMFTREELNVIASLCIENDVLVFTDEVYDKLAFEMDHISMASPGMYERTVTMNSLGKTFSLTGWKIGWTVAPPHLTWGVRQAHSFLTFATCTPMQWMTALRAPDSYYEELKRDYSAKKAILVEGLKAVGFRVYPSSGTYFVWDHTPFGLKDIAFCEYLIKEVGWAIPTSVFYLHPEDGKNLVRFTFCKDEGTLRMVERMKEKLKPQ EQ ID NO: 10 Rice GPT DNA sequence ce GPT codon optimized for E. coli expression; untranslated sequences shown inwer case gtggATGAACCTGGCAGGCTTTCTGGCAACCCCGGCAACCGCAACCGCAACCCTCATGAAATGCCGCTGAACCCGAGCAGCAGCGCGAGCTTTCTGCTGAGCAGCTGCGTCGTAGCCTGGTGGCGAGCCTGCGTAAAGCGAGCCCGGCAGCAGCAGAGCACTGAGCCCGATGGCAAGCGCAAGCACCGTGGCAGCAGAAAACGGTGCGCAAAAGCAGCAGCAGAAAAACAGCAGCAGCAGCCGGTGCAGGTGGCGAAAGTCTGGAAAAATTTAAAACCACCATTTTTACCCAGATGAGCATGCTGGCGATTAACATGGCGCGATTAACCTGGGCCAGGGCTTTCCAACTTTGATGGCCCGGATTTTGTGAAAGAAGCGGCGATTCAGGCGATTAACGCGGCAAAAACCAGTATGCGCGTGGCTATGGCGTGCCGGAACTGAACAGCGCGATGCGGAACGTTTTCTGAAAGATAGCGGCCTGCAGGTGGATCCGGAAAAAGAATGACCGTGACCAGCGGCTGCACCGAAGCGATTGCGGCGACCATTCTGGGCCTATTAACCCGGGCGATGAAGTGATTCTGTTTGCGCCGTTTTATGATAGCTATGAGCGACCCTGAGCATGGCGGGCGCGAACGTGAAAGCGATTACCCTGCGTCCGCGGATTTTAGCGTGCCGCTGGAAGAACTGAAAGCGGCCGTGAGCAAAAACACCGTGCGATTATGATTAACACCCCGCATAACCCGACCGGCAAAATGTTTACCCGGAAGAACTGGAATTTATTGCGACCCTGTGCAAAGAAAACGATGTGCTGCTGTTGCGGATGAAGTGTATGATAAACTGGCGTTTGAAGCGGATCATATTAGCATGGCAGCATTCCGGGCATGTATGAACGTACCGTGACCATGAACAGCCTGGGCAAAACTTTAGCCTGACCGGCTGGAAAATTGGCTGGGCGATTGCGCCGCCGCATCTGCCTGGGGCGTGCGTCAGGCACATAGCTTTCTGACCTTTGCAACCTGCACCCCATGCAGGCAGCCGCCGCAGCAGCACTGCGTGCACCGGATAGCTATTATGAAGACTGCGTCGTGATTATGGCGCGAAAAAAGCGCTGCTGGTGAACGGCCTGAAAATGCGGGCTTTATTGTGTATCCGAGCAGCGGCACCTATTTTGTGATGGTGGATATACCCCGTTTGGCTTTGATAACGATATTGAATTTTGCGAATATCTGATTCGTGAGTGGGCGTGGTGGCGATTCCGCCGAGCGTGTTTTATCTGAACCCGGAAGATGCAAAAACCTGGTGCGTTTTACCTTTTGCAAAGATGATGAAACCCTGCGTGCGCGGTGGAACGTATGAAAACCAAACTGCGTAAAAAAAAGCTTgcggccgcactcgagc caccaccaccaccactga EQ ID NO: 11 Rice GPT amino acid sequence cludes amino terminal amino acids WW for cloning and His tag sequences fromet28 vector in italics. WMNLAGFLATPATATATRHEMPLNPSSSASFLLSSLRRSLVASLRKASPAAAAALPMASASTVAAENGAAKAAAEKQQQQPVQVAKRLEKFKTTIFTQMSMLAIKHGAINLQGFPNFDGPDFVKEAAIQAINAGKNQYARGYGVPELNSAIAERFLKDSGLQVDPEEVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAGANVKAITLRPPDFSPLEELKAAVSKNTRAIMINTPHNPTGKMFTREELEFIATLCKENDVLLFADEVYDKLFEADHISMASIPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFL FATCTPMQAAAAAALRAPDSYYEELRRDYGAKKALIVNGLKDAGFIVYPSSGTYFMVDHTPFGFDNDIEFCEYLIREVGWAIPPSVFYLNPEDGKNLVRFTFCKDDETLRMERMKTKLRiQ(KLAAALEHHHHHH EQ ID NO: 12 Soybean GPT DNA sequence OPO 151 D WITH SOYBEAN for E coli expression om starting codon. Vector sequences are italicized TGCATCATCACCATCACCATGGTAAGCCTATCCCTAACCCTCTCCTCGGTCTCA TTCTACGGAAAACCTGTA TTTTCAGGGAATTGATCCCTTCACCGCGAAACGLTGGAAAAATTTCAGACCACCATTTTTACCCAGATGAGCCTGCTGGCGATTAAACTGGCGCGATTAACCTGGGCCAGGGCTTTCCGAACTTTGATGGCCCGGAATTTTGAAAGAAGCGGCGATTCAGGCGATTCGTGATGGCAAAAACCAGTATGCGCGGGCTATGGCGTGCCGGATCTGAACATTGCGATTGCGGAACGTTTTAAAAAAGAACCGGCCTGGTGGTGGATCCGGAAAAAGAAATTACCGTGACCAGCGGCTGCACGAAGCGATTGCGGCGACCATGATTGGCCTGATTAACCCGGGCGATGAAGTGTTATGTTTGCGCCGTTTTATGATAGCTATGAAGCGACCCTGAGCATGGCGGGCCGAAAGTGAAAGGCATTACCCTGCGTCCGCCGGATTTTGCGGTGCCGCTGGAGAACTGAAAAGCACCATTAGCAAAAACACCCGTGCGATTCTGATTAACACCCCCATAACCCGACCGGCAAAATGTTTACCCGTGAAGAACTGAACTGCATTGCGAGCTGTGCATTGAAAACGATGTGCTGGTGTTTACCGATGAAGTGTATGATAAACTGCGTTTGATATGGAACATATTAGCATGGCGAGCCTGCCGGGCATGTTTGAACGACCGTGACCCTGAACAGCCTGGGCAAAACCTTTAGCCTGACCGGCTGGAAAATGGCTGGGCGATTGCGCCGCCGCATCTGAGCTGGGGCGTGCGTCAGGCGCATCGTTTCTGACCTTTGCAACCGCACATCCGTTTCAGTGCGCAGCAGCAGCAGCATGCGTGCACCGGATAGCTATTATGTGGAACTGAAACGTGATTATATGGCGAAAGTGCGATTCTGATTGAAGGCCTGAAAGCGGTGGGCTTTAAAGTGTTTCCGAGCGCGGCACCTATΠTGTGGTGGTGGATCATACCCCGTTTGGCCTGGAAAACGATTGGCGTTTTGCGAATATCTGGTGAAAGAAGTGGGCGTGGTGGCGATTCCGACAGCGTGTTTTATCTGAACCCGGAAGAAGGCAAAAACCTGGTGCGTTTTACCTTTGCAAAGATGAAGAAACCATTCGTAGCGCGGTGGAACGTATGAAAGCGAAACTCGTAAAGTCGACTAA EQ ID NO: 13 Soybean GPT amino acid sequence anslated protein product, vector sequences italicized HHHHHHGKPtPNPLLGLDSTENL YFGG/DPFrAKRLEKFQTTIFTQMSLLAIKHGAILGQGFPNFDGPEFVKEAAIQAIRDGKNQYARGYGVPDLNIAIAERFKKDTGLWDPKEITVTSGCTEAIAATMIGLINPGDEVIMFAPFYDSYEATLSMAGAKVKGITLRPPDFVPLEELKSTISKNTRAtLINTPHNPTGKMFTREELNCIASLCIENDVLVFTDEVYDKLFDMEHISMASLPGMFERTVTLNSLGKTFSLTGWKIGWAIAPPHLSWGVRQAHAFLFATAHPFQCAAAAALRAPDSYYVELKRDYMAKRAILIEGLKAVGFKVFPSSGTYFV WOHTPFGLENDVAFCEYLVKEVGWAIPTSVFYLNPEEGKNLVRFTFCKDEETIRS VERMKAKLRKVD EQ ID NO: 14 Bailey GPT DNA sequence oding sequence from start with intron removed TGGTAGATCTGAGGAACCGACGMCT-AGrATGGCATCCGCCCCCGCCTCCGC TCCGCGGCCCTCTCCACCGCCGCCCCCGCCGACAACGGGGCCGCCAAGCCC CGGAGCAGCGGCCGGTACAGGTGGCTAAGCGATTGGAGAAGTTCAAAACAAC ATTTTCACACAGATGAGCATGCTCGCAGTGAAGCATGGAGCAATAAACCTTGG CAGGGGTTTCCCAATTTTGATGGCCCTGACTTTGTCAAAGATGCTGCTATTGA GCTATCAAAGCTGGAAAGAATCAGTATGCAAGAGGATATGGTGTGCCTGAATT AACTCAGCTGTTGCTGAGAGATTTCTCAAGGACAGTGGATTGCACATCGATCC GATAAGGAAGTTACTGTTACATCTGGGTGCACAGAAGCAATAGCTGCAACGAT TTGGGTCTGATCAACCCTGGGGATGAAGTCATACTGTTTGCTCCATTCTATGAT CTTATGAGGCTACACTGTCCATGGCTGGTGCGAATGTCAAAGCCATTACACTC GCCCTCCGGACTTTGCAGTCCCTCTTGAAGAGCTAAAGGCTGCAGTCTCGAA AATACCAGAGCAATAATGATTAATACACCTCACAACCCTACCGGGAAAATGTTC CAAGGGAGGAACTTGAGTTCATTGCTGATCTCTGCAAGGAAAATGACGTGTTG TCTTTGCCGATGAGGTCTACGACAAGCTGGCGTTTGAGGCGGATCACATATCA TGGCTTCTATTCCTGGCATGTATGAGAGGACCGTCACTATGAACTCCCTGGGG AGACGTTCTCCTTGACCGGATGGAAGATCGGCTGGGCGATAGCACCACCGCA CTGACATGGGGCGTAAGGCAGGCACACTCCTTCCTCACATTCGCCACCTCCA GCCGATGCAATCAGCAGCGGCGGCGGCCCTGAGAGCACCGGACAGCTACTT GAGGAGCTGAAGAGGGACTACGGCGCAAAGAAAGCGCTGCTGGTGGACGGG TCAAGGCGGCGGGCTTCATCGTCTACCCTTCGAGCGGAACCTACTTCATCATG TCGACCACACCCCGTTCGGGTTCGACAACGACGTCGAGTTCTGCGAGTACTT ATCCGCGAGGTCGGCGTCGTGGCCATCCCGCCAAGCGTGTTCTACCTGAACC GGAGGACGGGAAGAACCTGGTGAGGTTCACCTTCTGCAAGGACGACGACACG TAAGGGCGGCGGTGGACAGGATGAAGGCCAAGCTCAGGAAGAAATGA EQ ID NO: 15 Barley GPT amino acid sequence anslated sequence from start site {intron removed) VDLRNRRTSMASAPASASAALSTAAPADNGAAKPTEQRPVQVAKRLEKFKTTIFT MSMLAVKHGAINLGQGFPNFDGPDFVKDAAIEAIKAGKNQYARGYGVPELNSAVA RFLKDSGLHIDPDKEVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAG NVKAITLRPPDFAVPLEELKAAVSKNTRAIMINTPHNPTGKMFTREELEFIADLCKE DVLLFADEVYDKLAFEADHISMASIPGMYERTVTMNSLGKTFSLTGWKIGWAIAPP LTWGVRQAHSFLTFATSTPMQSAAAAALRAPDSYFEELKRDYGAKKALLVDGLKA GFIVYPSSGTYFIMVDHTPFGFDNDVEFCEYLIREVGVVAIPPSVFYLNPEDGKNLV FTFCKDDDTLRAAVDRMKAKLRKK EQ ID NO: 16 Zebra fish GPT DNA sequence anio rerio sequence designed for expression in E coϋ. Bold, italicized nucleotidesdded for cloning or from pET28b vector. TGΓCCGTGGCGAAACGTCTGGAAAAATTTAAAACCACCATTTTTACCCAGATGACATGCTGGCGATTAAACATGGCGCGATTAACCTGGGCCAGGGCTTTCCGAACTTGATGGCCCGGATTTTGTGAAAGAAGCGGCGATTCAGGCGATTCGTGATGGCACAACCAGTATGCGCGTGGCTATGGCGTGCCGGATCTGAACATTGCGATTAGGAACGTTATAAAAAAGATACCGGCCTGGCGGTGGATCCGGAAAAAGAAATTACGTGACCAGCGGCTGCACCGAAGCGATTGCGGCGACCGTGCTGGGCCTGATTACCCGGGCGATGAAGTGATTGTGTTTGCGCCGTTTTATGATAGCTATGAAGCGCCCTGAGCATGGCGGGCGCGAAAGTGAAAGGCATTACCCTGCGTCCGCCGGTTTTGCGCTGCCGATTGAAGAACTGAAAAGCACCATTAGCAAAAACACCCGTGGATTCTGCTGAACACCCCGCATAACCCGACCGGCAAAATGTTTACCCCGGAAGACTGAACACCATTGCGAGCCTGTGCATTGAAAACGATGTGCTGGTGTTTAGCGTGAAGTGTATGATAAACTGGCGTTTGATATGGAACATATTAGCATTGCGAGCCTCCGGGCATGTTTGAACGTACCGTGACCATGAACAGCCTGGGCAAAACCTTTACCTGACCGGCTGGAAAATTGGCTGGGCGATTGCGCCGCCGCATCTGACCTGGGCGTGCGTCAGGCGCATGCGTTTCTGACCTTTGCAACCAGCAACCCGATGCATGGGCAGCAGCAGTGGCACTGCGTGCACCGGATAGCTATTATACCGAACTGAACGTGATTATATGGCGAAACGTAGCATTCTGGTGGAAGGCCTGAAAGCGGTGGCTTTAAAGTGTTTCCGAGCAGCGGCACCTATTTTGTGGTGGTGGATCATACCCGTTTGGCCATGAAAACGATATTGCGTTTTGCGAATATCTGGTGAAAGAAGTGGCGTGGTGGCGATTCCGACCAGCGTGTTTTATCTGAACCCGGAAGAAGGCAAAACCTGGTGCGTTTTACCTTTTGCAAAGATGAAGGCACCCTGCGTGCGGCGGTGATCGTATGAMGAAAAACTGCGTAMGΓCGACAAGCTTGCGGCCGCACΓCGGCACCACCACCACCACCACTGA EQ ID NO; 17 Zebra fish GPR amino acid sequence mino acid sequence of Danio reήo cloned and expressed in E, coli (bold, italicizedmino acids are added from vector/ cloning and His tag on C-terminus) SVAKRLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPDFVKEMIQAIRDGNNQARGYGVPDLN IAISERYKKDTGLAVDPEKEITVTSGCTEAIAATVLGLINPGDEVIVFPFYDSYEATLSMAGAKVKGITLRPPDFALPIEELKSTISKNTRAILLNTPHNPTGKMFPEELNTIASLCIENDVLVFSDEVYDKLAFDMEHISIASLPGMFERTVTMNSLGKTFSLGWKIGWAIAPPHLTWGVRQAHAFLTFATSNPMQWAAAVALRAPDSYYTELKRDYAKRSILVEGLKAVGFKVFPSSGTYFVWDHTPFGHENDIAFCEYLVKEVGWAIPTVFYLNPEEGKNLVRFTFCKDEGTLRAAVDRMKEKLRKVDKLAΛALEHHHHHH- EQ ID NO: 18 Arabidopsis truncated GPT -30 construct DNA sequence abidopsis GPT with 30 amino acids removed from the targeting sequence. TGGCCAAAATCCATCGTCCTATCGGAGCCACCATGACCACAGTTTCGACTCAG ACGAGTCTACTCAAAAACCCGTCCAGGTGGCGAAGAGATTAGAGAAGTTCMG CTACTATTTTCACTCAAATGAGCATATTGGCAGTTAAACATGGAGCGATCAATT AGGCCAAGGCTTTCCCMTTTCGACGGTCCTGATTTTGTTAAAGAAGCTGCGA CCMGCTATTAMGATGGTAAAMCCAGTATGCTCGTGGATACGGCATTCCTCA CTCAACTCTGCTATAGCTGCGCGGTTTCGTGAAGATACGGGTCTTGTTGTTGA CCTGAGAMGMGTTACTGTTACATCTGGTTGCACAGMGCCATAGCTGCAGC ATGTTGGGTTTMTMACCCTGGTGATGMGTCATTCTCTTTGCACCGTTTTAT ATTCCTATGMGCAACACTCTCTATGGCTGGTGCTAMGTAAMGGAATCACTT ACGTCCACCGGACTTCTCCATCCCTTTGGMGAGCTTAMGCTGCGGTMCTA CMGACTCGAGCCATCCTTATGMCACTCCGCACMCCCGACCGGGMGATGT CACTAGGGAGGAGCTTGAMCCATTGCATCTCTCTGCATTGAAMCGATGTGC TGTGTTCTCGGATGMGTATACGATMGCTTGCGTTTGAMTGGATCACATTTC ATAGCTTCTCTTCCCGGTATGTATGAMGMCTGTGACCATGMTTCCCTGGGA MGACTTTCTCTTTMCCGGATGGMGATCGGCTGGGCGATTGCGCCGCCTCAT TGACTTGGGGAGTTCGACMGCACACTCTTACCTCACATTCGCCACATCMCA CAGCACAATGGGCAGCCGTTGCAGCTCTCAAGGCACCAGAGTCTTACTTCAM AGCTGAMAGAGATTACAATGTGAAMAGGAGACTCTGGTTMGGGTTTGMG MGTCGGATTTACAGTGTTCCCATCGAGCGGGACTTACTTTGTGGTTGCTGAT ACACTCCATTTGGMTGGAGMCGATGTTGCTTTCTGTGAGTATCTTATTGMG AGTTGGGGTCGTTGCGATCCCMCGAGCGTCTTTTATCTGMTCCAGMGMG GAAGMTTTGGTTAGGTTTGCGTTCTGTAMGACGMGAGACGTTGC TGGTGCMTTGAGAGGATGMGCAGMGCTTMGAGAAMGTCTGA EQ ID NO: 19 Arabidopsis truncated GPT -30 construct amino acid sequence AKIHRPIGATMTTVSTQNESTQKPVQVAKRLEKFKTTIFTQMSILAVKHGAINLGQG PNFDGPDFVKEMIQAIKDGKNQYARGYGIPQLNSAIMRFREDTGLWDPEKEVT TSGCTEAIAMMLGLINPGDEVILFAPFYDSYEATLSMAGAKVKGITLRPPDFSIPLE LKMVTNKTRAILMNTPHNPTGKMFTREELETIASLCIENDVLVFSDEVYDKLAFEM HISIASLPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSYLTFATS PAQWMVMLKAPESYFKELKRDYNVKKETLVKGLKEVGFTVFPSSGTYFWADH PFGMENDVAFCEYLIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAIER KQKLKRKV EQ ID NO: 20: Arabidopsis truncated GPT -45 construct DNA sequence abidopsis GPT with 45 residues in the targeting sequence removed TGGCGACTCAGAACGAGTCTACTCAAAAACCCGTCCAGGTGGCGAAGAGATTAAGAAGTTCMGACTACTATTTTCACTCAAATGAGCATATTGGCAGTTAAACATGAGCGATCAATTTAGGCCAAGGCTTTCCCAATTTCGACGGTCCTGATTTTGTTAAGAAGCTGCGATCCAAGCTATTAAAGATGGTAAAAACCAGTATGCTCGTGGATAGGCATTCCTCAGCTCAACTCTGCTATAGCTGCGCGGTTTCGTGAAGATACGGGCTTGTTGTTGATCCTGAGAAAGAAGTTACTGTTACATCTGGTTGCACAGAAGCCTAGCTGCAGCTATGTTGGGTTTAATAAACCCTGGTGATGAAGTCATTCTCTTTGACCGTTTTATGATTCCTATGAAGCAACACTCTCTATGGCTGGTGCTAAAGTAAAGGAATCACTTTACGTCCACCGGACTTCTCCATCCCTTTGGAAGAGCTTAAAGCGCGGTAACTAACAAGACTCGAGCCATCCTTATGAACACTCCGCACAACCCGACGGGAAGATGTTCACTAGGGAGGAGCTTGAAACCATTGCATCTCTCTGCATTGAAACGATGTGCTTGTGTTCTCGGATGAAGTATACGATAAGCTTGCGTTTGAAATGATCACATTTCTATAGCTTCTCTTCCCGGTATGTATGAAAGAACTGTGACCATGATTCCCTGGGAAAGACTTTCTCTTTAACCGGATGGAAGATCGGCTGGGCGATTGGCCGCCTCATCTGACTTGGGGAGTTCGACAAGCACACTCTTACCTCACATTCGCACATCAACACCAGCACAATGGGCAGCCGTTGCAGCTCTCAAGGCACCAGAGCTTACTTCAAAGAGCTGAAAAGAGATTACAATGTGAAAAAGGAGACTCTGGTTAGGGTTTGAAGGAAGTCGGATTTACAGTGTTCCCATCGAGCGGGACTTACTTTGGGTTGCTGATCACACTCCATTTGGAATGGAGAACGATGTTGCTTTCTGTGAGTACTTATTGAAGAAGTTGGGGTCGTTGCGATCCCAACGAGCGTCTTTTATCTGAATCAGAAGAAGGGAAGAATTTGGTTAGGTTTGCGTTCTGTAAAGACGAAGAGACGTGCGTGGTGCAATTGAGAGGATGAAGCAGAAGCTTAAGAGAAAAGTCTGA EQ ID NO: 21: Arabidopsis truncated GPT -45 construct amino acid sequenceATQNESTQKPVQVAKRLEKFKTTIFTQMSILAVKHGAINLGQGFPNFDGPDFVKEA QAIKDGKNQYARGYGIPQLNSAIAARFREDTGLVVDPEKEVTVTSGCTEAIAAAMLLINPGDEVILFAPFYDSYEATLSMAGAKVKGITLRPPDFSIPLEELKAAVTNKTRAIL NTPHNPTGKMFTREELETiASLCiENDVLVFSDEVYDKLAFEMDHISIASLPGMYERVTMNSLGKTFSLTGWKiGWAtAPPHLTWGVRQAHSYLTFATSTPAQWAAVAALKAESYFKELKRDYNVKKETLVKGLKEVGFTVFPSSGTYFWADHTPFGMENDVAFCELIEEVGVVAIPTSVFYLNPEEGKNLVRFAFCKDEETLRGAJERMKQKLKRKV EQ ID NO: 22: Tomato Rubisco promoter OMATO RuBisCo rbcS3C promoter sequence from Kpnl to Ncoi GΓΛCCGTTTGAATCCTCCTTAAAGTTTTTCTCTGGAGAAACTGTAGTAATTTTACTTGTTGTGTTCCCTTCATCTTTTGAATTAATGGCATTTGTTTTAATACTAATCTGCTCTGAAACTTGTAATGTATGTATATCAGTTTCTTATAATTTATCCAAGTAATATCT CCATTCTCTATGCAATTGCCTGCATAAGCTCGACAAAAGAGTACATCAACCCCT CTCCTCTGGACTACTCTAGCTAAACTTGAATTTCCCCTTAAGATTATGAMTTG TATATCCTTAACAAACGACTCCTTCTGTTGGAAAATGTAGTACTTGTCTTTCTTC TTTGGGTATATATAGTTTATATACACCATACTATGTACAACATCCAAGTAGAGTG AATGGATACATGTACAAGACTTATTTGATTGATTGATGACTTGAGTTGCCTTAG AGTAACAAATTCTTAGGTCAATAAATCGTTGATTTGAAATTAATCTCTCTGTCTT GACAGATAGGAATTATGACTTCCAATGGTCCAGAAAGCAAAGTTCGCACTGAG GTATACTTGGAATTGAGACTTGCACAGGTCCAGAAACCAAAGTTCCCATCGAG TCTAAAATCACATCTTTGGAATGAAATTCAATTAGAGATAAGTTGCTTCATAGCA AGGTAAAATGGAAGATGTGAAGTAACCTGCAATAATCAGTGAAATGACATTAAT CACTAAATACTTCATATGTAATTATCCTTTCCAGGTTAACAATACTCTATAAAGT AGAATTATCAGAAATGGGCTCATCAAACTTTTGTACTATGTATTTCATATAAGGA GTATAACTATACATAAGTGTATACACAACTTTATTCCTATTTTGTAAAGGTGGAG GACTGTTTTCGATGGATCTAAAGCAATATGTCTATAAAATGCATTGATATAATAA TATCTGAGAAAATCCAGAATTGGCGTTGGATTATTTCAGCCAAATAGAAGTTTG ACCATACTTGTTGATTCCTTCTMGTTMGGTGMGTATCATTCATAMCAGTTT CCCCMAGTACTACTCACCAAGTTTCCCTTTGTAGMTTMCAGTTCAAATATAT GCGCAGAMTTACTCTATGCCCAAMCCMACGAGMAGAMCAAMTACAGG GTTGCAGACTTTATTRRCGTGTTAGGGTGTGTTTTTTCATGTMTTMTCMMA TATTATGACAAAMCATTTATACATATTTTTACTCAACACTCTGGGTATCAGGGT GGTTGTGTTCGACMTCMTATGGAMGGMGTATΠTCCTTATTTTTTTAGTTA TATTTTCAGTTATACCAMCATACCTTGTGATATTATTTTTAAAMTGMMACTC TCAGAMGMMAGCAAMGCMCMMAMTTGCMGTATTTTTTAAAAMGA AAAAAAMCATATCTTGTTTGTCAGTATGGGMGTTTGAGATMGGACGAGTGA GGGTTAAMTTCAGTGGCCATTGATTTTGTAATGCCAAGAACCACAAMTCCM GGTTACCATTCCTGTMGATGAGGTTTGCTMCTCTTTTTGTCCGTTAGATAGG MGCCTTATCACTATATATACMGGCGTCCTMTMCCTCTTAGTMCCMTTATT CAGCACCΛJGG EQ ID NO; 23: Bamboo GPT DNA sequence TGGCCTCCGCGGCCGTCTCCACCGTCGCCACCGCCGCCGACGGCGTCGCGA GCCGACGGAGMGCAGCCGGTACAGGTCGCAMGCGTTTGGAAMGTTTMG CMCMTTTTCACACAGATGAGCATGCTTGCCATCMGCATGGAGCMTAMC TCGGCCAGGGCTTTCCGMTTTTGATGGCCCTGACTTTGTGAMGMGCTGCT TTCMGCTATCMTGCTGGGMGMTCAGTATGCMGAGGATATGGTGTGCCT AACTGAACTCGGCTGTTGCTGAMGGTTCCTGAAGGACAGTGGCTTGCAAGTC ATCCCGAGMGGMGTTACTGTCACATCTGGGTGCACGGAAGCGATAGCTGC ACGATATTGGGTCTTATCMCCCTGGCGATGMGTGATCTTGTTTGCTCCATTC ATGATTCATACGAGGCTACGCTGTCGATGGCTGGTGCCAATGTAAMGCCATT CTCTCCGTCCTCCAGATTTTGCAGTCCCTCTTGAGGAGCTAMGGCCACAGTC CTMGMCACCAGAGCGATMTGATAMCACACCACACMTCCTACTGGGAM TGTTTTCTAGGGMGMCTTGMTTCATTGCTACTCTCTGCMGMMATGATG GTTGCTTTTTGCTGATGAGGTCTATGACAAGTTGGCATTTGAGGCAGATCATATTCAATGGCTTCTATTCCTGGCATGTATGAGAGGACTGTGACTATGAACTCTCTGGGAAGACATTCTCTCTAACAGGATGGAAGATCGGTTGGGCAATAGCACCACCAACCTGACATGGGGTGTAAGGCAGGCACACTCATTCCTCACATTTGCCACCTGCCACCAATGCAATCGGCGGCGGCGGCGGCTCTTAGAGCACCAGATAGCTACTAGGGGAGCTGAAGAGGGATTACGGTGCAAAGAAAGCGATACTAGTCGACGGACCMGGCTGCAGGTTTTATTGTTTACCCTTCAAGTGGAACATACTTTGTCATGGTGATCACACCCCGTTTGGTTTCGACAATGATATTGAGTTCTGCGAGTATTTGATCGCGAAGTCGGTGTTGTCGCCATACCACCAAGCGTATTTTATCTCAACCCTGAGATGGGAAGAACTTGGTGAGGTTCACCTTCTGCAAGGATGATGATACGCTGAGACCGCAGTTGAGAGGATGAAGACAAAGCTCAGGAAAAAATGA EQ ID NO: 24: Bamboo GPT amino acid sequence ASAAVSTVATAADGVAKPTEKQPVQVAKRLEKFKTTIFTQMSMLAIKHGAINLGQGPNFDGPDFVKEAAIQAINAGKNQYARGYGVPELNSAVAERFLKDSGLQVDPEKEVVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAGANVKAITLRPPDFAVPLELKATVSKNTRAIMINTPHNPTGKMFSREELEFIATLCKKNDVLLFADEVYDKLAFEDHISMASIPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFACTPMQSAAAAALRAPDSYYGELKRDYGAKKAILVDGLKAAGFIVYPSSGTYFVMVHTPFGFDNDIEFCEYLIREVGWAIPPSVFYLNPEDGKNLVRFTFCKDDDTLRAAVEMKTKLRKK EQ ID NO: 25: 1305.1 +rbcS3C promoter + cat! intron with rice GPT gene. ambial 305.1 with (31 end of) rbcS3C+rice GPT. Underlined ATG Is start site,arentheses are the catl introπ and the underlined actagt is the spei cloning site used splice in the rice gene. AAAMGAAAAAAAAMCATATCTTGTTTGTCAGTATGGGAAGTTTGAGATAAGGCGAGTGAGGGGTTAAMTTCAGTGGCCATTGATTTTGTMTGCCMGMCCACAMTCCMTGGTrACCATrCCTGTMGATGAGGTTTGCTMCTCTTTTTGTCCGTAGATAGGMGCCTTATCACTATATATACMGGCGTCCTMTMCCTCTTAGTACCMTTATTTCAGCACCAJGGTAGATCTGAGG(GTAMTTTCTAGTTTTTCTCCTCATTTTCTTGGTTAGGACCCTTTTCTCTTTTTATTTTTTTGAGCTTTGATCTTTCTTAMCTGATCTATTTTTTMTTGATTGGTTATGGTGTAMTATTACATAGCTTTMTGATMTCTGATTACTTTATTTCGTGTGTCTATGATGATGATGATAGTTACAG)ACCGACGAACTaGTATGMTCTGGCCGGCTTTCTCGCCACGCCCGCGACCGCGCCGCGACGCGGCATGAGATGCCGTTAMTCCCTCCTCCTCCGCCTCCTTCCTCTCTCCTCGCTCCGCCGCTCGCTCGTCGCGTCGCTCCGGMGGCCTCGCCGGGGCGGCCGCGGCGCTCTCCCCCATGGCCTCCGCGTCCACCGTCGCCGCCGAMCGGCGCCGCCMGGCGGCGGCGGAGMGCAGCAGCAGCAGCCTGTGCA GTTGCAAAGCGGTTGGAAAAGTTTAAGACGACCATTTTCACACAGATGAGTATCTTGCCATCAAGCATGGAGCAATAAACCTTGGCCAGGGTTTTCCGAATTTCGAGGCCCTGACTTTGTAAAAGAGGCTGCTATTCAAGCTATCAATGCTGGGAAGAACAGTACGCAAGAGGATATGGTGTGCCTGAACTGAACTCAGCTATTGCTGAAAGTTCCTGAAGGACAGCGGACTGCAAGTCGATCCGGAGAAGGAAGTTACTGTCAATCTGGATGCACAGAAGCTATAGCTGCAACAATTTTAGGTCTAATTAATCCAGGGATGAAGTGATATTGTTTGCTCCATTCTATGATTCATATGAGGCTACCCTGTCATGGCTGGTGCCAACGTAAAAGCCATTACTCTCCGTCCTCCAGATΠTTCAGTCCTCTTGAAGAGCTAAAGGCTGCAGTCTCGAAGAACACCAGAGCTATTATGATAACACCCCGCACAATCCTACTGGGAAAATGTTTACAAGGGAAGAACTTGAGTTTTTGCCACTCTCTGCAAGGAAAATGATGTGCTGCTTTTTGCTGATGAGGTCTACACAAGTTAGCTTTTGAGGCAGATCATATATCAATGGCTTCTATTCCTGGCATGTTGAGAGGACCGTGACCATGAACTCTCTTGGGAAGACATTCTCTCTTACAGGATGAAGATCGGTTGGGCAATCGCACCGCCACACCTGACATGGGGTGTAAGGCAGCACACTCATTCCTCACGTTTGCGACCTGCACACCAATGCAAGCAGCTGCAGCTCAGCTCTGAGAGCACCAGATAGCTACTATGAGGAACTGAGGAGGGATTATGGGCTAAGAAGGCATTGCTAGTCAACGGACTCAAGGATGCAGGTTTCATTGTCTACCTTCAAGTGGAACATACTTCGTCATGGTCGACCACACCCCATTTGGTTTCGAAATGATATTGAGTTCTGCGAGTATTTGATTCGCGAAGTCGGTGTTGTCGCCATACACCTAGTGTATTTTATCTCAACCCTGAGGATGGGAAGAACTTGGTGAGGTTCCCTTTTGCAAGGATGATGAGACGCTGAGAGCCGCGGTTGAGAGGATGAAGACAAGCTCAGGAAAAAATGA EQ ID NO: 26: HORDEUM GPT SEQUENCE IN VECTOR ambial 305.1 with (31 end of) rbcS3C+hordeum IDW. Underlined ATG is start site,arentheses are the cat! introπ and the underlined actagt is the spel cloning site used splice in the hordeum gene. AAAAAGAAAAAAAAAACATATCTTGTTTGTCAGTATGGGAAGTTTGAGATAAGGCGAGTGAGGGGTTAAAATTCAGTGGCCATTGATTTTGTAATGCCAAGAACCACAMTCCAATGGTTACCATTCCTGTAAGATGAGGTTTGCTAACTCTTTTTGTCCGTAGATAGGAAGCCTTATCACTATATATACAAGGCGTCCTAATAACCTCTTAGTACCAATTATTTCAGCACCATGGTAGATCTGAGGFGTAAATTTCTAGTTTTTCTCCTCATTTTCTTGGTTAGGACCCTTTTCTCTTTTTATTTTTTTGAGCTTTGATCTTTCTTAAACTGATCTATTTTTTAATTGATTGGTTATGGTGTAAATATTACATAGCTTTAATGATAATCTGATTACTTTATΓTCGTGTGTCTATGATGATGATGATAGTTACAG)ACCGACGAACΓAGΓATGGCATCCGCCCCCGCCTCCGCCTCCGCGGCCCTCTCCCCGCCGCCCCCGCCGACAACGGGGCCGCCAAGCCCACGGAGCAGCGGCCGTACAGGTGGCTAAGCGATTGGAGAAGTTCAAAACAACAATTTTCACACAGATGGCATGCTCGCAGTGAAGCATGGAGCAATAAACCTTGGACAGGGGTTTCCCAATTTGATGGCCCTGACTTTGTCAAAGATGCTGCTATTGAGGCTATCAAAGCTGGAAGAATCAGTATGCAAGAGGATATGGTGTGCCTGAATTGAACTCAGCTGTTGCTAGAGATTTCTCAAGGACAGTGGATTGCACATCGATCCTGATAAGGAAGTTACT TTACATCTGGGTGCACAGAAGCAATAGCTGCAACGATATTGGGTCTGATCAACCTGGGGATGMGTCATACTGTTTGCTCCATTCTATGATTCTTATGAGGCTACACGTCCATGGCTGGTGCGAATGTCAAAGCCATTACACTCCGCCCTCCGGACTTTGAGTCCCTCTTGAAGAGCTAAAGGCTGCAGTCTCGAAGAATACCAGAGCAATAAGATTAATACACCTCACAACCCTACCGGGAAAATGTTCACAAGGGAGGAACTTGGTTCATTGCTGATCTCTGCAAGGAAAATGACGTGTTGCTCTTTGCCGATGAGGCTACGACAAGCTGGCGTTTGAGGCGGATCACATATCAATGGCTTCTATTCCTGCATGTATGAGAGGACCGTCACTATGAACTCCCTGGGGAAGACGTTCTCCTTGACGGATGGAAGATCGGCTGGGCGATAGCACCACCGCACCTGACATGGGGCGTAGGCAGGCACACTCCTTCCTCACATTCGCCACCTCCACGCCGATGCAATCAGCGCGGCGGCGGCCCTGAGAGCACCGGACAGCTACTTTGAGGAGCTGAAGAGGACTACGGCGCAAAGAAAGCGCTGCTGGTGGACGGGCTCAAGGCGGCGGGCTCATCGTCTACCCTTCGAGCGGAACCTACTTCATCATGGTCGACCACACCCCGTCGGGTTCGACAACGACGTCGAGTTCTGCGAGTACTTGATCCGCGAGGTCGGCTCGTGGCCATCCCGCCAAGCGTGTTCTACCTGAACCCGGAGGACGGGAAGAACTGGTGAGGTTCACCTTCTGCAAGGACGACGACACGCTAAGGGCGGCGGTGACAGGATGAAGGCCAAGCTCAGGAAGAAATGATTGAGGGGCGCΛCGTGTGA EQ ID NO: 27 Gambia 1201 + Arabidopsis GPT sequence (35S promoter fromaMV in italics) ATGGAGTCAAAGATTCAAATAGAGGACCTAACAGAACTCGCCGTAAAGACTGGGAACAGTTCATACAGAGTCTCTTACGACTCAATGACAAGAAGAAAATCTTCGTCACATGGTGGAGCACGACACACTTGTCTACTCCAAAAATATCAAAGATACAGTCTAGAAGACCAAAGGGCAATTGAGACTTTTCAACAAAGGGTAATATCCGGAAACCCCTCGGATTCCATTGCCCAGCTATCTGTCACTTTATTGTGAAGATAGTGGAAAA GAAGGTGGCTCCTACAAATGCCATCATTGCGATAAAGGAAAGGCCATCGTTGAGATGCCTCTGCCGACAGTGGTCCCAAAGATGGACCCCCACCCACGAGGAGCACGTGGAAAAAGAAGACGTTCCAACCACGTCTTCAAAGCAAGTGGATTGATGTGTATCTCCACTGACGTAAGGGATGACGCACAATCCCACTATCCTTCGCAAGACC TTCCTCTATATAAGGAAGTTCATTTCATTTGGAGAGAACACGGGGGACTCTTGACATGTACCTGGACATAAATGGTGTGATGATCAAACAGTTTAGCTTCAAAGCCTCCTTCTCCCATTCTCTTCTAATTTCCGACAAAGCTCCGCCAAAATCCATCGTCCTTCGGAGCCACCATGACCACAGTTTCGACTCAGAACGAGTCTACTCAAAAACCCTCCAGGTGGCGAAGAGATTAGAGAAGTTCAAGACTACTATTTTCACTCAAATGGCATATTGGCAGTTAAACATGGAGCGATCAATTTAGGCCAAGGCTTTCCCAATTCGACGGTCCTGATTTTGTTAAAGAAGCTGCGATCCAAGCTATTAAAGATGGTAAAACCAGTATGCTCGTGGATACGGCATTCCTCAGCTCAACTCTGCTATAGCTGCCGGTTTCGTGAAGATACGGGTCTTGTTGTTGATCCTGAGAAAGAAGTTACTGTACATCTGGTTGCACAGAAGCCATAGCTGCAGCTATGTTGGGTTTAATAAACCCTGTGATGAAGTCATTCTCTTTGCACCGTTTTATGATTCCTATGAAGCAACACTCTTATGGCTGGTGCTAAAGTAAAAGGAATCACTTTACGTCCACCGGACTTCTCCACCCTTTGGAAGAGCTTAAAGCTGCGGTAACTAACAAGACTCGAGCCATCCTTA GAACACTCCGCACAACCCGACCGGGAAGATGTTCACTAGGGAGGAGCTTGAACCATTGCATCTCTCTGCATTGAAAACGATGTGCTTGTGTTCTCGGATGAAGTATCGATAAGCTTGCGTTTGAAATGGATCACATTTCTATAGCTTCTCTTCCCGGTATTATGAAAGAACTGTGACCATGAATTCCCTGGGAAAGACTTTCTCTTTAACCGGAGGAAGATCGGCTGGGCGATTGCGCCGCCTCATCTGACTTGGGGAGTTCGACAGCACACTCTTACCTCACATTCGCCACATCAACACCAGCACAATGGGCAGCCGTGCAGCTCTCAAGGCACCAGAGTCTTACTTCAAAGAGCTGAAAAGAGATTACAAGTGAAAAAGGAGACTCTGGTTAAGGGTTTGAAGGAAGTCGGATTTACAGTGTTCCATCGAGCGGGACTTACTTTGTGGTTGCTGATCACACTCCATTTGGAATGGAAACGATGTTGCTTTCTGTGAGTATCTTATTGAAGAAGTTGGGGTCGTTGCGATCCAACGAGCGTCTTTTATCTGAATCCAGAAGAAGGGAAGAATTTGGTTAGGTTGCGTTCTGTAAAGACGAAGAGACGTTGCGTGGTGCAATTGAGAGGATGAAGCGAAGCTTAAGAGAAAAGTCTGA EQ ID NO: 28 Gambia p1305.1 with (3' end of) rbcS3C+Arabidopsis GPT. nderlined ATG is start site, parentheses are the cat! intron and the underlined tagt is the spel cioning site used to splice in the Arabldopsis gene. AAAAAGAAAAAAAAAACATATCTTGTTTGTCAGTATGGGAAGTTTGAGATAAGGCGAGTGAGGGGTTAAAATTCAGTGGCCATTGATTTTGTAATGCCAAGAACCACAAATCCAATGGTTACCATTCCTGTAAGATGAGGTTTGCTAACTCTTTTTGTCCGTAGATAGGAAGCCTTATCACTATATATACAAGGCGTCCTAATAACCTCTTAGTACCAATTATTTCAGCACCiArGGTAGATCTGAGG(GTAAATTTCTAGTTTTTCTCCTCATTTTCTTGGTTAGGACCCTTTTCTCTTTTTATTTTTTTGAGCTTTGATCTTTCTTAAACTGATCTATTTTTTAATTGATTGGTTATGGTGTAAATATTACATAGCTTTAATGATAATCTGATTACTTTATTTCGTGTGTCTATGATGATGATGATAGTTACAG)ACCGACGAΛCTΛGTATGTACCTGGACATAAATGGTGTGATGATCAAACAGTTTACTTCAAAGCCTCTCTTCTCCCATTCTCTTCTAATTTCCGACAAAGCTCCGCCAAATCCATCGTCCTATCGGAGCCACCATGACCACAGTTTCGACTCAGAACGAGTCACTCAAAAACCCGTCCAGGTGGCGAAGAGATTAGAGAAGTTCAAGACTACTATTTCACTCAAATGAGCATATTGGCAGTTAAACATGGAGCGATCAATTTAGGCCAAGCTTTCCCAATTTCGACGGTCCTGATTTTGTTAAAGAAGCTGCGATCCAAGCTATAAAGATGGTAAAAACCAGTATGCTCGTGGATACGGCATTCCTCAGCTCAACTTGCTATAGCTGCGCGGTTTCGTGAAGATACGGGTCTTGTTGTTGATCCTGAGAAGAAGTTACTGTTACATCTGGTTGCACAGAAGCCATAGCTGCAGCTATGTTGGTTTAATAAACCCTGGTGATGAAGTCATTCTCTTTGCACCGTΠTATGATTCCTATAAGCAACACTCTCTATGGCTGGTGCTAAAGTAAAAGGAATCACTTTACGTCCACGGACTTCTCCATCCCTTTGGAAGAGCTTAAAGCTGCGGTAACTAACAAGACTGAGCCATCCTTATGAACACTCCGCACAACCCGACCGGGAAGATGTTCACTAGGAGGAGCTTGAAACCATTGCATCTCTCTGCATTGAAAACGATGTGCTTGTGTTTCGGATGAAGTATACGATAAGCTTGCGTTTGAAATGGATCACATTTCTATAGCTCTCTTCCCGGTATGTATGAAAGAACTGTGACCATGAATTCCCTGGGAAAGACTTCTCTTTAACCGGATGGAAGATCGGCTGGGCGATTGCGCCGCCTCATCTGACTT GGGAGTTCGACAAGCACACTCTTACCTCACATTCGCCACATCAACACCAGCACATGGGCAGCCGTTGCAGCTCTCAAGGCACCAGAGTCTTACTTCAAAGAGCTGAAAGAGATTACAATGTGAAAAAGGAGACTCTGGTTAAGGGTTTGAAGGAAGTCGATTTACAGTGTTCCCATCGAGCGGGACTTACTTTGTGGTTGCTGATCACACTCATTTGGAATGGAGAACGATGTTGCTTTCTGTGAGTATCTTATTGAAGAAGTTGGGTCGTTGCGATCCCAACGAGCGTCTTTTATCTGAATCCAGAAGAAGGGAAGAATTGGTTAGGTTTGCGTTCTGTAAAGACGAAGAGACGTTGCGTGGTGCAATTGAAGGATGAAGCAGAAGCTTAAGAGAAAAGTCTGA EQ ID NO: 29 Arabidpsis GPT coding sequence (mature protein, no targeting quence) TGGCGAAGAGATTAGAGAAGTTCAAGACTACTATTTTCACTCAAATGAGCATATGGCAGTTAMCATGGAGCGATCMTTTAGGCCAAGGCTTTCCCAATTTCGACGTCCTGATTTTGTTAMGMGCTGCGATCCMGCTATTAMGATGGTMMACCATATGCTCGTGGATACGGCATTCCTCAGCTCMCTCTGCTATAGCTGCGCGGTTCGTGMGATACGGGTCTTGTTGTTGATCCTGAGAMGMGTTACTGTTACATCTGTTGCACAGMGCCATAGCTGCAGCTATGTTGGGTTTMTAMCCCTGGTGATAAGTCATTCTCTTTGCACCGTTTTATGATTCCTATGAAGCAACACTCTCTATGGTGGTGCTAAAGTAAMGGMTCACTTTACGTCCACCGGACTTCTCCATCCCTTTGMGAGCTTAMGCTGCGGTMCTMCMGACTCGAGCCATCCTTATGMCACCCGCACMCCCGACCGGGMGATGTTCACTAGGGAGGAGCTTGAMCCATTGATCTCTCTGCATTGAAMCGATGTGCTTGTGTTCTCGGATGMGTATACGATMCTTGCGTTTGAMTGGATCACATTTCTATAGCTTCTCTTCCCGGTATGTATGMGMCTGTGACCATGMTTCCCTGGGAMGACTTTCTCTTTMCCGGATGGMGTCGGCTGGGCGATTGCGCCGCCTCATCTGACTTGGGGAGTTCGACMGCACATCTTACCTCACATTCGCCACATCAACACCAGCACAATGGGCAGCCGTTGCAGCCTCMGGCACCAGAGTCTTACTTCAMGAGCTGAAMGAGATTACMTGTGAMAGGAGACTCTGGTTMGGGTTTGMGGMGTCGGATTTACAGTGTTCCCATCGGCGGGACTTACTTTGTGGTTGCTGATCACACTCCATTTGGMTGGAGMCGATTTGCTTTCTGTGAGTATCTTATTGMGMGTTGGGGTCGTTGCGATCCCMCGGCGTCTTTTATCTGAATCCAGMGMGGGMGMTTTGGTTAGGTTTGCGTTCTTAMGACGMGAGACGTTGCGTGGTGCMTTGAGAGGATGAAGCAGMGCTTAGAGAAMGTCTGA EQ ID NO: 30 Arabidpsis GPT amino acid sequence {mature protein, no targeting quence) AKRLEKFKTTIFTQMSILAVKHGAINLGQGFPNFDGPDFVKEMIQAIKDGKNQYARYGIPQLNSAIMRFREDTGLWDPEKEVTVTSGCTEAIAMMLGLINPGDEVILFAPYDSYEATLSMAGAKVKGITLRPPDFSIPLEELKAAVTNKTRAiLMNTPHNPTGKMFTEELETIASLCIENDVLVFSDEVYDKLAFEMDHISIASLPGMYERTVTMNSLGKTFSL GWKIGWAIAPPHLTWGVRQAHSYLTFATSTPAQWAAVAALKAPESYFKELKRDYNKKETLVKGLKEVGFTVFPSSGTYFWADHTPFGMENDVAFCEYLIEEVGWAIPTSFYLNPEEGKNLVRFAFCKDEETLRGAIERMKQKLKRKV EQ ID NO: 31 Grape GPT amino acid sequence (mature protein, no targeting quence) AKRLEKFKTTIFTQMSMLAiKHGAINLGQGFPNFDGPEFVKEAAIQAIKDGKNQYARYGVPDLNSAVADRFKKDTGLWDPEKEVTVTSGCTEAIAATMLGLINPGDEVILFAFYDSYEATLSMAGAQIKSITLRPPDFAVPMDELKSAISKNTRAILINTPHNPTGKMFTEELNVIASLCIENDVLVFTDEVYDKLAFEMDHISMASLPGMYERTVTMNSLGKTFSTGWKIGWTVAPPHLTWGVRQAHSFLTFATCTPMQWAAATALRAPDSYYEELKRDSAKKAILVEGLKAVGFRVYPSSGTYFWVDHTPFGLKDDIAFCEYLIKEVGWAIPTVFYLHPEDGKNLVRFTFCKDEGTLRAAVERMKEKLKPKQ EQ ID NO: 32 Rice GPT amino acid sequence (mature protein, no targeting quence) AKRLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPDFVKEAAIQAINAGKNQYARYGVPELNSAIAERFLKDSGLQVDPEKEVTVTSGCTEAIAATILGLINPGDEVILFAPFDSYEATLSMAGANVKAITLRPPDFSVPLEELKAAVSKNTRAIMINTPHNPTGKMFTEELEFIATLCKENDVLLFADEVYDKLAFEADHISMASIPGMYERTVTMNSLGKTFSLGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQAAAAAALRAPDSYYEELRRDYAKKALLVNGLKDAGFIVYPSSGTYFVMVDHTPFGFDNDIEFCEYLIREVGWAIPPSFYLNPEDGKNLVRFTFCKDDETLRAAVERMKTKLRKK EQ ID NO: 33 Soybean GPT amino acid sequence (-1 mature protein, no targeting quence) KRLEKFQTTIFTQMSLLAIKHGAINLGQGFPNFDGPEFVKEAAIQAIRDGKNQYARGGVPDLNIAIAERFKKDTGLWDPEKEiTVTSGCTEAIAATMIGLINPGDEVIMFAPFYSYEATLSMAGAKVKGITLRPPDFAVPLEELKSTISKNTRAILINTPHNPTGKMFTRELNCIASLCIENDVLVFTDEVYDKLAFDMEHISMASLPGMFERTVTLNSLGKTFSLTG KIGWAIAPPHLSWGVRQAHAFLTFATAHPFQCAAAAALRAPDSYYVELKRDYMAKAILIEGLKAVGFKVFPSSGTYFVWDHTPFGLENDVAFCEYLVKEVGWAIPTSVFYNPEEGKNLVRFTFCKDEETIRSAVERMKAKLRKVD EQ ID NO: 34 Barley GPT amino add sequence (mature protein, no targeting AKRLEKFKTTIFTQMSMLAVKHGAINIGQGFPNFDGPDFVKDAAIEAIKAGKNQYAGYGVPELNSAVAERFLKDSGLHIOPDKEVTVTSGCTEAIAATILGLINPGDEVILFAPYDSYEATLSMAGANVKAITLRPPDFAVPLEELKAAVSKNTRAIMINTPHNPTGKMFTEELEFIADLCKENDVLLFADEVYDKLAFEADHISMASIPGMYERTVTMNSLGKTFSLGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQSAAAAALRAPDSYFEELKRDYGKKALLVDGLKAAGFIVYPSSGTYFIMVDHTPFGFDNDVEFCEYLIREVGWAIPPSVYLNPEDGKNLVRFTFCKDDDTLRAAVDRMKAKLRKK EQ ID NO: 35 Zebra fish GPT amino acid sequence (mature protein, no targeting quence) AKRLEKFKTTJFTQMSMLAIKHGAINLGQGFPNFDGPDFVKEAAIQAIRDGNNQYAGYGVPDLNIAISERYKKDTGLAVDPEKEITVTSGCTEAIAATVLGLINPGDEVIVFAPYDSYEATLSMAGAKVKGITLRPPDFALPIEELKSTISKNTRAILLNTPHNPTGKMFTPELNTIASLCIENDVLVFSDEVYDKLAFDMEHISIASLPGMFERTVTMNSLGKTFSLTWKIGWAIAPPHLTWGVRQAHAFLTFATSNPMQWAAAVALRAPDSYYTELKRDYMKRSILVEGLKAVGFKVFPSSGTYFVWDHTPFGHENDIAFCEYLVKEVGWAIPTSVYLNPEEGKNLVRFTFCKDEGTLRAAVDRMKEKLRK EQ ID NO: 36 Bamboo GPT amino acid sequence (mature protein, no targeting quence) AKRLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPDFVKEAAIQAINAGKNQYARYGVPELNSAVAERFLKDSGLQVDPEKEVTVTSGCTEAIAATILGLINPGDEVILFAPYDSYEATLSMAGANVKAITLRPPDFAVPLEELKATVSKNTRAIMINTPHNPTGKMFSEELEFIATLCKKNDVLLFADEVYDKLAFEADHISMASIPGMYERTVTMNSLGKTFSLGWKIGWAIAPPHLTWGVRQAHSFLTFATCTPMQSAAAAALRAPDSYYGELKRDYAKKAILVDGLKAAGFiVYPSSGTYFVMVDHTPFGFDNDIEFCEYLIREVGWAIPPSFYLNPEDGKNLVRFTFCKDDDTLRAAVERMKTKLRKK

Claims

WHAT IS CLAIMED IS:
1. A transgenic plant comprising a GPT transgene and a GS transgene, wherein said GPT transgene and said GS transgene are operably linked to a plant promoter.
2. The transgenic plant of claim 1, wherein the GS transgene is a GS1 transgene.
3. The transgenic plant of claim 1 or 2, wherein the GPT transgene encodes a polypeptide having an amino acid sequence selected from the group consisting of (a)
SEQ ID NO: 2; SEQ ID NO: 9; SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO 24, SEQ ID NO: 30, SEQ ID NO:31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36, and (b) an amino acid sequence that is at least 75% identical to any one of SEQ ID NO: 2; SEQ ID NO: 9; SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 21, SEQ ID NO 24, SEQ ID NO: 30. SEQ ID NO: 31 , SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35 and SEQ ID NO: 36 and has GPT activity.
4. The transgenic plant of claim 3, wherein the GS transgene encodes a polypeptide. having an amino acid sequence selected form the group consisting of (a) SEQ ID
NO: 4 and SEQ ID NO: 7 from residue 11 , and (b) an amino acid sequence that is at east 75% identical to SEQ ID NO: 4 or SEQ ID NO: 7.
5. The transgenic plant according to claims 1-4, wherein the GPT and GS transgenes are incorporated into the genome of the plant.
6. The transgenic plant of claim 5, further defined as a monocotyledonous plant.
7. The transgenic plant of claim 5, further defined as a dicotyledonous plant.
8. A progeny of any generation of the transgenic plant of daim S, wherein said progeny comprises said GPT transgene and said GS transgene.
9. A seed of any generation of the transgenic plant of claim 5, wherein said seed comprises said GPT transgene and said GS transgene.
10. The transgenic plant of claim 5 which displays an enhanced growth rate when compared to an analogous wild-type or untransformed plant.
11. The transgenic plant of claim 5 which displays increased biomass yield when compared to an analogous wild-type or untransformed plant.
12. The transgenic plant of claim 5 which displays increased seed yield when compared to an analogous wild-type or untransformed plant.
13. The transgenic plant of claim 5 which displays increased flower or flower bud yield when compared to an analogous wild-type or untransformed plant.
14. The transgenic plant of claim 5 which displays increased fruit or pod yield when compared to an analogous wild-type or untransformed plant.
15. The transgenic plant of claim 5 which displays larger leaves when compared to an analogous wild-type or untransformed plant.
16. The transgenic plant of claim 5 which displays increased GPT activity when compared to an analogous wild-type or untransformed plant.
17. The transgenic plant of claim 5 which displays increased GS activity when compared to an analogous wild-type or untransformed plant.
18. The transgenic plant of claim 5 which displays increased 2-oxoglutaramate levels when compared to an analogous wild-type or untransformβd plant.
19. The transgenic plant of claim 5 which displays increased nitrogen use efficiency when compared to an analogous wild-type or untransformed plant.
20. The transgenic plant of claim 5 which displays increased tolerance to salt or saline conditions when compared to an analogous wild-type or untransformed plant.
21. A method for producing a plant having enhanced growth properties relative to an analogous wild type or untransformed plant, comprising:
(a) introducing a GPT transgene into the plant;
(b) introducing a GS transgene into the plant or a progeny of the plant;
(c) expressing the GPT transgene and the GS transgene in the plant or the progeny of the plant; and,
(d) selecting a plant having an increased growth characteristic relative to a plant of the same species that does not comprise a GPT transgene or a GS transgene.
22. A method for producing a plant having enhanced growth properties relative to an analogous wild type or untransformed plant, comprising:
(a) introducing a GS transgene into the plant;
(b) introducing a GPT transgene into the plant or a progeny of the plant;
(c) expressing the GS transgene and the GPT transgene in the plant or the progeny of the plant; and,
(d) selecting a plant having an increased growth characteristic relative to a plant of the same species that does not comprise a GS transgene or a GPT transgene.
23. The method according to claim 21 or 22, wherein the increased growth characteristic is selected from the group consisting of increased biomass, earlier flowering, earlier budding, increased plant height, increased flowering, increased budding, larger leaves, increased fruit or pod yield and increased seed yield.
24. A method of producing a plant having increased nitrogen use efficiency relative o an analogous wild type or untransfoimed plant, comprising:
(a) introducing a GPT transgene into the plant;
(b) introducing a GS transgene into the plant or a progeny of the plant; (c) expressing the GPT transgene and the GS transgene in the plant or the progeny of the plant; and,
(d) selecting a plant having an increased nitrogen use efficiency relative to a plant of the same species that does not comprise a GPT transgene or a GS ransgene.
25. A method of producing a plant having increased nitrogen use efficiency relative o an analogous wild type or untransformed plant, comprising:
(a) introducing a GS transgene into the plant;
(b) introducing a GPT transgene into the plant or a progeny of the plant; (c) expressing the GS transgene and the GPT transgene in the plant or the progeny of the plant; and,
(d) selecting a plant having an increased nitrogen use efficiency relative to a plant of the same species that does not comprise a GS transgene or a GPT ransgene.
26. A method of producing a plant seed having increased tolerance to germination or growth in salt or saline conditions relative to an analogous wild type or untransformed plant, comprising:
(a) introducing a GPT transgene into the plant; (b) introducing a GS transgene into the plant or a progeny of the plant;
(c) expressing the GPT transgene and the GS transgene in the plant or the progeny of the plant;
(d) selecting a plant having an increased growth characteristic relative to a plant of the same species that does not comprise a GPT transgene or a GS transgene; and,
(e) harvesting seeds from said plant and selecting for seeds that demonstrate ncreased germination in high salt conditions.
27. A method of producing a plant seed having increased tolerance to germination in salt or saline conditions relative to an analogous wild type or untransformed plant, comprising:
(a) introducing a GS transgene into the plant;
(b) introducing a GPT transgene into the plant or a progeny of the plant; (c) expressing the GS transgene and the GPT transgene in the plant or the progeny of the plant;
(d) selecting a plant having an increased growth characteristic relative to a plant of the same species that does not comprise a GS transgene or a GPT transgene; and, (e) harvesting seeds from said plant and selecting a seed that demonstrates ncreased germination in high salt conditions.
28. The method according to claim 26 or 27, further comprising propagating a plant from the seed so selected and harvesting a seed therefrom.
EP09810728A 2008-08-29 2009-08-31 TRANSGENIC PLANTS WITH ENHANCED GROWTH CHARACTERISTICS Withdrawn EP2334166A4 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US19052008P 2008-08-29 2008-08-29
PCT/US2009/055557 WO2010025466A2 (en) 2008-08-29 2009-08-31 Transgenic plants with enhanced growth characteristics

Publications (2)

Publication Number Publication Date
EP2334166A2 true EP2334166A2 (en) 2011-06-22
EP2334166A4 EP2334166A4 (en) 2012-01-25

Family

ID=41722345

Family Applications (1)

Application Number Title Priority Date Filing Date
EP09810728A Withdrawn EP2334166A4 (en) 2008-08-29 2009-08-31 TRANSGENIC PLANTS WITH ENHANCED GROWTH CHARACTERISTICS

Country Status (14)

Country Link
EP (1) EP2334166A4 (en)
JP (2) JP5779095B2 (en)
CN (1) CN102405289A (en)
AU (2) AU2009287446C1 (en)
BR (1) BRPI0917919A2 (en)
CA (1) CA2735646A1 (en)
CL (1) CL2011000396A1 (en)
CO (1) CO6341510A2 (en)
IL (1) IL211421A (en)
MX (3) MX357045B (en)
NZ (1) NZ591185A (en)
RU (2) RU2015151684A (en)
WO (1) WO2010025466A2 (en)
ZA (1) ZA201102266B (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2801948C2 (en) * 2018-03-28 2023-08-21 Филип Моррис Продактс С.А. Modulation of the content of reducing sugars in the plant

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110030104A1 (en) 2008-08-29 2011-02-03 Los Alamos National Security, Llc Nucleic acids encoding plant glutamine phenylpyruvate transaminase (GPT) and uses thereof
US20110030089A1 (en) 2008-08-29 2011-02-03 Los Alamos National Security, Llc Transgenic plants with enhanced growth characteristics
CN102405289A (en) * 2008-08-29 2012-04-04 洛斯阿拉莫斯国家安全有限公司 Transgenic plants with enhanced growth characteristics
EA022553B1 (en) 2010-01-22 2016-01-29 Байер Интеллектуэль Проперти Гмбх Use of biologically active ingredient combination, kit and composition comprising biologically active ingredient combination for controlling animal pests and method for improving utilization of production potential of transgenic plant
US9068194B2 (en) 2010-02-28 2015-06-30 Los Alamos National Security, Llc Increasing plant growth by modulating omega-amidase expression in plants
IN2014DN00156A (en) 2011-08-10 2015-05-22 Bayer Ip Gmbh
CN106470544B (en) * 2014-03-10 2019-06-18 以色列国家农业和农村发展农业研究组织沃尔坎尼中心 Melon plants with increased fruit yield
CN113564184B (en) * 2021-07-16 2023-04-18 昆明理工大学 Gastrodia elata glutamine synthetase gene and application thereof

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6107547A (en) * 1993-10-06 2000-08-22 New York University Transgenic plants that exhibit enhanced nitrogen assimilation
EP1591522A3 (en) * 1993-10-06 2005-11-09 New York University Transgenic plants that exhibit enhanced nitrogen assimilation
RU2109446C1 (en) * 1993-10-26 1998-04-27 Евгения Яковлевна Яковенко Method for producing natural plant growth regulator
US20070011783A1 (en) * 1999-05-06 2007-01-11 Jingdong Liu Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement
EP1228222A2 (en) * 1999-11-04 2002-08-07 Incyte Genomics, Inc. Human transferase molecules
US6831040B1 (en) * 2000-01-27 2004-12-14 The Regents Of The University Of California Use of prolines for improving growth and other properties of plants and algae
AU2006204997B2 (en) * 2005-01-12 2011-09-01 Monsanto Technology, Llc Genes and uses for plant improvement
US20080005810A1 (en) * 2006-05-18 2008-01-03 The Governors Of The University Of Alberta Method of conferring multiple stress tolerance and early flowering in plants
WO2008070179A2 (en) * 2006-12-06 2008-06-12 Monsanto Technology, Llc Genes and uses for plant improvement
US8362325B2 (en) * 2007-10-03 2013-01-29 Ceres, Inc. Nucleotide sequences and corresponding polypeptides conferring modulated plant characteristics
CN102405289A (en) * 2008-08-29 2012-04-04 洛斯阿拉莫斯国家安全有限公司 Transgenic plants with enhanced growth characteristics

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2801948C2 (en) * 2018-03-28 2023-08-21 Филип Моррис Продактс С.А. Modulation of the content of reducing sugars in the plant

Also Published As

Publication number Publication date
AU2009287446B2 (en) 2016-01-28
MX357276B (en) 2018-07-03
CN102405289A (en) 2012-04-04
WO2010025466A2 (en) 2010-03-04
RU2582260C2 (en) 2016-04-20
AU2016202733B2 (en) 2017-04-06
AU2009287446C1 (en) 2016-08-11
WO2010025466A3 (en) 2010-04-29
CL2011000396A1 (en) 2012-03-30
NZ591185A (en) 2013-05-31
CA2735646A1 (en) 2010-03-04
JP2012501191A (en) 2012-01-19
JP6163514B2 (en) 2017-07-12
EP2334166A4 (en) 2012-01-25
AU2009287446A1 (en) 2010-03-04
JP5779095B2 (en) 2015-09-16
AU2016202733A1 (en) 2016-05-19
JP2015130896A (en) 2015-07-23
CO6341510A2 (en) 2011-11-21
RU2011111344A (en) 2012-10-10
MX357045B (en) 2018-06-22
RU2015151684A (en) 2019-01-15
MX2011002110A (en) 2011-08-03
ZA201102266B (en) 2012-10-31
BRPI0917919A2 (en) 2015-08-18
IL211421A (en) 2015-03-31

Similar Documents

Publication Publication Date Title
US20100186121A1 (en) Transgenic Plants with Enhanced Growth Characteristics
AU2016202733B2 (en) Transgenic plants with enhanced growth characteristics
US9862964B2 (en) Transgenic plants with enhanced growth characteristics
JP6117837B2 (en) Plant glutamine phenylpyruvate transaminase gene and transgenic plant carrying it
EP2539456A1 (en) Increasing plant growth by modulating omega-amidase expression in plants
WO2011106734A1 (en) Transgenic soybean and rice plants with enhanced growth characteristics
US20100170009A1 (en) Nucleic acids encoding plant glutamine phenylpyruvate transaminase (GPT) and uses thereof
US20100263090A1 (en) Plant Glutamine Phenylpyruvate Transaminase Gene and Transgenic Plants Carrying Same
US20130232641A1 (en) Plant glutamine phenylpyruvate transaminase gene and transgenic plants carrying same
US10119127B2 (en) Nucleic acids encoding plant glutamine phenylpyruvate transaminase (GPT) and uses thereof
US20170121728A1 (en) Plant glutamine phenylpyruvate transaminase gene and transgenic plants carrying same
WO2010025463A2 (en) Nucleic acids encoding plant glutamine phenylpyruvate transaminase (gpt) and uses thereof

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20110329

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO SE SI SK SM TR

AX Request for extension of the european patent

Extension state: AL BA RS

A4 Supplementary search report drawn up and despatched

Effective date: 20111228

RIC1 Information provided on ipc code assigned before grant

Ipc: C12N 9/10 20060101ALI20111221BHEP

Ipc: C12N 15/82 20060101ALI20111221BHEP

Ipc: A01H 5/00 20060101AFI20111221BHEP

17Q First examination report despatched

Effective date: 20140408

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20170829