EP2308889A1 - Isoforms of brain natriuretic peptide - Google Patents

Isoforms of brain natriuretic peptide Download PDF

Info

Publication number
EP2308889A1
EP2308889A1 EP10187879A EP10187879A EP2308889A1 EP 2308889 A1 EP2308889 A1 EP 2308889A1 EP 10187879 A EP10187879 A EP 10187879A EP 10187879 A EP10187879 A EP 10187879A EP 2308889 A1 EP2308889 A1 EP 2308889A1
Authority
EP
European Patent Office
Prior art keywords
seq
sequence
polypeptide
bnp2
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
EP10187879A
Other languages
German (de)
French (fr)
Other versions
EP2308889B1 (en
Inventor
Shuchong Pan
Robert D. Simari
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mayo Foundation for Medical Education and Research
Mayo Clinic in Florida
Original Assignee
Mayo Foundation for Medical Education and Research
Mayo Clinic in Florida
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Mayo Foundation for Medical Education and Research, Mayo Clinic in Florida filed Critical Mayo Foundation for Medical Education and Research
Publication of EP2308889A1 publication Critical patent/EP2308889A1/en
Application granted granted Critical
Publication of EP2308889B1 publication Critical patent/EP2308889B1/en
Anticipated expiration legal-status Critical
Expired - Lifetime legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/58Atrial natriuretic factor complex; Atriopeptin; Atrial natriuretic peptide [ANP]; Cardionatrin; Cardiodilatin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/26Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/575Hormones
    • G01N2333/58Atrial natriuretic factor complex; Atriopeptin; Atrial natriuretic peptide [ANP]; Brain natriuretic peptide [BNP, proBNP]; Cardionatrin; Cardiodilatin
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/32Cardiovascular disorders
    • G01N2800/325Heart failure or cardiac arrest, e.g. cardiomyopathy, congestive heart failure

Definitions

  • the invention relates to methods and materials for diagnosing heart conditions such as heart failure, and more particularly, for diagnosing heart conditions by detecting isoforms of brain natriuretic peptide (BNP).
  • BNP brain natriuretic peptide
  • the invention also relates to methods and materials for treating heart conditions (e.g., heart failure) and kidney conditions (e.g., kidney failure).
  • Atrial natriuretic peptide is secreted by atrial myocytes in response to increased intravascular volume. Once ANP is in the circulation, its effects are primarily on the kidney, vascular tissue, and adrenal gland, in which its actions lead to the excretion of sodium and water by the kidneys and a decrease in intravascular volume and blood pressure.
  • BNP also is of myocardial cell origin, and like ANP, it circulates in human plasma. BNP is natriuretic, rennin inhibiting, vasodilating, and lusitropic.
  • BNP The main circulating and storage form of BNP is a 32 amino acid peptide with a ring structure.
  • Physiological actions of BNP are mediated through a guanylate cyclase-linked receptor, natriuretic peptide receptor A (NPR-A). Clearance of BNP is promoted by a NPR-C receptor that removes it from the circulation. BNP also is degraded through enzymatic cleavage by neutral endopeptidase.
  • C-type natriuretic peptide (CNP) is of endothelial cell origin and functions as a vasodilating and growth-inhibiting peptide.
  • Dendroaspis natriuretic peptide DNP is similar in structure to ANP, BNP, and CNP, and is isolated from the venom of Dendoaspis angusticeps or green mamba snake.
  • ANP and BNP are increased in the plasma and heart during congestive heart failure in humans, and exert cardiorenal protective actions in addition to serving as serum markers for ventricular dysfunction.
  • Epidemiological evidence indicates that at least 3% of the adult population above the age of 45 may have ventricular systolic dysfunction and 52% may be asymptomatic.
  • the invention is based on the identification of novel forms of BNP generated by alternative splicing.
  • Alternatively spliced human BNP isoforms contain the 17-aminoacid disulfide ring structure of BNP, have unique carboxy-termini, and result from distinct splicing variation.
  • One of the isoform, BNP2 has a unique 33 amino acid residue C-terminal extension attached to the ring. This isoform is the result of intron 2 inclusion.
  • BNP3 contains a novel 14 amino acid residue C-terminal extension and is the result of an alternative splice acceptor present within intron 2. As described herein, expression of BNP2 and BNP3 is increased in cardiomyocytes during heart failure.
  • BNP2 and BNP3 polypeptides or ribonucleic acids encoding BNP2 or BNP3 can be used as markers for heart conditions.
  • the presence, absence, or level of such polypeptides or ribonucleic acids can be used to diagnose heart conditions and monitor treatment of heart conditions.
  • BNP2 and BNP3 can be used as therapeutics for the treatment of heart conditions.
  • the invention features a purified polypeptide and an antibody having specific binding affinity for the polypeptide.
  • the polypeptide includes an amino acid sequence selected from the group consisting of the amino acid sequence of SEQ ID NO:1, 2, 3, 4, 35, or 36; a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length.
  • the amino acid sequence can have at least 75% (e.g., 80, 90, or 95%) sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2 or at least 75% (e.g., 80, 90, or 95%) sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least 6 contiguous residues in length.
  • the polypeptide can include the amino acid sequence of SEQ ID NO:35 or SEQ ID NO:36.
  • Pharmaceutical compositions can include a polypeptide and a pharmaceutically acceptable carrier.
  • the invention features an isolated nucleic acid encoding a purified polypeptide described above, vectors that include the nucleic acids, and host cells that include the vectors.
  • the polypeptide can be encoded by the nucleic acid sequence of SEQ ID NO:5; the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO:5; the nucleic acid sequence of SEQ ID NO:6; or the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO:6.
  • the host cells can be eukaryotic host cells.
  • the invention also features a chimeric natriuretic polypeptide.
  • the polypeptide includes a first region and a second region, the first region having an amino acid sequence selected from the group consisting of a) the sequence of residues 1 to 27 of SEQ ID NO:16; b) the sequence of residues 1 to 25 of SEQ ID NO:17; c) the sequence of residues 1 to 23 of SEQ ID NO:18; d) the sequence of residues 1 to 22 of SEQ ID NO:19; and e) the sequence of a), b), c), or d) with one to five amino acid substitutions; and the second region having an amino acid sequence selected from the group consisting of: f) the sequence of SEQ ID NO:1 or SEQ ID NO:2; g) a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; h) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or
  • the invention features a purified polypeptide that includes an amino acid sequence of the formula: Gly-Xaa 1 - Xaa 2 - Xaa 3 - Xaa 4 - Xaa 5 - Xaa 6 - Xaa 7 -Xaa 8 - Xaa 9 - Xaa 10 - Xaa 11 - Xaa 12 - Xaa 13 - Xaa 14 - Xaa 15 -Xaa 16 - Xaa 17 - Xaa 18 - Xaa 19 -Xaa 20 - Xaa 21 - Xaa 22 - Xaa 23 - Xaa 24 - Xaa 25 - Xaa 26 - Xaa 27 - Xaa 28 - Gly- Xaa 29 - Xaa 30 -Xaa 31 - Xaa 32 (SEQ ID NO:20),
  • the invention features a method for diagnosing a heart condition in a patient.
  • the method includes providing a biological sample from the patient; detecting the presence, absence, or level of BNP2 or BNP3 in the biological sample; and classifying the patient as having the heart condition or not having the heart condition based, at least in part, on the presence of BNP-2 or BNP-3, the level of BNP2 or BNP3, or the absence of BNP2 or BNP3.
  • the heart condition can be heart failure, unstable angina, acute myocardial infarction, or hypertension.
  • the presence, absence, or level of BNP2 can be detected or the presence, absence, or level of BNP3 can be detected. In some embodiments, the presence, absence, or level of BNP2 and BNP3 is detected.
  • a heart condition also can be diagnosed in a patient by providing a biological sample from the patient; detecting the presence, absence, or level of a ribonucleic acid encoding BNP2 or BNP3 in the biological sample; and classifying the patient as having the heart condition or not having the heart condition based, at least in part, on the presence of the ribonucleic acid encoding BNP2 or BNP3, the level of the ribonucleic acid encoding BNP2 or BNP3, or the absence of the ribonucleic acid encoding BNP2 or BNP3.
  • the heart condition can be heart failure, unstable angina, acute myocardial infarction, or hypertension.
  • the invention features a method for treating a heart condition in a mammal.
  • the method includes administering a polypeptide or a nucleic acid to the mammal under conditions wherein the severity of a symptom of the heart condition is reduced.
  • the polypeptide includes an amino acid sequence selected from the group consisting of the amino acid sequence ofSEQ ID NO:1, 2, 3, 4, 35, or 36; a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO: or SEQ ID NO:2; a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length.
  • the amino acid sequence can have at least 75% (e.g., 80, 90, or 95%) sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2 or at least 75% (e.g., 80, 90, or 95%) sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least 6 contiguous residues in length.
  • the polypeptide can include the amino acid sequence of SEQ ID NO:35 or SEQ ID NO:36.
  • the nucleic acid contains a sequence encoding a polypeptide described above.
  • the polypeptide can be encoded by the nucleic acid sequence of SEQ ID NO:5; the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO:5; the nucleic acid sequence of SEQ ID NO:6; or the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO:6.
  • the heart condition can be heart failure, unstable angina, acute myocardial infarction, and/or hypertension.
  • the invention features a method for treating a kidney condition in a mammal.
  • the method includes administering a polypeptide or a nucleic acid to the mammal under conditions wherein the severity of a symptom of the kidney condition is reduced.
  • the polypeptide includes an amino acid sequence selected from the group consisting of the amino acid sequence of SEQ ID NO:1, 2, 3, 4, 35, or 36; a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length.
  • the amino acid sequence can have at least 75% (e.g., 80, 90, or 95%) sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2 or at least 75% (e.g., 80, 90, or 95%) sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least 6 contiguous residues in length.
  • the polypeptide can include the amino acid sequence of SEQ ID NO:35 or SEQ ID NO:36.
  • the nucleic acid contains a sequence encoding a polypeptide described above.
  • the polypeptide can be encoded by the nucleic acid sequence of SEQ ID NO:5; the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO:5; the nucleic acid sequence of SEQ ID NO:6; or the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO:6.
  • the kidney condition can be kidney failure.
  • the invention features a method for increasing cGMP within a mammal.
  • the method includes administering a polypeptide described herein or a nucleic acid encoding said polypeptide to the mammal under conditions wherein the level of cGMP within the mammal is increased.
  • the invention features a method for dilating an artery within a mammal.
  • the method includes administering a polypeptide described herein or a nucleic acid encoding said polypeptide to the mammal under conditions wherein said artery dilates.
  • the invention features a method for increasing diuresis and/or natriuresis in a mammal.
  • the method includes administering a polypeptide described herein or a nucleic acid encoding said polypeptide to the mammal under conditions wherein diuresis and/or natriuresis increases.
  • the invention features a purified antibody.
  • the antibody binds to a BNP2 polypeptide, and does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO:16 or to a BNP3 polypeptide consisting of the sequence set forth in SEQ ID NO:4.
  • the BNP2 polypeptide can contain the sequence set forth in SEQ ID NO:1.
  • the antibody can be a monoclonal antibody.
  • the invention features a purified antibody.
  • the antibody binds to a BNP3 polypeptide, and does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO:16 or to a BNP2 polypeptide consisting of the sequence set forth in SEQ ID NO:3.
  • the BNP3 polypeptide can contain the sequence set forth in SEQ ID NO:2.
  • the antibody can be a monoclonal antibody.
  • the invention provides isoforms of BNP, including BNP2 and BNP3 polypeptides, and methods of using the isoforms as markers for various heart conditions, including heart failure, hypertension, unstable angina, sudden cardiac death, and acute myocardial infarction, as well as renal failure.
  • BNP2 and BNP3 are present in biological samples from patients with failing hearts but are absent or at low levels in biological samples from control patients. Consequently, the presence or level of BNP2 or BNP3 can be detected in biological samples and used to diagnose heart conditions, monitor treatment for heart conditions, or track progression of heart disease.
  • the presence or level of BNP isoforms can be assessed by either measuring BNP2 or BNP3 polypeptides or ribonucleic acids encoding BNP2 or BNP3 as described below.
  • polypeptides provided herein may be used as therapeutics for the treatment of heart conditions and/or kidney conditions.
  • Therapeutic effects of BNP2 and BNP3 may be similar to BNP, which is a balanced vasodilator with no inotropic nor chronotropic properties.
  • Intravenous therapy with recombinant BNP significantly decreases pulmonary capillary wedge pressure and systemic vascular resistance and increases cardiac index.
  • BNP is not pro-arrhythmic and has no effect on heart rate. Burger and Burger, Curr. Opin. Investig. Drugs 2(7):929-35 (2001 ).
  • the polypeptides provided herein e.g., BNP2 and BNP3 or nucleic acids encoding such polypeptides can be used to stimulate cGMP and/or vasodilate arteries in a mammal.
  • the polypeptides provided herein e.g., BNP2 and BNP3 or nucleic acids encoding such polypeptides can be used to treat hypertension, pulmonary hypertension, and/or congestive heart failure.
  • the polypeptides provided herein (e.g., BNP2 and BNP3) or nucleic acids encoding such polypeptides can be used increase diuresis and/or natriuresis in a mammal.
  • a BNP2 or BNP3 polypeptide can be administered to a mammal to increase urinary flow and urinary excretion of sodium.
  • the polypeptides provided herein e.g., BNP2 and BNP3 or nucleic acids encoding such polypeptides can be used to treat a fluid overload state (e.g., congestive heart failure, liver failure, and kidney failure) and/or to treat a sodium overloaded state (e.g., congestive heart failure).
  • the invention features purified isoforms of BNP.
  • purified with reference to an isoform of BNP means that the polypeptide is substantially free of other polypeptides, lipids, carbohydrates, and nucleic acid with which it is naturally associated.
  • a purified polypeptide is any polypeptide that is removed from its natural environment and is at least 60 percent pure.
  • a purified polypeptide can be at least about 65, 70, 75, 80, 85, 90, 95, or 99 percent pure.
  • a purified polypeptide will yield a single major band on a non-reducing polyacrylamide gel.
  • An isoform of BNP refers to any polypeptide that (1) has the amino acid sequence set forth in SEQ ID NO:1, 2, 3, 4, 14, 35, or 36, (2) contains an amino acid sequence having a length of about 6, 7, 8, 9, 10, 11, 12, 13, 14, or more amino acid residues with at least about 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or more percent identity over that length to the amino acid sequence set forth in SEQ ID NO:1 or 2, or (3) contains about 6, 7, 8, 9, 10, 11, 12, 13, 14 or more consecutive amino acid residues encoded by a nucleic acid sequence that hybridizes, under hybridization conditions (see below), to the sense or antisense strand of a nucleic acid encoding the sequence set forth in SEQ ID NO:1 or 2.
  • a polypeptide can contain an amino acid sequence of 10, 15, 20, 25, 30 or more residues in length and have at least 45% identity with the amino acid sequence of SEQ ID NO:1, which contains the 33 amino acid C-terminal fragment of human BNP2 (see FIG. 1A ).
  • the full-length amino acid sequence of human BNP2 is set forth in SEQ ID NO:3 and the sequence of the mature BNP2 polypeptide is set forth in SEQ ID NO:36 (see the underlined sequence in FIG. 1A ).
  • SEQ ID NO:2 contains the 14 amino acid C-terminal fragment of human BNP3 (see FIG. 2 ).
  • the full-length amino acid sequence of human BNP3 is set forth in SEQ ID NO:4 while the sequence of the mature BNP3 polypeptide is set forth in SEQ ID NO:35 (see underlined sequence in FIG. 2 ).
  • Non-limiting examples of polypeptide sequences that have at least 45% identity to the polypeptide sequence set forth in SEQ ID NO:1 include the C-terminal BNP2 polypeptide sequences depicted in FIG. 3 .
  • the C-terminal BNP2 sequences from human (SEQ ID NO:1) and pig (SEQ ID NO:8) have about 48% identity.
  • the C-terminal BNP2 sequences from human (SEQ ID NO:1) and mouse (SEQ ID NO:11) have about 67% identity.
  • the C-terminal BNP2 sequences from human (SEQ ID NO:1) and orangutan (SEQ ID NO:7) have about 91 % identity.
  • the C-terminal BNP2 sequences from human (SEQ ID NO:1), chimpanzee (SEQ ID NO:9), and gorilla (SEQ ID NO:12) have about 97% identity.
  • the length and percent identity over that length for any amino acid sequence is determined as follows. First, an amino acid sequence is compared to the identified amino acid sequence (e.g., SEQ ID NO:1) using the BLAST 2 Sequences (B12seq) program from the stand-alone version of BLASTZ containing BLASTN version 2.0.14 and BLASTP version 2.0.14. This stand-alone version of BLASTZ can be obtained from the world wide web at Fish & Richardson P.C.'s web site ("fr” dot "com/blast/”) or at the U.S. government's National Center for Biotechnology Information web site ("ncbi” dot "nlm” dot "nih” dot "gov”).
  • B12seq BLAST 2 Sequences
  • B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
  • BLASTN is used to compare nucleic acid sequences
  • BLASTP is used to compare amino acid sequences.
  • Bl2seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C: ⁇ seq1.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C: ⁇ seq2.txt); -p is set to blastp; -o is set to any desired file name (e.g., C: ⁇ output.txt); and all other options are left at their default setting.
  • -i is set to a file containing the first amino acid sequence to be compared (e.g., C: ⁇ seq1.txt)
  • -j is set to a file containing the second amino acid sequence to be compared (e.g., C: ⁇ seq2.txt)
  • -p is set to blastp
  • -o is set to any desired file name (e.g., C: ⁇ output.txt); and all other options are left at
  • the following command can be used to generate an output file containing a comparison between two amino acid sequences: C: ⁇ B12seq -i c: ⁇ seql.txt -j c: ⁇ seq2.txt ⁇ p blastp ⁇ o c: ⁇ output.txt. If the target sequence shares homology with any portion of the identified sequence, then the designated output file will present those regions of homology as aligned sequences. If the target sequence does not share homology with any portion of the identified sequence, then the designated output file will not present aligned sequences.
  • a length is determined by counting the number of consecutive amino acid residues from the target sequence presented in alignment with sequence from the identified sequence (e.g., SEQ ID NO:1) starting with any matched position and ending with any other matched position.
  • a matched position is any position where an identical amino acid residue is presented in both the target and identified sequence. Gaps presented in the target sequence are not counted since gaps are not amino acid residues. Likewise, gaps presented in the identified sequence are not counted since target sequence amino acid residues are counted, not amino acid residues from the identified sequence.
  • a single amino acid target sequence that aligns with the sequence set forth in SEQ ID NO:1 can have many different lengths with each length having its own percent identity. It is noted that the percent identity value is rounded to the nearest tenth. For example, 78.11, 78.12, 78.13, and 78.14 is rounded down to 78.1, while 78.15, 78.16, 78.17, 78.18, and 78.19 is rounded up to 78.2. It is also noted that the length value will always be an integer.
  • the hybridization conditions can be moderately or highly stringent hybridization conditions.
  • moderately stringent hybridization conditions mean the hybridization is performed at about 42°C in a hybridization solution containing 25 mM KPO 4 (pH 7.4), 5X SSC, 5X Denhart's solution, 50 ⁇ g/mL denatured, sonicated salmon sperm DNA, 50% formamide, 10% Dextran sulfate, and 1-15 ⁇ g/mL probe (about 5x10 7 cpm/ ⁇ g), while the washes are performed at about 50°C with a wash solution containing 2X SSC and 0.1% sodium dodecyl sulfate.
  • Highly stringent hybridization conditions mean the hybridization is performed at about 42°C in a hybridization solution containing 25 mM KPO 4 (pH 7.4), 5X SSC, 5X Denhart's solution, 50 ⁇ g/mL denatured, sonicated salmon sperm DNA, 50% formamide, 10% Dextran sulfate, and 1-15 ng/mL probe (about 5x10 7 cpm/ ⁇ g), while the washes are performed at about 65°C with a wash solution containing 0.2X SSC and 0.1% sodium dodecyl sulfate.
  • an isoform of BNP can stimulate production of cGMP in human umbilical vascular endothelial cells (HUVEC). Intracellular cGMP production can be assayed using, for example, the BIOTRACK cGMP enzyme immunoassay kit (Amersham Pharmacia Biotech).
  • the isoform of BNP is vasoactive. Vasoactivity can be assessed by determining responsivity of a blood vessel (e.g., a carotid artery in an organ chamber) to the isoform.
  • Isoforms of BNP can be obtained by extraction from a natural source (e.g., from isolated cells, tissues or bodily fluids), by expression of a recombinant nucleic acid encoding the polypeptide, or by chemical synthesis.
  • a natural source e.g., from isolated cells, tissues or bodily fluids
  • standard recombinant technology using expression vectors encoding isoforms ofBNP (as described below) can be used.
  • the resulting polypeptides then can be purified using, for example, affinity chromatographic techniques and HPLC. The extent of purification can be measured by any appropriate method, including but not limited to: column chromatography, polyacrylamide gel electrophoresis, or high-performance liquid chromatography.
  • Isoforms of BNP can be "engineered” to contain a tag sequence that allows the polypeptide to be purified (e.g., captured onto an affinity matrix).
  • a tag such as c-myc, hemagglutinin, polyhistidine, or FlagTM tag (Kodak) can be used to aid polypeptide purification.
  • tags can be inserted anywhere within the polypeptide including at either the carboxyl or amino termini.
  • Other fusions that can be used include enzymes that aid in the detection of the polypeptide, such as alkaline phosphatase.
  • Chimeric natriuretic polypeptides can be produced that contain two regions, a first region that includes the N-terminus and ring structure of a mature natriuretic polypeptide (e.g., BNP, DNP, ANP, or CNP) and a second region that includes the C-terminal portion of a BNP isoform.
  • the N-terminus and ring structure of BNP includes residues 1 to 27 of SEQ ID NO:16 while the N-termini and ring structures of DNP and ANP include residues 1 to 23 of SEQ ID NO:17 and SEQ ID NO:18, respectively.
  • the sequences of BNP, DNP, ANP, and CNP are presented in FIG. 4 .
  • the first region can contain the N-terminus and ring structure of a naturietic polypeptide with one to five amino acid substitutions.
  • Suitable C-terminal portions of a BNP isoform have at least 45% identity to the amino acid sequences of SEQ ID NO:1 and 2, as discussed above.
  • the C-terminal portion can have the sequence set forth in SEQ ID NO:20 (described below).
  • Chimeric polypeptides can have biological activities of naturietic peptides, including the ability to stimulate cyclic GMP production in cells or vasoactivity.
  • a polypeptide of the invention can have the sequence set forth in the formula: Gly-Xaa 1 - Xaa 2 - Xaa 3 - Xaa 4 - Xaa 5 - Xaa 6 - Xaa 7 - Xaa 8 - Xaa 9 - Xaa 10 -Xaa 11 - Xaa 12 - Xaa 13 - Xaa 14 - Xaa 15 -Xaa 16 - Xaa 17 - Xaa 18 - Xaa 19 - Xaa 20 - Xaa 21 - Xaa 22 -Xaa 23 - Xaa 24 - Xaa 25 - Xaa 26 - Xaa 27 - Xaa 28 - Gly- Xaa 29 - Xaa 30 - Xaa 31- Xaa 32 , (SEQ ID NO:20
  • the amino acids set forth at each position of SEQ ID NO:20 represent the residues that are present in naturally-occurring BNP2 polypeptides, including BNP2 from humans (SEQ ID NO:3); orangutan (SEQ ID NO:7), chimpanzee (SEQ ID NO:9); gorilla (SEQ ID N0:12); cat (SEQ ID NO:12); dog (SEQ ID NO:14); mouse (SEQ ID NO:11); sheep (SEQ ID NO:10); and pig (SEQ ID NO:8).
  • a nucleic acid encoding such polypeptides can be produced as described below.
  • Polypeptides of the invention can be formulated as pharmaceutical compositions by admixture with pharmaceutically acceptable non-toxic excipients or carriers. Such compositions can be administered to a subject in need thereof in an amount effective to treat a heart condition or a kidney condition.
  • Pharmaceutical compositions may be prepared for parenteral administration, particularly in the form of liquid solutions or suspensions in aqueous physiological buffer solutions; for oral administration, particularly in the form of tablets or capsules; or for intranasal administration, particularly in the form of powders, nasal drops, or aerosols.
  • Compositions for other routes of administration may be prepared as desired using standard methods.
  • Formulations for parenteral administration may contain as common excipients sterile water or saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, hydrogenated naphthalenes, and the like.
  • polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, hydrogenated naphthalenes, and the like.
  • biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxethylene-polyoxypropylene copolymers are examples of excipients for controlling the release of the polypeptide in vivo.
  • Other suitable parenteral delivery systems include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
  • Formulations for inhalation administration may contain excipients such as lactose, if desired.
  • Inhalation formulations may be aqueous solutions containing, for example, polyoxyethylene-9-lauryl ether, glycocholate and deoxycholate, or they may be oily solutions for administration in the form of nasal drops. If desired, the compounds can be formulated as gels to be applied intranasally. Formulations for parenteral administration may also include glycocholate for buccal administration
  • tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g. magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulfate). Tablets can be coated by methods known in the art. Preparations for oral administration can also be formulated to give controlled release of the compound.
  • binding agents e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose
  • fillers e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate
  • lubricants e.g. magnesium stearate, tal
  • Nasal preparations can be presented in a liquid form or as a dry product.
  • Nebulised aqueous suspensions or solutions can include carriers or excipients to adjust pH and/or tonicity.
  • the invention also features isolated nucleic acids that encode BNP polypeptides.
  • isolated as used herein with reference to nucleic acid refers to a naturally-occurring nucleic acid that is not immediately contiguous with both of the sequences with which it is immediately contiguous (one on the 5' end and one on the 3' end) in the naturally-occurring genome of the organism from which it is derived.
  • an isolated nucleic acid can be, without limitation, a recombinant DNA molecule of any length, provided one of the nucleic acid sequences normally found immediately flanking that recombinant DNA molecule in a naturally-occurring genome is removed or absent.
  • an isolated nucleic acid includes, without limitation, a recombinant DNA that exists as a separate molecule (e.g., a cDNA or a genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences as well as recombinant DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a retrovirus, adenovirus, or herpes virus), or into the genomic DNA of a prokaryote or eukaryote.
  • an isolated nucleic acid can include a recombinant DNA molecule that is part of a hybrid or fusion nucleic acid sequence.
  • isolated as used herein with reference to nucleic acid also includes any non-naturally-occurring nucleic acid since non-naturally-occurring nucleic acid sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome.
  • non-naturally-occurring nucleic acid such as an engineered nucleic acid is considered to be isolated nucleic acid.
  • Engineered nucleic acid e.g., a nucleic acid encoding the polypeptide of SEQ ID NO:20
  • Isolated non-naturally-occurring nucleic acid can be independent of other sequences, or incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a retrovirus, adenovirus, or herpes virus), or the genomic DNA of a prokaryote or eukaryote.
  • a non-naturally-occurring nucleic acid can include a nucleic acid molecule that is part of a hybrid or fusion nucleic acid sequence.
  • a nucleic acid existing among hundreds to millions of other nucleic acids within, for example, cDNA libraries or genomic libraries, or gel slices containing a genomic DNA restriction digest, is not to be considered an isolated nucleic acid.
  • nucleic acid refers to both RNA and DNA, including mRNA, cDNA, genomic DNA, synthetic (e.g., chemically synthesized) DNA, and nucleic acid analogs.
  • the nucleic acid can be double-stranded or single-stranded, and where single-stranded, can be the sense strand or the antisense strand.
  • nucleic acid can be circular or linear.
  • Nucleic acid analogs can be modified at the base moiety, sugar moiety, or phosphate backbone to improve, for example, stability, hybridization, or solubility of a nucleic acid.
  • Modifications at the base moiety include deoxyuridine for deoxythymidine, and 5-methyl-2'-deoxycytidine and 5-bromo-2'-deoxycytidine for deoxycytidine.
  • Modifications of the sugar moiety can include modification of the 2' hydroxyl of the ribose sugar to form 2'-O-methyl or 2'-O-allyl sugars.
  • the deoxyribose phosphate backbone can be modified to produce morpholino nucleic acids, in which each base moiety is linked to a six-membered, morpholino ring, or peptide nucleic acids, in which the deoxyphosphate backbone is replaced by a pseudopeptide backbone and the four bases are retained.
  • deoxyphosphate backbone can be replaced with, for example, a phosphorothioate or phosphorodithioate backbone, a phosphoroamidite, or an alkyl phosphotriester backbone.
  • Nucleic acids of the invention can have the sequence set forth in SEQ ID NOS: 5 or 6 (see FIGS 1 and 2 ) or have a sequence having at least 45% identity (e.g., 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95 identity) to the sequence set forth in nucleotides 383 to 489 of SEQ ID NO:5 or nucleotides 388 to 432 of SEQ ID NO:6.
  • Nucleotides 383 to 489 of SEQ ID NO:5 encode the amino acid sequence set forth in SEQ ID NO:1.
  • Nucleotides 388 to 432 of SEQ ID NO:6 encode the amino acid sequence set forth in SEQ ID NO:2.
  • Sequence identity can be determined as described above.
  • BLASTN is used to compare nucleic acid sequences.
  • the options are set as follows: -i is set to a file containing the first nucleic acid sequence to be compared (e.g., C: ⁇ seq1.txt); -j is set to a file containing the second nucleic acid sequence to be compared (e.g., C: ⁇ seq2.txt); -p is set to blastn; -o is set to any desired file name (e.g., C: ⁇ output.txt); -q is set to -1; -r is set to 2; and all other options are left at their default setting.
  • the following command will generate an output file containing a comparison between two sequences: C: ⁇ B12seq -i c: ⁇ seq1.txt -j c: ⁇ seq2.txt -p blastn -o c: ⁇ output.txt -q -1 -r 2. If the target sequence shares homology with any portion of the identified sequence, then the designated output file will present those regions of homology as aligned sequences. If the target sequence does not share homology with any portion of the identified sequence, then the designated output file will not present aligned sequences.
  • a length is determined by counting the number of consecutive nucleotides from the target sequence presented in alignment with sequence from the identified sequence starting with any matched position and ending with any other matched position.
  • a matched position is any position where an identical nucleotide is presented in both the target and identified sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides. Likewise, gaps presented in the identified sequence are not counted since target sequence nucleotides are counted, not nucleotides from the identified sequence.
  • isolated nucleic acids are at least 10 nucleotides in length (e.g., 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, 200, 300, 350, 400, or more nucleotides in length).
  • Nucleic acid molecules that are less than full-length can be useful, for example, as primers or probes for diagnostic purposes.
  • Isolated nucleic acid molecules can be produced by standard techniques, including, without limitation, common molecular cloning and chemical nucleic acid synthesis techniques. For example, polymerase chain reaction (PCR) techniques can be used. PCR refers to a procedure or technique in which target nucleic acids are enzymatically amplified.
  • PCR polymerase chain reaction
  • Sequence information from the ends of the region of interest or beyond typically is employed to design oligonucleotide primers that are identical in sequence to opposite strands of the template to be amplified.
  • PCR can be used to amplify specific sequences from DNA as well as RNA, including sequences from total genomic DNA or total cellular RNA.
  • Primers typically are 15 to 50 nucleotides in length, but can range from 10 nucleotides to hundreds of nucleotides in length.
  • a primer can be 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, or 45 nucleotides in length.
  • a primer can be purified from a restriction digest by conventional methods, or can be chemically synthesized.
  • Primers typically are single-stranded for maximum efficiency in amplification, but a primer can be double-stranded. Double-stranded primers are first denatured (e.g., treated with heat) to separate the strands before use in amplification.
  • General PCR techniques are described, for example in PCR Primer: A Laboratory Manual, ed. by Dieffenbach and Dveksler, Cold Spring Harbor Laboratory Press, 1995 .
  • reverse transcriptase can be used to synthesize a complementary DNA (cDNA) strand.
  • Ligase chain reaction, strand displacement amplification, self-sustained sequence replication or nucleic acid sequence-based amplification also can be used to obtain isolated nucleic acids.
  • Isolated nucleic acids also can be chemically synthesized, either as a single nucleic acid molecule (e.g., using automated DNA synthesis in the 3' to 5' direction using phosphoramidite technology) or as a series of oligonucleotides.
  • one or more pairs of long oligonucleotides e.g., >100 nucleotides
  • each pair containing a short segment of complementarity e.g., about 15 nucleotides
  • DNA polymerase is used to extend the oligonucleotides, resulting in a single, double-stranded nucleic acid molecule per oligonucleotide pair, which then can be ligated into a vector.
  • Isolated nucleic acids also can be obtained by mutagenesis.
  • the sequences depicted in FIGS. 1 , 2 , or 3 can be mutated using standard techniques such as, for example, oligonucleotide-directed mutagenesis and/or site-directed mutagenesis through PCR. See, Short Protocols in Molecular Biology,Chapter 8, Green Publishing Associates and John Wiley & Sons, Edited by Ausubel et al., 1992 . Examples of positions to be modified can be identified from the sequence alignment of FIG. 3 .
  • Nucleic acids encoding a polypeptide provided herein can be formulated as pharmaceutical compositions by admixture with pharmaceutically acceptable non-toxic excipients or carriers. Such compositions can be administered to a subject in need thereof in an amount effective to treat a heart condition or a kidney condition.
  • the invention also provides vectors containing nucleic acids such as those described above.
  • a "vector” is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
  • the vectors of the invention can be expression vectors.
  • An "expression vector” is a vector that includes one or more expression control sequences, and an “expression control sequence” is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence.
  • the nucleic acid is operably linked to one or more expression control sequences.
  • "operably linked” means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest.
  • expression control sequences include promoters, enhancers, and transcription terminating regions.
  • a promoter is an expression control sequence composed of a region of a DNA molecule, typically within 100 nucleotides upstream of the point at which transcription starts (generally near the initiation site for RNA polymerase II). To bring a coding sequence under the control of a promoter, it is necessary to position the translation initiation site of the translational reading frame of the polypeptide between one and about fifty nucleotides downstream of the promoter.
  • Enhancers provide expression specificity in terms of time, location, and level. Unlike promoters, enhancers can function when located at various distances from the transcription site. An enhancer also can be located downstream from the transcription initiation site.
  • a coding sequence is "operably linked" and “under the control” of expression control sequences in a cell when RNA polymerase is able to transcribe the coding sequence into mRNA, which then can be translated into the protein encoded by the coding sequence.
  • Suitable expression vectors include, without limitation, plasmids and viral vectors derived from, for example, bacteriophage, baculoviruses, tobacco mosaic virus, herpes viruses, cytomegalovirus, retroviruses, poxviruses, adenoviruses, and adeno-associated viruses. Numerous vectors and expression systems are commercially available from such corporations as Novagen (Madison, WI), Clontech (Palo Alto, CA), Stratagene (La Jolla, CA), and Invitrogen/Life Technologies (Carlsbad, CA).
  • An expression vector can include a tag sequence designed to facilitate subsequent manipulation of the expressed nucleic acid sequence (e.g., purification or localization).
  • Tag sequences such as green fluorescent protein (GFP), glutathione S-transferase (GST), polyhistidine, c-myc, hemagglutinin, or FlagTM tag (Kodak, New Haven, CT) sequences typically are expressed as a fusion with the encoded polypeptide.
  • GFP green fluorescent protein
  • GST glutathione S-transferase
  • polyhistidine e-myc
  • hemagglutinin hemagglutinin
  • FlagTM tag Kodak, New Haven, CT
  • the invention also provides host cells containing vectors of the invention.
  • the term "host cell” is intended to include prokaryotic and eukaryotic cells into which a vector can be introduced. Any method can be used to introduce a vector into a cell. For example, calcium phosphate precipitation, electroporation, heat shock, lipofection, microinjection, and viral-mediated nucleic acid transfer can be used introduce isolated nucleic acid into cells.
  • naked DNA can be delivered directly to cells in vivo as described elsewhere ( U.S. Patent Nos. 5,580,859 and 5,589,466 ).
  • methods of the invention include detecting the presence or absence of an isoform of BNP in a biological sample from a patient (e.g., a human patient) and diagnosing the patient based on the presence or absence of the BNP isoform.
  • the level of the BNP isoform can be determined and compared to the level of the isoform from a control population (e.g., the average level of BNP2 from a plurality of control subjects without heart conditions).
  • a control population e.g., the average level of BNP2 from a plurality of control subjects without heart conditions.
  • Suitable biological samples for detecting isoforms of BNP include, for example, blood (including whole blood, plasma, and serum), urine, saliva, heart tissue, and circulating cells.
  • Additional factors that can be considered when diagnosing heart conditions can include, for example, family history or other genetic factors and the levels of other cardiac markers such as troponin I or T, high sensitive C-reactive protein (hs-CRP), creatine kinase (CK), CK-MB, creatinine, or myoglobin.
  • myoglobin is not cardiac specific, but is released from infarcted myocardium at an early stage (about 2-3 hours post infarction) and returns to normal within about 24 hours.
  • Cardiac isoforms of troponin I and troponin T are specific, but appear in the circulation later than myoglobin (5 to 48 hours post infarction).
  • Myocardial tissue contains one isoform of CK-MB, while skeletal tissue has different isoforms. Antibodies having specific binding affinity for such cardiac markers are available commercially.
  • the presence, absence, or level of a BNP isoform in a subject also can be used to monitor treatment (e.g., treatment with an ACE inhibitor or ⁇ blocker) for a heart condition.
  • treatment e.g., treatment with an ACE inhibitor or ⁇ blocker
  • the subject's baseline level of a BNP isoform before treatment can be compared to the level of the isoform at various time points after treatment (e.g., one or more hours, days, weeks, or months after treatment).
  • a decrease in the level of the BNP isoform relative to the baseline level is indicative of a positive response to treatment.
  • Treatment can be monitored based on a combination of the presence, absence, or level of the BNP isoform and the level of other cardiac markers as described above.
  • Isoforms of BNP such as BNP2 or BNP3 can be detected, for example, immunologically using one or more antibodies.
  • antibody or “antibodies” include intact molecules as well as fragments thereof that are capable of binding to an epitopic determinant of a BNP isoform.
  • epitopic determinants refers to an antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains, and typically have specific three-dimensional structural characteristics, as well as specific charge characteristics.
  • Epitopes generally have at least five contiguous amino acids (a continuous epitope), or alternatively can be a set of noncontiguous amino acids that define a particular structure (e.g., a conformational epitope).
  • the terms "antibody” and “antibodies” include polyclonal antibodies, monoclonal antibodies, humanized or chimeric antibodies, single chain Fv antibody fragments, Fab fragments, and F(ab) 2 fragments.
  • Polyclonal antibodies are heterogenous populations of antibody molecules that are contained in the sera of the immunized animals.
  • Monoclonal antibodies are homogeneous populations of antibodies to a particular epitope of an antigen.
  • Antibody fragments that have specific binding affinity for an isoform of BNP can be generated by known techniques.
  • F(ab')2 fragments can be produced by pepsin digestion of the antibody molecule; Fab fragments can be generated by reducing the disulfide bridges of F(ab')2 fragments.
  • Fab expression libraries can be constructed. See, for example, Huse et al., Science 246:1275 (1989 ). Once produced, antibodies or fragments thereof are tested for recognition of a BNP isoform by standard immunoassay methods including ELISA techniques, radioimmunoassays, and Western blotting. See, Short Protocols in Molecular Biology, Chapter 11, Green Publishing Associates and John Wiley & Sons, Edited by Ausubel, F.M et al., 1992 .
  • an antibody having specific binding affinity for an isoform of BNP or a secondary antibody that binds to such an antibody can be labeled, either directly or indirectly.
  • Suitable labels include, without limitation, radionuclides (e . g .
  • fluorescent moieties e.g., fluorescein, FITC, PerCP, rhodamine, or PE
  • luminescent moieties e.g., QdotTM nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, CA
  • compounds that absorb light of a defined wavelength or enzymes (e.g., alkaline phosphatase or horseradish peroxidase).
  • Antibodies can be indirectly labeled by conjugation with biotin then detected with avidin or streptavidin labeled with a molecule described above.
  • detectors include, without limitation, x-ray film, radioactivity counters, scintillation counters, spectrophotometers, colorimeters, fluorometers, luminometers, and densitometers. Combinations of these approaches (including "multi-layer” assays) familiar to those in the art can be used to enhance the sensitivity of assays.
  • Immunological assays for detecting an isoform of BNP can be performed in a variety of known formats, including sandwich assays, competition assays (competitive RIA), or bridge immunoassays. See, for example, U.S. Patent Nos. 5,296,347 ; 4,233,402 ; 4,098,876 ; and 4,034,074 .
  • Methods of detecting an isoform of BNP generally include contacting a biological sample with an antibody that binds to the isoform ofBNP and detecting binding of the isoform of BNP to the antibody.
  • an antibody having specific binding affinity for an isoform of BNP can be immobilized on a solid substrate by any of a variety of methods known in the art and then exposed to the biological sample.
  • Binding of the BNP isoform to the antibody on the solid substrate can be detected by exploiting the phenomenon of surface plasmon resonance, which results in a change in the intensity of surface plasmon resonance upon binding that can be detected qualitatively or quantitatively by an appropriate instrument, e.g., a Biacore apparatus (Biacore International AB, Rapsgatan, Sweden).
  • a Biacore apparatus Biacore International AB, Rapsgatan, Sweden
  • the antibody is labeled and detected as described above.
  • a standard curve using known quantities of the isoform can be generated to aid in the quantitation of the levels of the isoform.
  • a "sandwich" assay in which a capture antibody is immobilized on a solid substrate is used to detect the presence, absence, or level of an isoform of BNP.
  • the solid substrate can be contacted with the biological sample such that any BNP2 or BNP3 in the sample can bind to the immobilized antibody.
  • the presence, absence, or level of the BNP isoform bound to the antibody can be determined using a "detection" antibody having specific binding affinity for the isoform and the methods described above.
  • a capture antibody is used that has binding affinity for BNP as well as BNP2 and BNP3.
  • a detection antibody can be used that has specific binding affinity for BNP2 or BNP3.
  • the capture antibody should not bind to the same epitope (or range of epitopes in the case of a polyclonal antibody) as the detection antibody.
  • the detection antibody can be another monoclonal antibody that binds to an epitope that is either completely physically separated from or only partially overlaps with the epitope to which the capture monoclonal antibody binds, or a polyclonal antibody that binds to epitopes other than or in addition to that to which the capture monoclonal antibody binds.
  • the detection antibody can be either a monoclonal antibody that binds to an epitope that is either completely physically separated from or partially overlaps with any of the epitopes to which the capture polyclonal antibody binds, or a polyclonal antibody that binds to epitopes other than or in addition to that to which the capture polyclonal antibody binds.
  • Sandwich assays can be performed as sandwich ELISA assays, sandwich Western blotting assays, or sandwich immunomagnetic detection assays.
  • Suitable solid substrates to which an antibody (e.g., a capture antibody) can be bound include, without limitation, microtiter plates, tubes, membranes such as nylon or nitrocellulose membranes, and beads or particles (e.g., agarose, cellulose, glass, polystyrene, polyacrylamide, magnetic, or magnetizable beads or particles). Magnetic or magnetizable particles can be particularly useful when an automated immunoassay system is used.
  • Antibodies having specific binding affinity for an isoform of BNP can be produced through standard methods.
  • a polypeptide can be recombinantly produced as described above, or can be purified from a biological sample, and used to immunize host animals, including rabbits, chickens, mice, guinea pigs, or rats.
  • a polypeptide having the amino acid sequence set forth in SEQ ID NOS:1 or 2, or fragments thereof that are at least six amino acids in length can be used to immunize an animal.
  • Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin and dinitrophenol.
  • Monoclonal antibodies can be prepared using a BNP polypeptide and standard hybridoma technology. In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described by Kohler, G.
  • Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD, and any subclass thereof.
  • the hybridoma producing the monoclonal antibodies of the invention can be cultivated in vitro and in vivo.
  • BNP2 and BNP3 include mass-spectrophotometric techniques such as electrospray ionization (ESI), and matrix-assisted laser desorption-ionization (MALDI).
  • ESI electrospray ionization
  • MALDI matrix-assisted laser desorption-ionization
  • nucleic acid based methods can include an amplification step using, for example, PCR. Template nucleic acid need not be purified for PCR; it can be a minor fraction of a complex mixture, such as a cell lysate. Template DNA or RNA can be extracted from a biological sample using routine techniques.
  • FRET technology is based on the concept that when a donor fluorescent moiety and a corresponding acceptor fluorescent moiety are positioned within a certain distance of each other, energy transfer taking place between the two fluorescent moieties can be visualized or otherwise detected and quantitated.
  • Two oligonucleotide probes each containing a fluorescent moiety, can hybridize to an amplification product at particular positions determined by the complementarity of the oligonucleotide probes to the target nucleic acid sequence.
  • a FRET signal is generated.
  • Hybridization temperatures and times can range from about 35°C to about 65°C for about 10 seconds to about 1 minute. Detection of FRET can occur in real-time, such that the increase in an amplification product after each cycle of a PCR assay is detected and, in some embodiments, quantified.
  • Fluorescent analysis and quantification can be carried out using, for example, a photon counting epifluorescent microscope system (containing the appropriate dichroic mirror and filters for monitoring fluorescent emission in a particular range of wavelengths), a photon counting photomultiplier system, or a fluorometer.
  • Excitation to initiate energy transfer can be carried out with an argon ion laser, a high intensity mercury arc lamp, a fiber optic light source, or another high intensity light source appropriately filtered for excitation in the desired range.
  • Fluorescent moieties can be, for example, a donor moiety and a corresponding acceptor moiety.
  • corresponding refers to an acceptor fluorescent moiety having an emission spectrum that overlaps the excitation spectrum of the donor fluorescent moiety.
  • the wavelength maximum of the emission spectrum of an acceptor fluorescent moiety typically should be at least 100 nm greater than the wavelength maximum of the excitation spectrum of the donor fluorescent moiety, such that efficient non-radiative energy transfer can be produced there between.
  • Fluorescent donor and corresponding acceptor moieties are generally chosen for (a) high efficiency Förster energy transfer; (b) a large final Stokes shift (>100 nm); (c) shift of the emission as far as possible into the red portion of the visible spectrum (>600 nm); and (d) shift of the emission to a higher wavelength than the Raman water fluorescent emission produced by excitation at the donor excitation wavelength.
  • a donor fluorescent moiety can be chosen with an excitation maximum near a laser line (for example, Helium-Cadmium 442 nm or Argon 488 nm), a high extinction coefficient, a high quantum yield, and a good overlap of its fluorescent emission with the excitation spectrum of the corresponding acceptor fluorescent moiety.
  • a corresponding acceptor fluorescent moiety can be chosen that has a high extinction coefficient, a high quantum yield, a good overlap of its excitation with the emission of the donor fluorescent moiety, and emission in the red part of the visible spectrum (>600 nm).
  • Representative donor fluorescent moieties that can be used with various acceptor fluorescent moieties in FRET technology include fluorescein, Lucifer Yellow, B-phycoerythrin, 9-acridineisothiocyanate, Lucifer Yellow VS, 4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid, 7-diethylamino-3-(4'-isothiocyanatophenyl)-4-methylcoumarin, succinimdyl 1-pyrenebutyrate, and 4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid derivatives.
  • acceptor fluorescent moieties depending upon the donor fluorescent moiety used, include LCTM-Red 640, LCTM-Red 705, Cy5, Cry5.5, Lissamine rhodamine B sulfonyl chloride, tetramethyl rhodamine isothiocyanate, rhodamine x isothiocyanate, erythrosine isothiocyanate, fluorescein, diethylenetriamine pentaacetate, and other chelates of Lanthanide ions (e.g., Europium, or Terbium).
  • Donor and acceptor fluorescent moieties can be obtained from, for example, Molecular Probes, Inc. (Eugene, OR) or Sigma Chemical Co. (St. Louis, MO).
  • Donor and acceptor fluorescent moieties can be attached to probe oligonucleotides via linker arms.
  • the length of each linker arm is important, as the linker arms will affect the distance between the donor and acceptor fluorescent moieties.
  • the length of a linker arm for the purpose of the present invention is the distance in Angstroms ( ⁇ ) from the nucleotide base to the fluorescent moiety.
  • a linker arm is from about 10 to about 25 ⁇ in length.
  • the linker arm may be of the kind described, for example, in WO 84/03285 .
  • WO 84103285 also discloses methods for attaching linker arms to a particular nucleotide base, as well as methods for attaching fluorescent moieties to a linker arm.
  • An acceptor fluorescent moiety such as an LCTM-Red 640-NHS-ester can be combined with C6-Phosphoramidites (available from ABI (Foster City, CA) or Glen Research (Sterling, VA)) to produce, for example, LCTM-Red 640-Phosphoramidite.
  • C6-Phosphoramidites available from ABI (Foster City, CA) or Glen Research (Sterling, VA)
  • Linkers frequently used to couple a donor fluorescent moiety such as fluorescein to an oligonucleotide include thiourea linkers (FITC-derived, for example, fluorescein-CPG's from Glen Research or ChemGene (Ashland, MA)), amide-linkers (fluorescein-NHS-ester-derived, such as fluorescein-CPG from BioGenex (San Ramon, CA)), or 3'-amino-CPG's that require coupling of a fluorescein-NHS-ester after oligonucleotide synthesis.
  • FITC-derived for example, fluorescein-CPG's from Glen Research or ChemGene (Ashland, MA)
  • amide-linkers fluorescein-NHS-ester-derived, such as fluorescein-CPG from BioGenex (San Ramon, CA)
  • 3'-amino-CPG's that require coupling of a fluoresc
  • PCR amplification, detection, and quantification of an amplification product can be combined in a single closed cuvette with dramatically reduced cycling time. Since detection and quantification occur concurrently with amplification, real-time PCR methods obviate the need for manipulation of the amplification product, and diminish the risk of cross-contamination between amplification products. Real-time PCR greatly reduces turn-around time and is an attractive alternative to conventional PCR techniques in the clinical laboratory or in the field.
  • Control samples can be included within each thermocycler run. Positive control samples can amplify a nucleic acid control template (e.g., a nucleic acid other than a target nucleic acid) using, for example, control primers and control probes. Positive control samples also can amplify, for example, a plasmid construct containing a control nucleic acid template. Such a plasmid control can be amplified internally (e.g., within the sample) or in a separate sample run side-by-side with the test samples. Each thermocycler run also should include a negative control that, for example, lacks the target template DNA. Such controls are indicators of the success or failure of the amplification, hybridization and/or FRET reaction. Therefore, control reactions can readily determine, for example, the ability of primers to anneal with sequence-specificity and to initiate elongation, as well as the ability of probes to hybridize with sequence-specificity and for FRET to occur.
  • a nucleic acid control template e.g.
  • Another FRET format utilizes TaqMan ® technology to detect the presence, absence, or level of an amplification product, and hence, the presence, absence, or level of nucleic acid encoding an isoform of BNP.
  • TaqMan ® technology utilizes one single-stranded hybridization probe labeled with two fluorescent moieties. When a first fluorescent moiety is excited with light of a suitable wavelength, the absorbed energy is transferred to a second fluorescent moiety according to the principles of FRET. The second fluorescent moiety is generally a quencher molecule.
  • the labeled hybridization probe binds to the target DNA (i.e., the amplification product) and is degraded by the 5' to 3' exonuclease activity of the Taq Polymerase during the subsequent elongation phase.
  • the excited fluorescent moiety and the quencher moiety become spatially separated from one another.
  • the fluorescence emission from the first fluorescent moiety can be detected.
  • an ABI PRISM ® 7700 Sequence Detection System uses TaqMan ® technology, and is suitable for performing the methods described herein for detecting isoforms of BNP.
  • Information on PCR amplification and detection using an ABI PRISM ® 7700 system can be found at the website of Applied Biosystems.
  • Molecular beacons in conjunction with FRET also can be used to detect the presence of an amplification product using the real-time PCR methods of the invention.
  • Molecular beacon technology uses a hybridization probe labeled with a first fluorescent moiety and a second fluorescent moiety.
  • the second fluorescent moiety is generally a quencher, and the fluorescent labels are typically located at each end of the probe.
  • Molecular beacon technology uses a probe oligonucleotide having sequences that permit secondary structure formation (e.g., a hairpin). As a result of secondary structure formation within the probe, both fluorescent moieties are in spatial proximity when the probe is in solution.
  • the secondary structure of the probe is disrupted and the fluorescent moieties become separated from one another such that after excitation with light of a suitable wavelength, the emission of the first fluorescent moiety can be detected.
  • amplification product can be detected using, for example, a fluorescent DNA binding dye (e.g., SYBRGreenI ® or SYBRGold ® (Molecular Probes)).
  • a fluorescent DNA binding dye e.g., SYBRGreenI ® or SYBRGold ® (Molecular Probes)
  • DNA binding dyes Upon interaction with an amplification product, such DNA binding dyes emit a fluorescent signal after excitation with light at a suitable wavelength.
  • a double-stranded DNA binding dye such as a nucleic acid intercalating dye also can be used.
  • a melting curve analysis usually is performed for confirmation of the presence of the amplification product.
  • a BNP isoform, a nucleic acid encoding a BNP isoform, or an antibody having specific binding affinity for an isoform of BNP can be combined with packaging material and sold as a kit.
  • kits can be useful for diagnosing heart conditions, monitoring treatment of heart conditions, monitoring progression of heart disease, or treating heart or kidney conditions.
  • Components and methods for producing articles of manufactures are well known.
  • the articles of manufacture may combine one or more polypeptides, nucleic acids, or antibodies as described herein.
  • the articles of manufacture may further include reagents such as secondary antibodies, anti-BNP antibodies, buffers, indicator molecules, solid phases (e.g., beads) and/or other useful agents for diagnosing heart conditions, monitoring treatment of heart conditions, or monitoring progression of heart disease.
  • An antibody can be in a container, such as a plastic, polyethylene, polypropylene, ethylene, or propylene vessel that is either a capped tube or a bottle, or can be included on a solid phase, e.g., a handheld device for bedside testing that includes an antibody (e.g., an anti-BNP2 or BNP3 antibody).
  • Instructions describing how the various reagents are effective for treating heart or kidney conditions, monitoring treatment of heart conditions, or monitoring progression of heart disease also may be included in such kits.
  • intron 2 of the BNP genomic sequence encoded a polypeptide having homology to the C-terminal of the snake DNP polypeptide.
  • Northern blotting was performed using cellular RNA isolated from kidney, brain, and heart (left ventricles and atria) tissue of patients with and without heart failure. Approximately 5 ⁇ g of RNA was electrophoresed through a 1% agarose gel containing formaldehyde and transferred to a nylon membrane. Northern blotting was performed using the NorthernMaxTM kit from Ambion, Inc. (Austin, TX), according to the manufacturer's instructions.
  • the membranes were UV autocross-linked, prehybridized at 42°C for 1 hour, and hybridized at 42°C overnight with a labeled probe containing the second intron sequence.
  • the probe was labeled with 32 P using the Random Primers DNA Labeling System (Gibco BRL).
  • the membranes were washed twice in low stringency buffer (provided in NorthernMaxTM kit, equivalent to 2X SSC, 0.1% SDS or 2X SSPE, 0.1% SDS) at room temperature, five minutes per wash, then washed twice in a high stringency buffer (provided in NorthernMaXTM kit, equivalent to 0.1X SSC, 0.1% SDS or O.1X SSPE, 0.1% SDS) at 42°C, 15 minutes per wash.
  • Hybridization signals on the blots were analyzed by autoradiography. Message for the second intron was detected in the left atrium of heart failure patients.
  • Complementary DNA cDNA was produced using an oligo(dT) primer and the ThermoScriptTM RT-PCR Kit from Invitrogen Corp. (Carlsbad, CA) according to the manufacturer's instructions.
  • RT-PCR was performed using a forward primer having the sequence: 5'-AGAC ATG GATCCCCAGACAG-3' (SEQ ID NO:21; 5' start codon is underlined) and a reverse primer having the sequence: 5'-CAAGAGGAAGCGATGTCCAG-3' (SEQ ID NO:22, positioned at nucleotides 113 to 133 in the second intron).
  • RT-PCR was performed using a forward primer having the sequence: 5'-AGAC ATG GATCCCCAGAGAG-3' (SEQ ID NO:25, 5' start codon is underlined) and a reverse primers having the sequence: 5'- TTTCTGCACCACTTTGCAGC-3' (SEQ ID NO:26, where the underlined portion of the primer is the 3' sequence of the second exon, and the non-underlined portion of the primer corresponds to position 289-300 of the second intron).
  • a peptide corresponding to the residues 27-60 of the mature human BNP2 peptide was synthesized by the Mayo protein core facility and used to produce polyclonal antibodies.
  • Two rabbits were inoculated initially with 500 ⁇ g of the peptide plus Complete Freund's adjuvant followed by three booster inoculations of 250 ⁇ g of the peptide plus incomplete Freund's adjuvant. After each booster, sera were evaluated by Western-blotting.
  • One of the rabbits (#1105) exhibited a specific response after immunization and continues to maintain a high antibody titer with periodic boosters.
  • the polyclonal anti-BNP2 antibody was used to detect BNP2 in human heart tissue. Two sets of slices of paraffin embedded, human heart, left atrial tissues (normal and heart failure) were de-paraffinized and treated with antigen retrieval buffer. One set of slices was incubated with 5 times diluted polyclonal rabbit anti-BNP2 antibody and the other with preimmune rabbit serum. Anti-rabbit biotin conjugate and streptavidinalkaline phosphatase were used for color development. BNP2 was detected only in the heart tissue from the heart failure patient.
  • a peptide corresponding to the residues 27-41 of the mature human BNP3 peptide was synthesized by the Mayo protein core facility and used to produce polyclonal antibodies.
  • Two rabbits were inoculated initially with 500 ⁇ g of the peptide plus Complete Freund's adjuvant followed by three booster inoculations of 250 ⁇ g of the peptide plus incomplete Freund's adjuvant. After each booster, sera were evaluated by Western blotting.
  • One of the rabbits (#1403) exhibited a specific response after immunization and continues to maintain a high antibody titer with periodic boosters.
  • the polyclonal anti-BNP32 antibody was used to detect BNP3 in human heart tissue. Two sets of slices of paraffin embedded, human heart, left atrial tissues (normal and heart failure) were de-paraffinized and treated with antigen retrieval buffer. One set of slices was incubated with 5 times diluted polyclonal rabbit anti-BNP3 antibody and the other with preimmune rabbit serum. Anti-rabbit biotin conjugate and streptavidinalkaline phosphatase were used for color development. BNP3 was detected only in the heart tissue from the heart failure patient.
  • Example 7 Expression levels of BNP isoforms in human heart tissue
  • the PCR reaction mixture contained 2 gel cDNA, 2 ⁇ L FastStart DNA Master SYBR ® Green I (Roche), 2.4 ⁇ L MgCl 2 stock solution (25 mM), 0.5 ⁇ M of each primer (see Table 1), and sterile H 2 O in a total volume of 20 ⁇ l. All primers were selected using Primer3 software (Whitehead Institute).
  • Products were amplified using 45 cycles of denaturation at 95°C for 10 sec, annealing at 60°C for 5 sec, and extension at 72°C for 10 sec. Purified PCR products from each reaction were measured and served as quantitative standards. All quantitations were normalized to the GAPDH endogenous control. No template controls were used to determine whether fluorescent contaminants were present in the sample. To confirm amplification specificity, the PCR products were subjected to a melting-curve analysis and subsequent agarose gel electrophoresis.
  • BNP3 was not found in normal heart tissue.
  • the expression level of BNP-2 in heart failure heart tissue was about 7 times higher than the level in normal heart tissue.
  • Messenger RNA for BNP2 and BNP3 represent up to 5% of all BNP RNA.
  • Human umbilical vascular endothelial cells were cultured in 96-well plates using endothelial cell medium (EGMTTM-2) supplemented with the components provided by the EGMTTM-2 BulletKit (CC-3162) (Clonetics, East Rutherford, NJ). After cells reached about 80% confluency, the plates were washed with phosphate-buffered saline (PBS) then incubated for 30 minutes with 0, 0.1,1, or 10 ⁇ M of synthetic hBNP3 mature peptide (SPKMVQGSGCFGRKMDRISSSSGLGCKWQKENQTFPPGFL, SEQ ID NO:35) dissolved in EBM-2 that contained supplements and 0.5 mM IBXM.
  • PBS phosphate-buffered saline
  • BNP3 final conc 10 -10 to 10 -7 M or vehicle was added to the organ bath in a cumulative manner. Following three further washes and equilibration, the arteries were re-contracted and viability was confirmed by assessment of endothelium independent responses with incremental doses of sodium nitroprusside (10 -9 to 10 -5 M), an exogenous NO donor.
  • Vasorelaxation to BNP3 began at 10 -9 M, with vessel responsivity increasing in a dose dependent manner such that ⁇ 60% and ⁇ 95% complete relaxation was seen at doses of 10 -8 M and 10 -7 M, respectively. No response was seen in control rings.
  • the synthesized peptide was delivered via a direct intrarenal arterial infusion (0.03 ng/kg/min) in normal dogs. Physiologic assessment was performed following a 15 minute run-in period. Infusion of BNP-3 at this dose resulted in elevation of plasma cGMP. This elevation of cGMP was associated with increased urinary flow (6-8 fold) and increased urinary excretion of sodium. Both of these increases normalized during a washout period.
  • a purified polypeptide comprising an amino acid sequence selected from the group consisting of : a) the amino acid sequence of SEQ ID NO : 1,2, 3,4, 35, or 36 ; b) a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; c) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; and d) a sequence having at least 65% sequence identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least six contiguous residues in length.
  • amino acid sequence has at least 75% sequence identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • amino acid sequence has at least 75% sequence identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • amino acid sequence having at least 80% identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • amino acid sequence having at least 80% identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • amino acid sequence having at least 90% identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • amino acid sequence having at least 90% identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • amino acid sequence having at least 95% identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • amino acid sequence having at least 95% identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • polypeptide comprises the amino acid sequence of SEQ ID NO : 35 or SEQ ID NO : 36.
  • nucleic acid encoding the above polypeptide, wherein said polypeptide is encoded by i) the nucleic acid sequence of SEQ ID NO : 5 ; ii) the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO : 5 ; iii) the nucleic acid sequence of SEQ ID NO : 6; or iv) the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO : 6.
  • host cells comprising the above vector, preferably wherein said host cells are eukaryotic host cells.
  • composition comprising the above polypeptide and a pharmaceutically acceptable carrier.
  • a chimeric natriuretic polypeptide comprising a first region and a second region, said first region having an amino acid sequence selected from the group consisting of : a) the sequence of residues 1 to 27 of SEQ ID NO : 16; b) the sequence of residues 1 to 25 of SEQ ID NO : 17; c) the sequence of residues 1 to 23 of SEQ ID NO : 18; d) the sequence of residues 1 to 22 of SEQ ID NO : 19 ; and e) the sequence of a), b), c), or d) with one to five amino acid substitutions; said second region having an amino acid sequence selected from the group consisting of : f) the sequence of SEQ ID NO : 1 or SEQ ID NO : 2; g) a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; h) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID
  • a purified polypeptide comprising an amino acid sequence of the formula : Gly-Xaal-Xaa2-Xaa3-Xaa4-Xaas-Xaa6-Xaa7-Xaa8-Xaag-Xaalo-Xaa11-Xaa12-Xaai3- ⁇ BR> Xaa14-Xaa1s-Xaa16-Xaa17-Xaa18-Xaa19-Xaa2o-Xaa21-Xaa22-Xaa23-Xaa24-Xaa25- Xaa26-Xaa27-Xaa28-Gly-Xaa2g-Xaa3o-Xaa31-Xaa32 (SEQ ID NO : 20), wherein Xaal is Glu or Lys; Xaa2 is Pro, His, or Arg; Xaa3 is Pro or Leu; Xaa4 is Pro, Leu, or Ser
  • a method for diagnosing a heart condition in a patient comprising: a) providing a biological sample from said patient; b) detecting the presence, absence, or level of BNP2 or BNP3 in said biological sample; and c) classifying said patient as having said heart condition or not having said heart condition based, at least in part, on the presence of BNP-2 or BNP-3, the level of BNP2 or BNP3, or the absence of BNP2 or BNP3.
  • said heart condition is heart failure.
  • said heart condition is unstable angina.
  • said heart condition is acute myocardial infarction.
  • said heart condition is hypertension
  • Disclosed is also a method for diagnosing a heart condition in a patient comprising: a) providing a biological sample from said patient; b) detecting the presence, absence, or level of a ribonucleic acid encoding BNP2 or BNP3 in said biological sample; and c) classifying said patient as having said heart condition or not having said heart condition based, at least in part, on the presence of said ribonucleic acid encoding BNP2 or BNP3, the level of said ribonucleic acid encoding BNP2 or BNP3, or the absence of said ribonucleic acid encoding BNP2 or BNP3.
  • said heart condition is heart failure, unstable angina, acute myocardial infarction or hypertension.
  • said BNP2 polypeptide comprises the sequence set forth in SEQ ID NO: 1.
  • said antibody is a monoclonal antibody.
  • a purified antibody wherein said antibody binds to a BNP3 polypeptide, and wherein said antibody does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO : 16 or to a BNP2 polypeptide consisting of the sequence set forth in SEQ ID NO : 3.
  • said BNP3 polypeptide comprises the sequence set forth in SEQ ID NO : 2.
  • said antibody is a monoclonal antibody.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Cardiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Urology & Nephrology (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)
  • Vascular Medicine (AREA)
  • Hospice & Palliative Care (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Methods and materials for diagnosing and treating heart conditions (e.g., heart failure) and kidney conditions (e.g., kidney failure) are described.

Description

    CROSS-REFERENCE TO RELATED APPLICATION
  • This application claims priority to U.S. Provisional Patent Application No. 60/480,460, filed June 20, 2003 .
  • TECHNICAL FIELD
  • The invention relates to methods and materials for diagnosing heart conditions such as heart failure, and more particularly, for diagnosing heart conditions by detecting isoforms of brain natriuretic peptide (BNP). The invention also relates to methods and materials for treating heart conditions (e.g., heart failure) and kidney conditions (e.g., kidney failure).
  • BACKGROUND
  • Members of the natriuretic peptide family are hormones that regulate body fluid homeostasis. Atrial natriuretic peptide (ANP) is secreted by atrial myocytes in response to increased intravascular volume. Once ANP is in the circulation, its effects are primarily on the kidney, vascular tissue, and adrenal gland, in which its actions lead to the excretion of sodium and water by the kidneys and a decrease in intravascular volume and blood pressure. BNP also is of myocardial cell origin, and like ANP, it circulates in human plasma. BNP is natriuretic, rennin inhibiting, vasodilating, and lusitropic. The main circulating and storage form of BNP is a 32 amino acid peptide with a ring structure. Physiological actions of BNP are mediated through a guanylate cyclase-linked receptor, natriuretic peptide receptor A (NPR-A). Clearance of BNP is promoted by a NPR-C receptor that removes it from the circulation. BNP also is degraded through enzymatic cleavage by neutral endopeptidase. C-type natriuretic peptide (CNP) is of endothelial cell origin and functions as a vasodilating and growth-inhibiting peptide. Dendroaspis natriuretic peptide (DNP) is similar in structure to ANP, BNP, and CNP, and is isolated from the venom of Dendoaspis angusticeps or green mamba snake.
  • ANP and BNP are increased in the plasma and heart during congestive heart failure in humans, and exert cardiorenal protective actions in addition to serving as serum markers for ventricular dysfunction. Epidemiological evidence indicates that at least 3% of the adult population above the age of 45 may have ventricular systolic dysfunction and 52% may be asymptomatic.
  • SUMMARY
  • The invention is based on the identification of novel forms of BNP generated by alternative splicing. Alternatively spliced human BNP isoforms contain the 17-aminoacid disulfide ring structure of BNP, have unique carboxy-termini, and result from distinct splicing variation. One of the isoform, BNP2, has a unique 33 amino acid residue C-terminal extension attached to the ring. This isoform is the result of intron 2 inclusion. BNP3 contains a novel 14 amino acid residue C-terminal extension and is the result of an alternative splice acceptor present within intron 2. As described herein, expression of BNP2 and BNP3 is increased in cardiomyocytes during heart failure. Thus, BNP2 and BNP3 polypeptides or ribonucleic acids encoding BNP2 or BNP3 can be used as markers for heart conditions. As such, the presence, absence, or level of such polypeptides or ribonucleic acids can be used to diagnose heart conditions and monitor treatment of heart conditions. In addition, BNP2 and BNP3 can be used as therapeutics for the treatment of heart conditions.
  • The invention features a purified polypeptide and an antibody having specific binding affinity for the polypeptide. The polypeptide includes an amino acid sequence selected from the group consisting of the amino acid sequence of SEQ ID NO:1, 2, 3, 4, 35, or 36; a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length. The amino acid sequence can have at least 75% (e.g., 80, 90, or 95%) sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2 or at least 75% (e.g., 80, 90, or 95%) sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least 6 contiguous residues in length. In some embodiments, the polypeptide can include the amino acid sequence of SEQ ID NO:35 or SEQ ID NO:36. Pharmaceutical compositions can include a polypeptide and a pharmaceutically acceptable carrier.
  • In another aspect, the invention features an isolated nucleic acid encoding a purified polypeptide described above, vectors that include the nucleic acids, and host cells that include the vectors. The polypeptide can be encoded by the nucleic acid sequence of SEQ ID NO:5; the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO:5; the nucleic acid sequence of SEQ ID NO:6; or the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO:6. The host cells can be eukaryotic host cells.
  • The invention also features a chimeric natriuretic polypeptide. The polypeptide includes a first region and a second region, the first region having an amino acid sequence selected from the group consisting of a) the sequence of residues 1 to 27 of SEQ ID NO:16; b) the sequence of residues 1 to 25 of SEQ ID NO:17; c) the sequence of residues 1 to 23 of SEQ ID NO:18; d) the sequence of residues 1 to 22 of SEQ ID NO:19; and e) the sequence of a), b), c), or d) with one to five amino acid substitutions; and the second region having an amino acid sequence selected from the group consisting of: f) the sequence of SEQ ID NO:1 or SEQ ID NO:2; g) a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; h) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and i) a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length.
  • In another aspect, the invention features a purified polypeptide that includes an amino acid sequence of the formula: Gly-Xaa1- Xaa2- Xaa3- Xaa4- Xaa5- Xaa6- Xaa7-Xaa8- Xaa9- Xaa10- Xaa11- Xaa12- Xaa13- Xaa14- Xaa15 -Xaa16- Xaa17- Xaa18- Xaa19-Xaa20- Xaa21- Xaa22- Xaa23- Xaa24- Xaa25- Xaa26- Xaa27- Xaa28- Gly- Xaa29- Xaa30-Xaa31- Xaa32 (SEQ ID NO:20), wherein Xaa1 is Glu or Lys; Xaa2 is Pro, His, or Arg; Xaa3 is Pro or Leu; Xaa4 is Pro, Leu, or Ser; Xaa5 is Cys or Pro; Xaa6 is Pro, His, Gln, or Arg; Xaa7 is Arg, Phe, or Leu; Xaa8 is Asp, Gly, or absent; Xaa9 is Ser, Pro, or Leu; Xaa10 is Pro or absent; Xaa11 is Ser, Ala, or absent; Xaa12 is Pro or Ala; Xaa13 is Ala, Phe, Ile, or Leu; Xaa14 is Pro, Lys, or Leu; Xaa15 is Val, Leu, or Trp; Xaa16 is Cys, His, or Val; Xaa17 is Asp, Ala, Ile, Thr, Pro, or Arg; Xaa18 is Thr, Pro, or His; Xaa19 is Val, Ile, Pro, Val, Ser, or Leu; Xaa20 is Arg, Ser, Ile, or Glu; Xaa21 is Val, Ile, Ala, or Pro; Xaa22 is Thr, Val, or Leu; Xaa23 is Leu, Ser, or His; Xaa24 is Gly or Ala; Xaa25 is Phe, Ser, Thr, or Leu; Xaa26 is Val, Asp, or Leu; Xaa27 is Val, Leu, or Ser; Xaa28 is Ser, Arg, or Leu; Xaa29 is Asn, Asp, Pro, or Thr; Xaa30 is His, Gln, Asn, or Thr; Xaa31 is Thr, Ile, or Ser; and Xaa32 is Pro, Leu, or Glu.
  • In yet another aspect, the invention features a method for diagnosing a heart condition in a patient. The method includes providing a biological sample from the patient; detecting the presence, absence, or level of BNP2 or BNP3 in the biological sample; and classifying the patient as having the heart condition or not having the heart condition based, at least in part, on the presence of BNP-2 or BNP-3, the level of BNP2 or BNP3, or the absence of BNP2 or BNP3. The heart condition can be heart failure, unstable angina, acute myocardial infarction, or hypertension. The presence, absence, or level of BNP2 can be detected or the presence, absence, or level of BNP3 can be detected. In some embodiments, the presence, absence, or level of BNP2 and BNP3 is detected.
  • A heart condition also can be diagnosed in a patient by providing a biological sample from the patient; detecting the presence, absence, or level of a ribonucleic acid encoding BNP2 or BNP3 in the biological sample; and classifying the patient as having the heart condition or not having the heart condition based, at least in part, on the presence of the ribonucleic acid encoding BNP2 or BNP3, the level of the ribonucleic acid encoding BNP2 or BNP3, or the absence of the ribonucleic acid encoding BNP2 or BNP3. The heart condition can be heart failure, unstable angina, acute myocardial infarction, or hypertension.
  • In another aspect, the invention features a method for treating a heart condition in a mammal. The method includes administering a polypeptide or a nucleic acid to the mammal under conditions wherein the severity of a symptom of the heart condition is reduced. The polypeptide includes an amino acid sequence selected from the group consisting of the amino acid sequence ofSEQ ID NO:1, 2, 3, 4, 35, or 36; a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO: or SEQ ID NO:2; a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length. The amino acid sequence can have at least 75% (e.g., 80, 90, or 95%) sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2 or at least 75% (e.g., 80, 90, or 95%) sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least 6 contiguous residues in length. In some embodiments, the polypeptide can include the amino acid sequence of SEQ ID NO:35 or SEQ ID NO:36. The nucleic acid contains a sequence encoding a polypeptide described above. The polypeptide can be encoded by the nucleic acid sequence of SEQ ID NO:5; the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO:5; the nucleic acid sequence of SEQ ID NO:6; or the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO:6. The heart condition can be heart failure, unstable angina, acute myocardial infarction, and/or hypertension.
  • In another aspect, the invention features a method for treating a kidney condition in a mammal. The method includes administering a polypeptide or a nucleic acid to the mammal under conditions wherein the severity of a symptom of the kidney condition is reduced. The polypeptide includes an amino acid sequence selected from the group consisting of the amino acid sequence of SEQ ID NO:1, 2, 3, 4, 35, or 36; a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2; and a sequence having at least 65% sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least six contiguous residues in length. The amino acid sequence can have at least 75% (e.g., 80, 90, or 95%) sequence identity to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2 or at least 75% (e.g., 80, 90, or 95%) sequence identity to a fragment of SEQ ID NO:1 or SEQ ID NO:2 at least 6 contiguous residues in length. In some embodiments, the polypeptide can include the amino acid sequence of SEQ ID NO:35 or SEQ ID NO:36. The nucleic acid contains a sequence encoding a polypeptide described above. The polypeptide can be encoded by the nucleic acid sequence of SEQ ID NO:5; the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO:5; the nucleic acid sequence of SEQ ID NO:6; or the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO:6. The kidney condition can be kidney failure.
  • In another aspect, the invention features a method for increasing cGMP within a mammal. The method includes administering a polypeptide described herein or a nucleic acid encoding said polypeptide to the mammal under conditions wherein the level of cGMP within the mammal is increased.
  • In another aspect, the invention features a method for dilating an artery within a mammal. The method includes administering a polypeptide described herein or a nucleic acid encoding said polypeptide to the mammal under conditions wherein said artery dilates.
  • In another aspect, the invention features a method for increasing diuresis and/or natriuresis in a mammal. The method includes administering a polypeptide described herein or a nucleic acid encoding said polypeptide to the mammal under conditions wherein diuresis and/or natriuresis increases.
  • In another aspect, the invention features a purified antibody. The antibody binds to a BNP2 polypeptide, and does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO:16 or to a BNP3 polypeptide consisting of the sequence set forth in SEQ ID NO:4. The BNP2 polypeptide can contain the sequence set forth in SEQ ID NO:1. The antibody can be a monoclonal antibody.
  • In another aspect, the invention features a purified antibody. The antibody binds to a BNP3 polypeptide, and does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO:16 or to a BNP2 polypeptide consisting of the sequence set forth in SEQ ID NO:3. The BNP3 polypeptide can contain the sequence set forth in SEQ ID NO:2. The antibody can be a monoclonal antibody.
  • Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
  • Other features and advantages of the invention will be apparent from the following detailed description, and from the claims.
  • DESCRIPTION OF DRAWINGS
    • FIG. 1A and 1B are the nucleotide and amino acid sequence of human (SEQ ID NO:3) and dog BNP2 (SEQ ID NO:14), respectively. The underlined sequences represent the mature peptides.
    • FIG. 2 is the nucleotide and amino acid sequence of human BNP-3 (SEQ ID NO:4). The underlined sequence represents the mature peptide.
    • FIG. 3 is an alignment of C-terminal BNP2 polypeptide sequences from orangutan (SEQ ID NO:7); pig (SEQ ID NO:8); chimpanzee (SEQ ID NO:9); sheep (SEQ ID NO:10); mouse (SEQ ID NO:11); human (SEQ ID NO:3); gorilla (SEQ ID NO:12); cat (SEQ ID NO:13); dog (SEQ ID NO:14); and snake (SEQ ID NO:15).
    • FIG. 4 contains the amino acid sequences of BNP (SEQ ID NO:16); DNP (SEQ ID NO:17); ANP (SEQ ID NO:18); and CNP (SEQ ID NO:19).
    DETAILED DESCRIPTION
  • In general, the invention provides isoforms of BNP, including BNP2 and BNP3 polypeptides, and methods of using the isoforms as markers for various heart conditions, including heart failure, hypertension, unstable angina, sudden cardiac death, and acute myocardial infarction, as well as renal failure. As described herein, BNP2 and BNP3 are present in biological samples from patients with failing hearts but are absent or at low levels in biological samples from control patients. Consequently, the presence or level of BNP2 or BNP3 can be detected in biological samples and used to diagnose heart conditions, monitor treatment for heart conditions, or track progression of heart disease. The presence or level of BNP isoforms can be assessed by either measuring BNP2 or BNP3 polypeptides or ribonucleic acids encoding BNP2 or BNP3 as described below.
  • In addition, the polypeptides provided herein (e.g., BNP2 and BNP3) as well as nucleic acids encoding such polypeptides may be used as therapeutics for the treatment of heart conditions and/or kidney conditions. Therapeutic effects of BNP2 and BNP3 may be similar to BNP, which is a balanced vasodilator with no inotropic nor chronotropic properties. Intravenous therapy with recombinant BNP (Nesiritide, Natrecor®) significantly decreases pulmonary capillary wedge pressure and systemic vascular resistance and increases cardiac index. BNP is not pro-arrhythmic and has no effect on heart rate. Burger and Burger, Curr. Opin. Investig. Drugs 2(7):929-35 (2001).
  • In some embodiments, the polypeptides provided herein (e.g., BNP2 and BNP3) or nucleic acids encoding such polypeptides can be used to stimulate cGMP and/or vasodilate arteries in a mammal. In addition, the polypeptides provided herein (e.g., BNP2 and BNP3) or nucleic acids encoding such polypeptides can be used to treat hypertension, pulmonary hypertension, and/or congestive heart failure. In other embodiments, the polypeptides provided herein (e.g., BNP2 and BNP3) or nucleic acids encoding such polypeptides can be used increase diuresis and/or natriuresis in a mammal. For example, a BNP2 or BNP3 polypeptide can be administered to a mammal to increase urinary flow and urinary excretion of sodium. In addition, the polypeptides provided herein (e.g., BNP2 and BNP3) or nucleic acids encoding such polypeptides can be used to treat a fluid overload state (e.g., congestive heart failure, liver failure, and kidney failure) and/or to treat a sodium overloaded state (e.g., congestive heart failure).
  • BNP Isoforms
  • The invention features purified isoforms of BNP. As used herein, the term "purified" with reference to an isoform of BNP means that the polypeptide is substantially free of other polypeptides, lipids, carbohydrates, and nucleic acid with which it is naturally associated. Thus, a purified polypeptide is any polypeptide that is removed from its natural environment and is at least 60 percent pure. A purified polypeptide can be at least about 65, 70, 75, 80, 85, 90, 95, or 99 percent pure. Typically, a purified polypeptide will yield a single major band on a non-reducing polyacrylamide gel.
  • An isoform of BNP refers to any polypeptide that (1) has the amino acid sequence set forth in SEQ ID NO:1, 2, 3, 4, 14, 35, or 36, (2) contains an amino acid sequence having a length of about 6, 7, 8, 9, 10, 11, 12, 13, 14, or more amino acid residues with at least about 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or more percent identity over that length to the amino acid sequence set forth in SEQ ID NO:1 or 2, or (3) contains about 6, 7, 8, 9, 10, 11, 12, 13, 14 or more consecutive amino acid residues encoded by a nucleic acid sequence that hybridizes, under hybridization conditions (see below), to the sense or antisense strand of a nucleic acid encoding the sequence set forth in SEQ ID NO:1 or 2. For example, a polypeptide can contain an amino acid sequence of 10, 15, 20, 25, 30 or more residues in length and have at least 45% identity with the amino acid sequence of SEQ ID NO:1, which contains the 33 amino acid C-terminal fragment of human BNP2 (see FIG. 1A). The full-length amino acid sequence of human BNP2 is set forth in SEQ ID NO:3 and the sequence of the mature BNP2 polypeptide is set forth in SEQ ID NO:36 (see the underlined sequence in FIG. 1A). SEQ ID NO:2 contains the 14 amino acid C-terminal fragment of human BNP3 (see FIG. 2). The full-length amino acid sequence of human BNP3 is set forth in SEQ ID NO:4 while the sequence of the mature BNP3 polypeptide is set forth in SEQ ID NO:35 (see underlined sequence in FIG. 2).
  • Non-limiting examples of polypeptide sequences that have at least 45% identity to the polypeptide sequence set forth in SEQ ID NO:1 include the C-terminal BNP2 polypeptide sequences depicted in FIG. 3. For example, the C-terminal BNP2 sequences from human (SEQ ID NO:1) and pig (SEQ ID NO:8) have about 48% identity. The C-terminal BNP2 sequences from human (SEQ ID NO:1) and mouse (SEQ ID NO:11) have about 67% identity. The C-terminal BNP2 sequences from human (SEQ ID NO:1) and orangutan (SEQ ID NO:7) have about 91 % identity. The C-terminal BNP2 sequences from human (SEQ ID NO:1), chimpanzee (SEQ ID NO:9), and gorilla (SEQ ID NO:12) have about 97% identity.
  • The length and percent identity over that length for any amino acid sequence is determined as follows. First, an amino acid sequence is compared to the identified amino acid sequence (e.g., SEQ ID NO:1) using the BLAST 2 Sequences (B12seq) program from the stand-alone version of BLASTZ containing BLASTN version 2.0.14 and BLASTP version 2.0.14. This stand-alone version of BLASTZ can be obtained from the world wide web at Fish & Richardson P.C.'s web site ("fr" dot "com/blast/") or at the U.S. government's National Center for Biotechnology Information web site ("ncbi" dot "nlm" dot "nih" dot "gov"). The stand-alone version of BLASTZ also can be obtained from the library at the State University of New York at Old Westbury under the call number QH 447.M6714. Instructions explaining how to use the B12seq program can be found in the readme file accompanying BLASTZ. B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences.
  • To compare two amino acid sequences, the options of Bl2seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C:\seq1.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C:\seq2.txt); -p is set to blastp; -o is set to any desired file name (e.g., C:\output.txt); and all other options are left at their default setting. For example, the following command can be used to generate an output file containing a comparison between two amino acid sequences: C:\B12seq -i c:\seql.txt -j c:\seq2.txt ―p blastp ―o c:\output.txt. If the target sequence shares homology with any portion of the identified sequence, then the designated output file will present those regions of homology as aligned sequences. If the target sequence does not share homology with any portion of the identified sequence, then the designated output file will not present aligned sequences. Once aligned, a length is determined by counting the number of consecutive amino acid residues from the target sequence presented in alignment with sequence from the identified sequence (e.g., SEQ ID NO:1) starting with any matched position and ending with any other matched position. A matched position is any position where an identical amino acid residue is presented in both the target and identified sequence. Gaps presented in the target sequence are not counted since gaps are not amino acid residues. Likewise, gaps presented in the identified sequence are not counted since target sequence amino acid residues are counted, not amino acid residues from the identified sequence.
  • The percent identity over a determined length is determined by counting the number of matched positions over that length and dividing that number by the length followed by multiplying the resulting value by 100. For example, if (1) a 50 amino acid target sequence is compared to the sequence set forth in SEQ ID NO:1, (2) the B12seq program presents 20 amino acid residues from the target sequence aligned with a region of the sequence set forth in SEQ ID NO:1 where the first and last amino acid residues of ' that 20 amino acid region are matches, and (3) the number of matches over those 20 aligned amino acids is 18, then the 50 amino acid target sequence contains a length of 20 and a percent identity over that length of 90 (i.e., 18 ÷ 20 * 100 = 90).
  • It will be appreciated that a single amino acid target sequence that aligns with the sequence set forth in SEQ ID NO:1 can have many different lengths with each length having its own percent identity. It is noted that the percent identity value is rounded to the nearest tenth. For example, 78.11, 78.12, 78.13, and 78.14 is rounded down to 78.1, while 78.15, 78.16, 78.17, 78.18, and 78.19 is rounded up to 78.2. It is also noted that the length value will always be an integer.
  • The hybridization conditions can be moderately or highly stringent hybridization conditions. For the purpose of this invention, moderately stringent hybridization conditions mean the hybridization is performed at about 42°C in a hybridization solution containing 25 mM KPO4 (pH 7.4), 5X SSC, 5X Denhart's solution, 50 µg/mL denatured, sonicated salmon sperm DNA, 50% formamide, 10% Dextran sulfate, and 1-15 µg/mL probe (about 5x107 cpm/µg), while the washes are performed at about 50°C with a wash solution containing 2X SSC and 0.1% sodium dodecyl sulfate.
  • Highly stringent hybridization conditions mean the hybridization is performed at about 42°C in a hybridization solution containing 25 mM KPO4 (pH 7.4), 5X SSC, 5X Denhart's solution, 50 µg/mL denatured, sonicated salmon sperm DNA, 50% formamide, 10% Dextran sulfate, and 1-15 ng/mL probe (about 5x107 cpm/µg), while the washes are performed at about 65°C with a wash solution containing 0.2X SSC and 0.1% sodium dodecyl sulfate.
  • In some embodiments, an isoform of BNP can stimulate production of cGMP in human umbilical vascular endothelial cells (HUVEC). Intracellular cGMP production can be assayed using, for example, the BIOTRACK cGMP enzyme immunoassay kit (Amersham Pharmacia Biotech). In other embodiments, the isoform of BNP is vasoactive. Vasoactivity can be assessed by determining responsivity of a blood vessel (e.g., a carotid artery in an organ chamber) to the isoform.
  • Isoforms of BNP can be obtained by extraction from a natural source (e.g., from isolated cells, tissues or bodily fluids), by expression of a recombinant nucleic acid encoding the polypeptide, or by chemical synthesis. For example, standard recombinant technology using expression vectors encoding isoforms ofBNP (as described below) can be used. The resulting polypeptides then can be purified using, for example, affinity chromatographic techniques and HPLC. The extent of purification can be measured by any appropriate method, including but not limited to: column chromatography, polyacrylamide gel electrophoresis, or high-performance liquid chromatography. Isoforms of BNP can be "engineered" to contain a tag sequence that allows the polypeptide to be purified (e.g., captured onto an affinity matrix). For example, a tag such as c-myc, hemagglutinin, polyhistidine, or Flag™ tag (Kodak) can be used to aid polypeptide purification. Such tags can be inserted anywhere within the polypeptide including at either the carboxyl or amino termini. Other fusions that can be used include enzymes that aid in the detection of the polypeptide, such as alkaline phosphatase.
  • Chimeric natriuretic polypeptides can be produced that contain two regions, a first region that includes the N-terminus and ring structure of a mature natriuretic polypeptide (e.g., BNP, DNP, ANP, or CNP) and a second region that includes the C-terminal portion of a BNP isoform. The N-terminus and ring structure of BNP includes residues 1 to 27 of SEQ ID NO:16 while the N-termini and ring structures of DNP and ANP include residues 1 to 23 of SEQ ID NO:17 and SEQ ID NO:18, respectively. The sequences of BNP, DNP, ANP, and CNP are presented in FIG. 4. In other embodiments, the first region can contain the N-terminus and ring structure of a naturietic polypeptide with one to five amino acid substitutions. Suitable C-terminal portions of a BNP isoform have at least 45% identity to the amino acid sequences of SEQ ID NO:1 and 2, as discussed above. The C-terminal portion can have the sequence set forth in SEQ ID NO:20 (described below). Chimeric polypeptides can have biological activities of naturietic peptides, including the ability to stimulate cyclic GMP production in cells or vasoactivity.
  • In some embodiments, a polypeptide of the invention can have the sequence set forth in the formula: Gly-Xaa1- Xaa2- Xaa3- Xaa4- Xaa5- Xaa6- Xaa7- Xaa8- Xaa9- Xaa10-Xaa11- Xaa12- Xaa13- Xaa14- Xaa15 -Xaa16- Xaa17- Xaa18- Xaa19- Xaa20- Xaa21 - Xaa22-Xaa23- Xaa24- Xaa25- Xaa26- Xaa27- Xaa28- Gly- Xaa29- Xaa30- Xaa31- Xaa32, (SEQ ID NO:20), wherein Xaa1 is Glu or Lys; Xaa2 is Pro, His, or Arg; Xaa3 is Pro or Leu; Xaa4 is Pro, Leu, or Ser; Xaa5 is Cys or Pro; Xaa6 is Pro, His, Gln, or Arg; Xaa7 is Arg, Phe, or Leu; Xaa8 is Asp, Gly, or absent; Xaa9 is Ser, Pro, or Leu; Xaa10 is Pro or absent; Xaa11 is Ser, Ala, or absent; Xaa12 is Pro or Ala; Xaa13 is Ala, Phe, Ile, or Leu; Xaa14 is Pro, Lys, or Leu; Xaa15 is Val, Leu, or Trp; Xaa16 is Cys, His, or Val; Xaa17 is Asp, Ala, Ile, Thr, Pro, or Arg; Xaa18 is Thr, Pro, or His; Xaa19 is Val, Ile, Pro, Val, Ser, or Leu; Xaa20 is Arg, Ser, Ile, or Glu; Xaa21 is Val, Ile, Ala, or Pro; Xaa22 is Thr, Val, or Leu; Xaa23 is Leu, Ser, or His; Xaa24 is Gly or Ala; Xaa25 is Phe, Ser, Thr, or Leu; Xaa26 is Val, Asp, or Leu; Xaa27 is Val, Leu, or Ser; Xaa28 is Ser, Arg, or Leu; Xaa29 is Asn, Asp, Pro, or Thr; Xaa30 is His, Gln, Asn, or Thr; Xaa31 is Thr, Ile, or Ser; and Xaa32 is Pro, Leu, or Glu. The amino acids set forth at each position of SEQ ID NO:20 represent the residues that are present in naturally-occurring BNP2 polypeptides, including BNP2 from humans (SEQ ID NO:3); orangutan (SEQ ID NO:7), chimpanzee (SEQ ID NO:9); gorilla (SEQ ID N0:12); cat (SEQ ID NO:12); dog (SEQ ID NO:14); mouse (SEQ ID NO:11); sheep (SEQ ID NO:10); and pig (SEQ ID NO:8). A nucleic acid encoding such polypeptides can be produced as described below.
  • Polypeptides of the invention can be formulated as pharmaceutical compositions by admixture with pharmaceutically acceptable non-toxic excipients or carriers. Such compositions can be administered to a subject in need thereof in an amount effective to treat a heart condition or a kidney condition. Pharmaceutical compositions may be prepared for parenteral administration, particularly in the form of liquid solutions or suspensions in aqueous physiological buffer solutions; for oral administration, particularly in the form of tablets or capsules; or for intranasal administration, particularly in the form of powders, nasal drops, or aerosols. Compositions for other routes of administration may be prepared as desired using standard methods.
  • Formulations for parenteral administration may contain as common excipients sterile water or saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, hydrogenated naphthalenes, and the like. In particular, biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxethylene-polyoxypropylene copolymers are examples of excipients for controlling the release of the polypeptide in vivo. Other suitable parenteral delivery systems include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes. Formulations for inhalation administration may contain excipients such as lactose, if desired. Inhalation formulations may be aqueous solutions containing, for example, polyoxyethylene-9-lauryl ether, glycocholate and deoxycholate, or they may be oily solutions for administration in the form of nasal drops. If desired, the compounds can be formulated as gels to be applied intranasally. Formulations for parenteral administration may also include glycocholate for buccal administration
  • For oral administration, tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g. magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulfate). Tablets can be coated by methods known in the art. Preparations for oral administration can also be formulated to give controlled release of the compound.
  • Nasal preparations can be presented in a liquid form or as a dry product. Nebulised aqueous suspensions or solutions can include carriers or excipients to adjust pH and/or tonicity.
  • Nucleic Acids Encoding Isoforms of BNP
  • The invention also features isolated nucleic acids that encode BNP polypeptides. The term "isolated" as used herein with reference to nucleic acid refers to a naturally-occurring nucleic acid that is not immediately contiguous with both of the sequences with which it is immediately contiguous (one on the 5' end and one on the 3' end) in the naturally-occurring genome of the organism from which it is derived. For example, an isolated nucleic acid can be, without limitation, a recombinant DNA molecule of any length, provided one of the nucleic acid sequences normally found immediately flanking that recombinant DNA molecule in a naturally-occurring genome is removed or absent. Thus, an isolated nucleic acid includes, without limitation, a recombinant DNA that exists as a separate molecule (e.g., a cDNA or a genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences as well as recombinant DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a retrovirus, adenovirus, or herpes virus), or into the genomic DNA of a prokaryote or eukaryote. In addition, an isolated nucleic acid can include a recombinant DNA molecule that is part of a hybrid or fusion nucleic acid sequence.
  • The term "isolated" as used herein with reference to nucleic acid also includes any non-naturally-occurring nucleic acid since non-naturally-occurring nucleic acid sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome. For example, non-naturally-occurring nucleic acid such as an engineered nucleic acid is considered to be isolated nucleic acid. Engineered nucleic acid (e.g., a nucleic acid encoding the polypeptide of SEQ ID NO:20) can be made using common molecular cloning or chemical nucleic acid synthesis techniques. Isolated non-naturally-occurring nucleic acid can be independent of other sequences, or incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a retrovirus, adenovirus, or herpes virus), or the genomic DNA of a prokaryote or eukaryote. In addition, a non-naturally-occurring nucleic acid can include a nucleic acid molecule that is part of a hybrid or fusion nucleic acid sequence. A nucleic acid existing among hundreds to millions of other nucleic acids within, for example, cDNA libraries or genomic libraries, or gel slices containing a genomic DNA restriction digest, is not to be considered an isolated nucleic acid.
  • As used herein, the term "nucleic acid" refers to both RNA and DNA, including mRNA, cDNA, genomic DNA, synthetic (e.g., chemically synthesized) DNA, and nucleic acid analogs. The nucleic acid can be double-stranded or single-stranded, and where single-stranded, can be the sense strand or the antisense strand. In addition, nucleic acid can be circular or linear. Nucleic acid analogs can be modified at the base moiety, sugar moiety, or phosphate backbone to improve, for example, stability, hybridization, or solubility of a nucleic acid. Modifications at the base moiety include deoxyuridine for deoxythymidine, and 5-methyl-2'-deoxycytidine and 5-bromo-2'-deoxycytidine for deoxycytidine. Modifications of the sugar moiety can include modification of the 2' hydroxyl of the ribose sugar to form 2'-O-methyl or 2'-O-allyl sugars. The deoxyribose phosphate backbone can be modified to produce morpholino nucleic acids, in which each base moiety is linked to a six-membered, morpholino ring, or peptide nucleic acids, in which the deoxyphosphate backbone is replaced by a pseudopeptide backbone and the four bases are retained. See, for example, Summerton and Weller (1997) Antisense Nucleic Acid Drug Dev. 7:187-195; and Hyrup et al. (1996) Bioorgan. Med. Chem. 4:5-23. In addition, the deoxyphosphate backbone can be replaced with, for example, a phosphorothioate or phosphorodithioate backbone, a phosphoroamidite, or an alkyl phosphotriester backbone.
  • Nucleic acids of the invention can have the sequence set forth in SEQ ID NOS: 5 or 6 (see FIGS 1 and 2) or have a sequence having at least 45% identity (e.g., 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95 identity) to the sequence set forth in nucleotides 383 to 489 of SEQ ID NO:5 or nucleotides 388 to 432 of SEQ ID NO:6. Nucleotides 383 to 489 of SEQ ID NO:5 encode the amino acid sequence set forth in SEQ ID NO:1. Nucleotides 388 to 432 of SEQ ID NO:6 encode the amino acid sequence set forth in SEQ ID NO:2.
  • Sequence identity can be determined as described above. BLASTN is used to compare nucleic acid sequences. To compare two nucleic acid sequences, the options are set as follows: -i is set to a file containing the first nucleic acid sequence to be compared (e.g., C:\seq1.txt); -j is set to a file containing the second nucleic acid sequence to be compared (e.g., C:\seq2.txt); -p is set to blastn; -o is set to any desired file name (e.g., C:\output.txt); -q is set to -1; -r is set to 2; and all other options are left at their default setting. The following command will generate an output file containing a comparison between two sequences: C:\B12seq -i c:\seq1.txt -j c:\seq2.txt -p blastn -o c:\output.txt -q -1 -r 2. If the target sequence shares homology with any portion of the identified sequence, then the designated output file will present those regions of homology as aligned sequences. If the target sequence does not share homology with any portion of the identified sequence, then the designated output file will not present aligned sequences.
  • Once aligned, a length is determined by counting the number of consecutive nucleotides from the target sequence presented in alignment with sequence from the identified sequence starting with any matched position and ending with any other matched position. A matched position is any position where an identical nucleotide is presented in both the target and identified sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides. Likewise, gaps presented in the identified sequence are not counted since target sequence nucleotides are counted, not nucleotides from the identified sequence.
  • Typically, isolated nucleic acids are at least 10 nucleotides in length (e.g., 10, 15, 20, 25, 30, 35, 40, 50, 75, 100, 200, 300, 350, 400, or more nucleotides in length). Nucleic acid molecules that are less than full-length can be useful, for example, as primers or probes for diagnostic purposes. Isolated nucleic acid molecules can be produced by standard techniques, including, without limitation, common molecular cloning and chemical nucleic acid synthesis techniques. For example, polymerase chain reaction (PCR) techniques can be used. PCR refers to a procedure or technique in which target nucleic acids are enzymatically amplified. Sequence information from the ends of the region of interest or beyond typically is employed to design oligonucleotide primers that are identical in sequence to opposite strands of the template to be amplified. PCR can be used to amplify specific sequences from DNA as well as RNA, including sequences from total genomic DNA or total cellular RNA. Primers typically are 15 to 50 nucleotides in length, but can range from 10 nucleotides to hundreds of nucleotides in length. For example, a primer can be 12, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, or 45 nucleotides in length. A primer can be purified from a restriction digest by conventional methods, or can be chemically synthesized. Primers typically are single-stranded for maximum efficiency in amplification, but a primer can be double-stranded. Double-stranded primers are first denatured (e.g., treated with heat) to separate the strands before use in amplification. General PCR techniques are described, for example in PCR Primer: A Laboratory Manual, ed. by Dieffenbach and Dveksler, Cold Spring Harbor Laboratory Press, 1995. When using RNA as a source of template, reverse transcriptase can be used to synthesize a complementary DNA (cDNA) strand. Ligase chain reaction, strand displacement amplification, self-sustained sequence replication or nucleic acid sequence-based amplification also can be used to obtain isolated nucleic acids. See, for example, Lewis Genetic Engineering News 12(9):1 (1992); Guatelli et al. (1990) Proc. Natl. Acad. Sci. USA, 87:1874-1878; and Weiss (1991) Science 254:1292.
  • Isolated nucleic acids also can be chemically synthesized, either as a single nucleic acid molecule (e.g., using automated DNA synthesis in the 3' to 5' direction using phosphoramidite technology) or as a series of oligonucleotides. For example, one or more pairs of long oligonucleotides (e.g., >100 nucleotides) can be synthesized that contain the desired sequence, with each pair containing a short segment of complementarity (e.g., about 15 nucleotides) such that a duplex is formed when the oligonucleotide pair is annealed. DNA polymerase is used to extend the oligonucleotides, resulting in a single, double-stranded nucleic acid molecule per oligonucleotide pair, which then can be ligated into a vector.
  • Isolated nucleic acids also can be obtained by mutagenesis. For example, the sequences depicted in FIGS. 1, 2, or 3 can be mutated using standard techniques such as, for example, oligonucleotide-directed mutagenesis and/or site-directed mutagenesis through PCR. See, Short Protocols in Molecular Biology,Chapter 8, Green Publishing Associates and John Wiley & Sons, Edited by Ausubel et al., 1992. Examples of positions to be modified can be identified from the sequence alignment of FIG. 3.
  • Nucleic acids encoding a polypeptide provided herein can be formulated as pharmaceutical compositions by admixture with pharmaceutically acceptable non-toxic excipients or carriers. Such compositions can be administered to a subject in need thereof in an amount effective to treat a heart condition or a kidney condition.
  • Vectors and Host Cells
  • The invention also provides vectors containing nucleic acids such as those described above. As used herein, a "vector" is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors of the invention can be expression vectors. An "expression vector" is a vector that includes one or more expression control sequences, and an "expression control sequence" is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence.
  • In the expression vectors of the invention, the nucleic acid is operably linked to one or more expression control sequences. As used herein, "operably linked" means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest. Examples of expression control sequences include promoters, enhancers, and transcription terminating regions. A promoter is an expression control sequence composed of a region of a DNA molecule, typically within 100 nucleotides upstream of the point at which transcription starts (generally near the initiation site for RNA polymerase II). To bring a coding sequence under the control of a promoter, it is necessary to position the translation initiation site of the translational reading frame of the polypeptide between one and about fifty nucleotides downstream of the promoter. Enhancers provide expression specificity in terms of time, location, and level. Unlike promoters, enhancers can function when located at various distances from the transcription site. An enhancer also can be located downstream from the transcription initiation site. A coding sequence is "operably linked" and "under the control" of expression control sequences in a cell when RNA polymerase is able to transcribe the coding sequence into mRNA, which then can be translated into the protein encoded by the coding sequence.
  • Suitable expression vectors include, without limitation, plasmids and viral vectors derived from, for example, bacteriophage, baculoviruses, tobacco mosaic virus, herpes viruses, cytomegalovirus, retroviruses, poxviruses, adenoviruses, and adeno-associated viruses. Numerous vectors and expression systems are commercially available from such corporations as Novagen (Madison, WI), Clontech (Palo Alto, CA), Stratagene (La Jolla, CA), and Invitrogen/Life Technologies (Carlsbad, CA).
  • An expression vector can include a tag sequence designed to facilitate subsequent manipulation of the expressed nucleic acid sequence (e.g., purification or localization). Tag sequences, such as green fluorescent protein (GFP), glutathione S-transferase (GST), polyhistidine, c-myc, hemagglutinin, or Flag™ tag (Kodak, New Haven, CT) sequences typically are expressed as a fusion with the encoded polypeptide. Such tags can be inserted anywhere within the polypeptide including at either the carboxyl or amino terminus.
  • The invention also provides host cells containing vectors of the invention. The term "host cell" is intended to include prokaryotic and eukaryotic cells into which a vector can be introduced. Any method can be used to introduce a vector into a cell. For example, calcium phosphate precipitation, electroporation, heat shock, lipofection, microinjection, and viral-mediated nucleic acid transfer can be used introduce isolated nucleic acid into cells. In addition, naked DNA can be delivered directly to cells in vivo as described elsewhere ( U.S. Patent Nos. 5,580,859 and 5,589,466 ).
  • Methods of Using BNP2 or BNP3 To Diagnose Heart Conditions
  • In general, methods of the invention include detecting the presence or absence of an isoform of BNP in a biological sample from a patient (e.g., a human patient) and diagnosing the patient based on the presence or absence of the BNP isoform. In other embodiments, the level of the BNP isoform can be determined and compared to the level of the isoform from a control population (e.g., the average level of BNP2 from a plurality of control subjects without heart conditions). Thus, the presence of an isoform of BNP or an increase in the level of the isoform relative to that of the control population is indicative of a heart condition. Suitable biological samples for detecting isoforms of BNP include, for example, blood (including whole blood, plasma, and serum), urine, saliva, heart tissue, and circulating cells.
  • Additional factors that can be considered when diagnosing heart conditions can include, for example, family history or other genetic factors and the levels of other cardiac markers such as troponin I or T, high sensitive C-reactive protein (hs-CRP), creatine kinase (CK), CK-MB, creatinine, or myoglobin. In general, myoglobin is not cardiac specific, but is released from infarcted myocardium at an early stage (about 2-3 hours post infarction) and returns to normal within about 24 hours. Cardiac isoforms of troponin I and troponin T are specific, but appear in the circulation later than myoglobin (5 to 48 hours post infarction). Myocardial tissue contains one isoform of CK-MB, while skeletal tissue has different isoforms. Antibodies having specific binding affinity for such cardiac markers are available commercially.
  • The presence, absence, or level of a BNP isoform in a subject also can be used to monitor treatment (e.g., treatment with an ACE inhibitor or β blocker) for a heart condition. For example, the subject's baseline level of a BNP isoform before treatment can be compared to the level of the isoform at various time points after treatment (e.g., one or more hours, days, weeks, or months after treatment). A decrease in the level of the BNP isoform relative to the baseline level is indicative of a positive response to treatment. Treatment can be monitored based on a combination of the presence, absence, or level of the BNP isoform and the level of other cardiac markers as described above.
  • Detecting Isoforms of BNP
  • Isoforms of BNP such as BNP2 or BNP3 can be detected, for example, immunologically using one or more antibodies. As used herein, the terms "antibody" or "antibodies" include intact molecules as well as fragments thereof that are capable of binding to an epitopic determinant of a BNP isoform. The term "epitope" refers to an antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains, and typically have specific three-dimensional structural characteristics, as well as specific charge characteristics. Epitopes generally have at least five contiguous amino acids (a continuous epitope), or alternatively can be a set of noncontiguous amino acids that define a particular structure (e.g., a conformational epitope). The terms "antibody" and "antibodies" include polyclonal antibodies, monoclonal antibodies, humanized or chimeric antibodies, single chain Fv antibody fragments, Fab fragments, and F(ab)2 fragments. Polyclonal antibodies are heterogenous populations of antibody molecules that are contained in the sera of the immunized animals. Monoclonal antibodies are homogeneous populations of antibodies to a particular epitope of an antigen.
  • Antibody fragments that have specific binding affinity for an isoform of BNP can be generated by known techniques. For example, F(ab')2 fragments can be produced by pepsin digestion of the antibody molecule; Fab fragments can be generated by reducing the disulfide bridges of F(ab')2 fragments. Alternatively, Fab expression libraries can be constructed. See, for example, Huse et al., Science 246:1275 (1989). Once produced, antibodies or fragments thereof are tested for recognition of a BNP isoform by standard immunoassay methods including ELISA techniques, radioimmunoassays, and Western blotting. See, Short Protocols in Molecular Biology, Chapter 11, Green Publishing Associates and John Wiley & Sons, Edited by Ausubel, F.M et al., 1992.
  • In immunological assays, an antibody having specific binding affinity for an isoform of BNP or a secondary antibody that binds to such an antibody can be labeled, either directly or indirectly. Suitable labels include, without limitation, radionuclides (e.g., 125I, 131I, 35S; 3H, 32P, 33p or 14C), fluorescent moieties (e.g., fluorescein, FITC, PerCP, rhodamine, or PE), luminescent moieties (e.g., Qdot™ nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, CA), compounds that absorb light of a defined wavelength, or enzymes (e.g., alkaline phosphatase or horseradish peroxidase). Antibodies can be indirectly labeled by conjugation with biotin then detected with avidin or streptavidin labeled with a molecule described above. Methods of detecting or quantifying a label depend on the nature of the label and are known in the art. Examples of detectors include, without limitation, x-ray film, radioactivity counters, scintillation counters, spectrophotometers, colorimeters, fluorometers, luminometers, and densitometers. Combinations of these approaches (including "multi-layer" assays) familiar to those in the art can be used to enhance the sensitivity of assays.
  • Immunological assays for detecting an isoform of BNP can be performed in a variety of known formats, including sandwich assays, competition assays (competitive RIA), or bridge immunoassays. See, for example, U.S. Patent Nos. 5,296,347 ; 4,233,402 ; 4,098,876 ; and 4,034,074 . Methods of detecting an isoform of BNP generally include contacting a biological sample with an antibody that binds to the isoform ofBNP and detecting binding of the isoform of BNP to the antibody. For example, an antibody having specific binding affinity for an isoform of BNP can be immobilized on a solid substrate by any of a variety of methods known in the art and then exposed to the biological sample. Binding of the BNP isoform to the antibody on the solid substrate can be detected by exploiting the phenomenon of surface plasmon resonance, which results in a change in the intensity of surface plasmon resonance upon binding that can be detected qualitatively or quantitatively by an appropriate instrument, e.g., a Biacore apparatus (Biacore International AB, Rapsgatan, Sweden). Alternatively, the antibody is labeled and detected as described above. A standard curve using known quantities of the isoform can be generated to aid in the quantitation of the levels of the isoform.
  • In other embodiments, a "sandwich" assay in which a capture antibody is immobilized on a solid substrate is used to detect the presence, absence, or level of an isoform of BNP. The solid substrate can be contacted with the biological sample such that any BNP2 or BNP3 in the sample can bind to the immobilized antibody. The presence, absence, or level of the BNP isoform bound to the antibody can be determined using a "detection" antibody having specific binding affinity for the isoform and the methods described above. In some embodiments, a capture antibody is used that has binding affinity for BNP as well as BNP2 and BNP3. In this embodiment, a detection antibody can be used that has specific binding affinity for BNP2 or BNP3. It is understood that in sandwich assays, the capture antibody should not bind to the same epitope (or range of epitopes in the case of a polyclonal antibody) as the detection antibody. Thus, if a monoclonal antibody is used as a capture antibody, the detection antibody can be another monoclonal antibody that binds to an epitope that is either completely physically separated from or only partially overlaps with the epitope to which the capture monoclonal antibody binds, or a polyclonal antibody that binds to epitopes other than or in addition to that to which the capture monoclonal antibody binds. If a polyclonal antibody is used as a capture antibody, the detection antibody can be either a monoclonal antibody that binds to an epitope that is either completely physically separated from or partially overlaps with any of the epitopes to which the capture polyclonal antibody binds, or a polyclonal antibody that binds to epitopes other than or in addition to that to which the capture polyclonal antibody binds. Sandwich assays can be performed as sandwich ELISA assays, sandwich Western blotting assays, or sandwich immunomagnetic detection assays.
  • Suitable solid substrates to which an antibody (e.g., a capture antibody) can be bound include, without limitation, microtiter plates, tubes, membranes such as nylon or nitrocellulose membranes, and beads or particles (e.g., agarose, cellulose, glass, polystyrene, polyacrylamide, magnetic, or magnetizable beads or particles). Magnetic or magnetizable particles can be particularly useful when an automated immunoassay system is used.
  • Antibodies having specific binding affinity for an isoform of BNP can be produced through standard methods. In general, a polypeptide can be recombinantly produced as described above, or can be purified from a biological sample, and used to immunize host animals, including rabbits, chickens, mice, guinea pigs, or rats. For example, a polypeptide having the amino acid sequence set forth in SEQ ID NOS:1 or 2, or fragments thereof that are at least six amino acids in length, can be used to immunize an animal. Various adjuvants that can be used to increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin and dinitrophenol. Monoclonal antibodies can be prepared using a BNP polypeptide and standard hybridoma technology. In particular, monoclonal antibodies can be obtained by any technique that provides for the production of antibody molecules by continuous cell lines in culture such as described by Kohler, G. et al., Nature, 256:495 (1975), the human B-cell hybridoma technique (Kosbor et al., Immunology Today, 4:72 (1983); Cole et al., Proc. Natl. Acad. Sci USA, 80:2026 (1983)), and the EBV-hybridoma technique (Cole et al., "Monoclonal Antibodies and Cancer Therapy," Alan R. Liss, Inc., pp. 77-96 (1983)). Such antibodies can be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD, and any subclass thereof. The hybridoma producing the monoclonal antibodies of the invention can be cultivated in vitro and in vivo.
  • Alternative techniques for detecting BNP2 and BNP3 include mass-spectrophotometric techniques such as electrospray ionization (ESI), and matrix-assisted laser desorption-ionization (MALDI). See, for example, Gevaert et al., Electrophoresis 22(9):1645-; Chaurand et al., J Am Soc Mass Spectrom 10(2):91-103,1999. Mass spectrometers useful for such applications are available from Applied Biosystems (Foster City, CA); Bruker Daltronics (Billerica, MA); and Amersham Pharmacia (Sunnyvale, CA).
  • Detecting Nucleic Acids Encoding Isoforms of BNP
  • Any one of a number of clinical diagnostic techniques can be used to detect ribonucleic acids encoding an isoform of BNP. Hybridization can be performed on a solid substrate such as a nylon membrane (e.g., a macroarray) or a microarray (e.g., a microchip) or in solution (e.g., ORIGEN technology). In some embodiments, nucleic acid based methods can include an amplification step using, for example, PCR. Template nucleic acid need not be purified for PCR; it can be a minor fraction of a complex mixture, such as a cell lysate. Template DNA or RNA can be extracted from a biological sample using routine techniques.
  • Once a PCR amplification product is generated, it can be detected by, for example, hybridization using FRET technology. FRET technology (see, for example, U.S. Patent Nos. 4,996,143 , 5,565,322 , 5,849,489 , and 6,162,603 ) is based on the concept that when a donor fluorescent moiety and a corresponding acceptor fluorescent moiety are positioned within a certain distance of each other, energy transfer taking place between the two fluorescent moieties can be visualized or otherwise detected and quantitated. Two oligonucleotide probes, each containing a fluorescent moiety, can hybridize to an amplification product at particular positions determined by the complementarity of the oligonucleotide probes to the target nucleic acid sequence. Upon hybridization of the oligonucleotide probes to the amplification product at the appropriate positions, a FRET signal is generated. Hybridization temperatures and times can range from about 35°C to about 65°C for about 10 seconds to about 1 minute. Detection of FRET can occur in real-time, such that the increase in an amplification product after each cycle of a PCR assay is detected and, in some embodiments, quantified.
  • Fluorescent analysis and quantification can be carried out using, for example, a photon counting epifluorescent microscope system (containing the appropriate dichroic mirror and filters for monitoring fluorescent emission in a particular range of wavelengths), a photon counting photomultiplier system, or a fluorometer. Excitation to initiate energy transfer can be carried out with an argon ion laser, a high intensity mercury arc lamp, a fiber optic light source, or another high intensity light source appropriately filtered for excitation in the desired range.
  • Fluorescent moieties can be, for example, a donor moiety and a corresponding acceptor moiety. As used herein with respect to donor and corresponding acceptor fluorescent moieties, "corresponding" refers to an acceptor fluorescent moiety having an emission spectrum that overlaps the excitation spectrum of the donor fluorescent moiety. The wavelength maximum of the emission spectrum of an acceptor fluorescent moiety typically should be at least 100 nm greater than the wavelength maximum of the excitation spectrum of the donor fluorescent moiety, such that efficient non-radiative energy transfer can be produced there between.
  • Fluorescent donor and corresponding acceptor moieties are generally chosen for (a) high efficiency Förster energy transfer; (b) a large final Stokes shift (>100 nm); (c) shift of the emission as far as possible into the red portion of the visible spectrum (>600 nm); and (d) shift of the emission to a higher wavelength than the Raman water fluorescent emission produced by excitation at the donor excitation wavelength. For example, a donor fluorescent moiety can be chosen with an excitation maximum near a laser line (for example, Helium-Cadmium 442 nm or Argon 488 nm), a high extinction coefficient, a high quantum yield, and a good overlap of its fluorescent emission with the excitation spectrum of the corresponding acceptor fluorescent moiety. A corresponding acceptor fluorescent moiety can be chosen that has a high extinction coefficient, a high quantum yield, a good overlap of its excitation with the emission of the donor fluorescent moiety, and emission in the red part of the visible spectrum (>600 nm).
  • Representative donor fluorescent moieties that can be used with various acceptor fluorescent moieties in FRET technology include fluorescein, Lucifer Yellow, B-phycoerythrin, 9-acridineisothiocyanate, Lucifer Yellow VS, 4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid, 7-diethylamino-3-(4'-isothiocyanatophenyl)-4-methylcoumarin, succinimdyl 1-pyrenebutyrate, and 4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic acid derivatives. Representative acceptor fluorescent moieties, depending upon the donor fluorescent moiety used, include LC™-Red 640, LC™-Red 705, Cy5, Cry5.5, Lissamine rhodamine B sulfonyl chloride, tetramethyl rhodamine isothiocyanate, rhodamine x isothiocyanate, erythrosine isothiocyanate, fluorescein, diethylenetriamine pentaacetate, and other chelates of Lanthanide ions (e.g., Europium, or Terbium). Donor and acceptor fluorescent moieties can be obtained from, for example, Molecular Probes, Inc. (Eugene, OR) or Sigma Chemical Co. (St. Louis, MO).
  • Donor and acceptor fluorescent moieties can be attached to probe oligonucleotides via linker arms. The length of each linker arm is important, as the linker arms will affect the distance between the donor and acceptor fluorescent moieties. The length of a linker arm for the purpose of the present invention is the distance in Angstroms (Å) from the nucleotide base to the fluorescent moiety. In general, a linker arm is from about 10 to about 25 Å in length. The linker arm may be of the kind described, for example, in WO 84/03285 . WO 84103285 also discloses methods for attaching linker arms to a particular nucleotide base, as well as methods for attaching fluorescent moieties to a linker arm.
  • An acceptor fluorescent moiety such as an LC™-Red 640-NHS-ester can be combined with C6-Phosphoramidites (available from ABI (Foster City, CA) or Glen Research (Sterling, VA)) to produce, for example, LC™-Red 640-Phosphoramidite. Linkers frequently used to couple a donor fluorescent moiety such as fluorescein to an oligonucleotide include thiourea linkers (FITC-derived, for example, fluorescein-CPG's from Glen Research or ChemGene (Ashland, MA)), amide-linkers (fluorescein-NHS-ester-derived, such as fluorescein-CPG from BioGenex (San Ramon, CA)), or 3'-amino-CPG's that require coupling of a fluorescein-NHS-ester after oligonucleotide synthesis.
  • Using commercially available real-time PCR instrumentation (e.g., LightCycler™, Roche Molecular Biochemicals, Indianapolis, IN), PCR amplification, detection, and quantification of an amplification product can be combined in a single closed cuvette with dramatically reduced cycling time. Since detection and quantification occur concurrently with amplification, real-time PCR methods obviate the need for manipulation of the amplification product, and diminish the risk of cross-contamination between amplification products. Real-time PCR greatly reduces turn-around time and is an attractive alternative to conventional PCR techniques in the clinical laboratory or in the field.
  • Control samples can be included within each thermocycler run. Positive control samples can amplify a nucleic acid control template (e.g., a nucleic acid other than a target nucleic acid) using, for example, control primers and control probes. Positive control samples also can amplify, for example, a plasmid construct containing a control nucleic acid template. Such a plasmid control can be amplified internally (e.g., within the sample) or in a separate sample run side-by-side with the test samples. Each thermocycler run also should include a negative control that, for example, lacks the target template DNA. Such controls are indicators of the success or failure of the amplification, hybridization and/or FRET reaction. Therefore, control reactions can readily determine, for example, the ability of primers to anneal with sequence-specificity and to initiate elongation, as well as the ability of probes to hybridize with sequence-specificity and for FRET to occur.
  • Another FRET format utilizes TaqMan® technology to detect the presence, absence, or level of an amplification product, and hence, the presence, absence, or level of nucleic acid encoding an isoform of BNP. TaqMan® technology utilizes one single-stranded hybridization probe labeled with two fluorescent moieties. When a first fluorescent moiety is excited with light of a suitable wavelength, the absorbed energy is transferred to a second fluorescent moiety according to the principles of FRET. The second fluorescent moiety is generally a quencher molecule. During the annealing step of the PCR reaction, the labeled hybridization probe binds to the target DNA (i.e., the amplification product) and is degraded by the 5' to 3' exonuclease activity of the Taq Polymerase during the subsequent elongation phase. As a result, the excited fluorescent moiety and the quencher moiety become spatially separated from one another. As a consequence, upon excitation of the first fluorescent moiety in the absence of the quencher, the fluorescence emission from the first fluorescent moiety can be detected. By way of example, an ABI PRISM® 7700 Sequence Detection System (Applied Biosystems, Foster City, CA) uses TaqMan® technology, and is suitable for performing the methods described herein for detecting isoforms of BNP. Information on PCR amplification and detection using an ABI PRISM® 7700 system can be found at the website of Applied Biosystems.
  • Molecular beacons in conjunction with FRET also can be used to detect the presence of an amplification product using the real-time PCR methods of the invention. Molecular beacon technology uses a hybridization probe labeled with a first fluorescent moiety and a second fluorescent moiety. The second fluorescent moiety is generally a quencher, and the fluorescent labels are typically located at each end of the probe. Molecular beacon technology uses a probe oligonucleotide having sequences that permit secondary structure formation (e.g., a hairpin). As a result of secondary structure formation within the probe, both fluorescent moieties are in spatial proximity when the probe is in solution. After hybridization to the target nucleic acids (i.e., amplification products), the secondary structure of the probe is disrupted and the fluorescent moieties become separated from one another such that after excitation with light of a suitable wavelength, the emission of the first fluorescent moiety can be detected.
  • As an alternative to FRET, amplification product can be detected using, for example, a fluorescent DNA binding dye (e.g., SYBRGreenI® or SYBRGold® (Molecular Probes)). Upon interaction with an amplification product, such DNA binding dyes emit a fluorescent signal after excitation with light at a suitable wavelength. A double-stranded DNA binding dye such as a nucleic acid intercalating dye also can be used. When double-stranded DNA binding dyes are used, a melting curve analysis usually is performed for confirmation of the presence of the amplification product.
  • Articles of Manufacture
  • A BNP isoform, a nucleic acid encoding a BNP isoform, or an antibody having specific binding affinity for an isoform of BNP (e.g., BNP2 or BNP3) can be combined with packaging material and sold as a kit. Such kits can be useful for diagnosing heart conditions, monitoring treatment of heart conditions, monitoring progression of heart disease, or treating heart or kidney conditions. Components and methods for producing articles of manufactures are well known. The articles of manufacture may combine one or more polypeptides, nucleic acids, or antibodies as described herein. In addition, the articles of manufacture may further include reagents such as secondary antibodies, anti-BNP antibodies, buffers, indicator molecules, solid phases (e.g., beads) and/or other useful agents for diagnosing heart conditions, monitoring treatment of heart conditions, or monitoring progression of heart disease. An antibody can be in a container, such as a plastic, polyethylene, polypropylene, ethylene, or propylene vessel that is either a capped tube or a bottle, or can be included on a solid phase, e.g., a handheld device for bedside testing that includes an antibody (e.g., an anti-BNP2 or BNP3 antibody). Instructions describing how the various reagents are effective for treating heart or kidney conditions, monitoring treatment of heart conditions, or monitoring progression of heart disease also may be included in such kits.
  • The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
  • EXAMPLES Example 1 - Identification of Brain Natriuretic Peptide-2 (BNP-2)
  • It was determined that intron 2 of the BNP genomic sequence encoded a polypeptide having homology to the C-terminal of the snake DNP polypeptide. To determine if the polypeptide encoded by intron 2 was expressed, Northern blotting was performed using cellular RNA isolated from kidney, brain, and heart (left ventricles and atria) tissue of patients with and without heart failure. Approximately 5 µg of RNA was electrophoresed through a 1% agarose gel containing formaldehyde and transferred to a nylon membrane. Northern blotting was performed using the NorthernMax™ kit from Ambion, Inc. (Austin, TX), according to the manufacturer's instructions. The membranes were UV autocross-linked, prehybridized at 42°C for 1 hour, and hybridized at 42°C overnight with a labeled probe containing the second intron sequence. The probe was labeled with 32P using the Random Primers DNA Labeling System (Gibco BRL). The membranes were washed twice in low stringency buffer (provided in NorthernMax™ kit, equivalent to 2X SSC, 0.1% SDS or 2X SSPE, 0.1% SDS) at room temperature, five minutes per wash, then washed twice in a high stringency buffer (provided in NorthernMaX™ kit, equivalent to 0.1X SSC, 0.1% SDS or O.1X SSPE, 0.1% SDS) at 42°C, 15 minutes per wash. Hybridization signals on the blots were analyzed by autoradiography. Message for the second intron was detected in the left atrium of heart failure patients.
  • Example 2 - Cloning of Human BNP-2
  • Total RNA was isolated from normal and heart failure human heart tissue using TRIzol® Reagent (Gibco BRL). Complementary DNA (cDNA) was produced using an oligo(dT) primer and the ThermoScript™ RT-PCR Kit from Invitrogen Corp. (Carlsbad, CA) according to the manufacturer's instructions. RT-PCR was performed using a forward primer having the sequence: 5'-AGACATGGATCCCCAGACAG-3' (SEQ ID NO:21; 5' start codon is underlined) and a reverse primer having the sequence: 5'-CAAGAGGAAGCGATGTCCAG-3' (SEQ ID NO:22, positioned at nucleotides 113 to 133 in the second intron). After combining the cDNA and primers, an initial denaturation was performed at 94°C for 4 min, followed by 35 cycles of denaturation at 94°C for 30 sees, annealing at 52°C for 1 min, and elongation at 72°C for 45 sec then a final extension at 72°C for 10 min. The resulting PCR product (∼520bp hBNP2 cDNA) was subcloned into Topo vector and sequenced for confirmation. The nucleic acid sequence of the hBNP2 cDNA is shown in FIG. 1A.
  • Example 3 - Cloning of Dog BNP-2
  • Total RNA was isolated from normal and heart failure dog heart tissue using TRIzol® Reagent (Gibco BRL). cDNA was made using an oligo(dT) primer and the ThermoScript™ RT-PCR Kit from Invitrogen Corp. (Carlsbad, CA) according to the manufacturer's instructions. RT-PCR was performed using a forward primer having the sequence: 5'-TTCTCTCCAGCGACATGGAG-3' (SEQ ID NO:23, 5' start codon is underlined) and a reverse primer having the sequence: 5'-GGACTCTTTCTGCTCCAAGG-3' (SEQ ID NO:24, positioned at nucleotides 288 to 308 in the second intron). After combining the cDNA and primers, an initial denaturation was performed at 94°C for 4 min, followed by 35 cycles of denaturation at 94°C for 30 secs, annealing at 55°C for 1 min, and elongation at 72°C for 45 sec then a final extension at 72°C for 10 min. The resulting PCR product (∼540bp dBNP2 cDNA) was subcloned into Topo vector and sequenced for confirmation. The nucleic acid sequence of the dBNP cDNA is shown in FIG. 1B.
  • Example 4 - Cloning of Human BNP-3
  • Total RNA was isolated from human heart tissue and cDNA were produced as described in Example 2. RT-PCR was performed using a forward primer having the sequence: 5'-AGACATGGATCCCCAGAGAG-3' (SEQ ID NO:25, 5' start codon is underlined) and a reverse primers having the sequence: 5'-TTTCTGCACCACTTTGCAGC-3' (SEQ ID NO:26, where the underlined portion of the primer is the 3' sequence of the second exon, and the non-underlined portion of the primer corresponds to position 289-300 of the second intron). After combining the cDNA and primers, an initial denaturation was performed at 94°C for 4 min, followed by 35 cycles of denaturation at 94°C for 30 sees, annealing at 60°C for 1 min, and elongation at 72°C for 45 sec then a final extension at 72°C for 10 min. The resulting PCR product (∼380bp hBNP3 cDNA) was subcloned into Topo vector and sequenced for confirmation. The nucleic acid sequence of hBNP3 is shown in FIG. 2.
  • Example 5 - Production of anti-human BNP2 antibody
  • A peptide corresponding to the residues 27-60 of the mature human BNP2 peptide was synthesized by the Mayo protein core facility and used to produce polyclonal antibodies. Two rabbits were inoculated initially with 500 µg of the peptide plus Complete Freund's adjuvant followed by three booster inoculations of 250 µg of the peptide plus incomplete Freund's adjuvant. After each booster, sera were evaluated by Western-blotting. One of the rabbits (#1105) exhibited a specific response after immunization and continues to maintain a high antibody titer with periodic boosters.
  • The polyclonal anti-BNP2 antibody was used to detect BNP2 in human heart tissue. Two sets of slices of paraffin embedded, human heart, left atrial tissues (normal and heart failure) were de-paraffinized and treated with antigen retrieval buffer. One set of slices was incubated with 5 times diluted polyclonal rabbit anti-BNP2 antibody and the other with preimmune rabbit serum. Anti-rabbit biotin conjugate and streptavidinalkaline phosphatase were used for color development. BNP2 was detected only in the heart tissue from the heart failure patient.
  • Example 6 - Production of anti-human BNP3 antibody
  • A peptide corresponding to the residues 27-41 of the mature human BNP3 peptide was synthesized by the Mayo protein core facility and used to produce polyclonal antibodies. Two rabbits were inoculated initially with 500 µg of the peptide plus Complete Freund's adjuvant followed by three booster inoculations of 250 µg of the peptide plus incomplete Freund's adjuvant. After each booster, sera were evaluated by Western blotting. One of the rabbits (#1403) exhibited a specific response after immunization and continues to maintain a high antibody titer with periodic boosters.
  • The polyclonal anti-BNP32 antibody was used to detect BNP3 in human heart tissue. Two sets of slices of paraffin embedded, human heart, left atrial tissues (normal and heart failure) were de-paraffinized and treated with antigen retrieval buffer. One set of slices was incubated with 5 times diluted polyclonal rabbit anti-BNP3 antibody and the other with preimmune rabbit serum. Anti-rabbit biotin conjugate and streptavidinalkaline phosphatase were used for color development. BNP3 was detected only in the heart tissue from the heart failure patient.
  • Example 7 - Expression levels of BNP isoforms in human heart tissue
  • Real-time PCR was used to assess the expression levels of BNP, BNP2, and BNP3 in both normal atria tissue and atria heart failure tissue. The level of GAPDH in RNA was used as the internal control. Total RNA was isolated from heart tissues as described above in Example 2. First-strand cDNA were synthesized by reverse transcriptase and oligo dT. PCR was performed using a LightCycler instrument and the FastStart DNA SYBR Green I Kit (Roche). The PCR reaction mixture contained 2 gel cDNA, 2 µL FastStart DNA Master SYBR® Green I (Roche), 2.4 µL MgCl2 stock solution (25 mM), 0.5 µM of each primer (see Table 1), and sterile H2O in a total volume of 20 µl. All primers were selected using Primer3 software (Whitehead Institute). TABLE 1
    Sequence (5' to 3' orientation) SEQ ID NO:
    Human GADPH
    Forward GAGTCAACGGATTTGGTCGT 27
    Reverse TTGATTTTGGAGGGATCTCG 28
    Human BNP
    Forward CTTCTTGCATCTGGCTTTCC 29
    Reverse AGGGATGTCTGCTCCACCT 30
    Human BNP2
    Forward GGACATCGCTTCCTCTTTGTT 31
    Reverse GAAGGTATTGTGGGCATGGT 32
    Human BNP3
    Forward TCCCACAGGTGGTCTGGAAGT 33
    Reverse TTCTGCACCACTTTGCAGC 34
  • Products were amplified using 45 cycles of denaturation at 95°C for 10 sec, annealing at 60°C for 5 sec, and extension at 72°C for 10 sec. Purified PCR products from each reaction were measured and served as quantitative standards. All quantitations were normalized to the GAPDH endogenous control. No template controls were used to determine whether fluorescent contaminants were present in the sample. To confirm amplification specificity, the PCR products were subjected to a melting-curve analysis and subsequent agarose gel electrophoresis.
  • As indicated in Table 2, BNP3 was not found in normal heart tissue. The expression level of BNP-2 in heart failure heart tissue was about 7 times higher than the level in normal heart tissue. Messenger RNA for BNP2 and BNP3 represent up to 5% of all BNP RNA. TABLE 2
    BNP BNP2 BNP3
    Normal heart tissue 58 2025 0.19
    Heart failure heart tissue 233100 13151 3807
  • Example 8 - Stimulation of cGMP production with BNP isoforms
  • Human umbilical vascular endothelial cells (HUVEC) were cultured in 96-well plates using endothelial cell medium (EGMT™-2) supplemented with the components provided by the EGMT™-2 BulletKit (CC-3162) (Clonetics, East Rutherford, NJ). After cells reached about 80% confluency, the plates were washed with phosphate-buffered saline (PBS) then incubated for 30 minutes with 0, 0.1,1, or 10 µM of synthetic hBNP3 mature peptide (SPKMVQGSGCFGRKMDRISSSSGLGCKWQKENQTFPPGFL, SEQ ID NO:35) dissolved in EBM-2 that contained supplements and 0.5 mM IBXM. After incubation, the culture medium was aspirated, and the cells were assayed for intracellular cGMP production using the BIOTRACK cGMP enzyme immunoassay kit (Amersham Pharmacia Biotech). The amount of cGMP was calculated according the standard curve that was generated from parallel reactions within the same experiment. As indicated in Table 3, increasing concentrations of BNP3 resulted in increased production of cGMP. TABLE 3
    Concentration of BNP3 (M)
    0 10 -10 10 -9 10 -8
    cGMP (fmol/well) 0 1 18 26
  • Example 9 -Vasoactivity of BNP isoforms
  • Vasoactivity was assessed in an organ chamber using carotid arteries from New Zealand White Rabbits. Following euthanization, carotids were immediately immersed in cold Krebs solution. Arterial rings -4mm in length (n=6) were dissected, connected to isometric force displacement transducers, and suspended in organ chambers filled with 25 mL of Krebs (94% O2, 6% CO2). Rings were equilibrated for 1 hour at 37°C and then incrementally stretched to 3g. Viability and maximum contraction was determined with 60mM KC1. After 3 washes with Krebs solution and further equilibration, arteries were pre-contracted with phenylephrine in a titrated fashion to achieve ∼80% stable maximal contraction. To study vasoactivity, BNP3 (final conc 10-10 to 10-7 M) or vehicle was added to the organ bath in a cumulative manner. Following three further washes and equilibration, the arteries were re-contracted and viability was confirmed by assessment of endothelium independent responses with incremental doses of sodium nitroprusside (10-9 to 10-5 M), an exogenous NO donor.
  • Vasorelaxation to BNP3 began at 10-9M, with vessel responsivity increasing in a dose dependent manner such that ∼60% and ∼ 95% complete relaxation was seen at doses of 10-8M and 10-7M, respectively. No response was seen in control rings. These data demonstrate that BNP3 is vasoactive at concentrations similar to those reported for other natriuretic peptides. See Best et al., Cardiovas. Research 55:375-384 (2002).
  • Example 10 - Intrarenal infusion of BNP-3 in normal dogs
  • To determine the physiological effects of BNP-3, the synthesized peptide was delivered via a direct intrarenal arterial infusion (0.03 ng/kg/min) in normal dogs. Physiologic assessment was performed following a 15 minute run-in period. Infusion of BNP-3 at this dose resulted in elevation of plasma cGMP. This elevation of cGMP was associated with increased urinary flow (6-8 fold) and increased urinary excretion of sodium. Both of these increases normalized during a washout period.
  • OTHER EMBODIMENTS
  • It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
  • Disclosed is a purified polypeptide comprising an amino acid sequence selected from the group consisting of : a) the amino acid sequence of SEQ ID NO : 1,2, 3,4, 35, or 36 ; b) a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; c) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; and d) a sequence having at least 65% sequence identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least six contiguous residues in length.
  • Disclosed is also the above polypeptide, wherein said amino acid sequence has at least 75% sequence identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • Disclosed is also the above polypeptide, wherein said amino acid sequence has at least 75% sequence identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • Disclosed is also the above polypeptide, said amino acid sequence having at least 80% identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • Disclosed is also the above polypeptide, said amino acid sequence having at least 80% identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • Disclosed is also the above polypeptide, said amino acid sequence having at least 90% identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • Disclosed is also the above polypeptide, said amino acid sequence having at least 90% identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • Disclosed is also the above polypeptide, said amino acid sequence having at least 95% identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2.
  • Disclosed is also the above polypeptide, said amino acid sequence having at least 95% identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least 6 contiguous residues in length.
  • Disclosed is also the above polypeptide, wherein said polypeptide comprises the amino acid sequence of SEQ ID NO : 35 or SEQ ID NO : 36.
  • Disclosed is also an isolated nucleic acid encoding the above polypeptide, wherein said polypeptide is encoded by i) the nucleic acid sequence of SEQ ID NO : 5 ; ii) the nucleic acid sequence of nucleotides 383 to 489 of SEQ ID NO : 5 ; iii) the nucleic acid sequence of SEQ ID NO : 6; or iv) the nucleic acid sequence of nucleotides 388 to 432 of SEQ ID NO : 6.
  • Disclosed is also a vector comprising the above nucleic acid.
  • Disclosed are also host cells comprising the above vector, preferably wherein said host cells are eukaryotic host cells.
  • Disclosed is also a pharmaceutical composition comprising the above polypeptide and a pharmaceutically acceptable carrier.
  • Disclosed is an antibody having specific binding affinity for the above polypeptide.
  • Disclosed is a chimeric natriuretic polypeptide comprising a first region and a second region, said first region having an amino acid sequence selected from the group consisting of : a) the sequence of residues 1 to 27 of SEQ ID NO : 16; b) the sequence of residues 1 to 25 of SEQ ID NO : 17; c) the sequence of residues 1 to 23 of SEQ ID NO : 18; d) the sequence of residues 1 to 22 of SEQ ID NO : 19 ; and e) the sequence of a), b), c), or d) with one to five amino acid substitutions; said second region having an amino acid sequence selected from the group consisting of : f) the sequence of SEQ ID NO : 1 or SEQ ID NO : 2; g) a sequence having at least 6 contiguous residues of the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; h) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO : 1 or SEQ ID NO : 2; and i) a sequence having at least 65% sequence identity to a fragment of SEQ ID NO : 1 or SEQ ID NO : 2 at least six contiguous residues in length. Disclosed is a purified polypeptide comprising an amino acid sequence of the formula : Gly-Xaal-Xaa2-Xaa3-Xaa4-Xaas-Xaa6-Xaa7-Xaa8-Xaag-Xaalo-Xaa11-Xaa12-Xaai3-<BR> Xaa14-Xaa1s-Xaa16-Xaa17-Xaa18-Xaa19-Xaa2o-Xaa21-Xaa22-Xaa23-Xaa24-Xaa25- Xaa26-Xaa27-Xaa28-Gly-Xaa2g-Xaa3o-Xaa31-Xaa32 (SEQ ID NO : 20), wherein Xaal is Glu or Lys; Xaa2 is Pro, His, or Arg; Xaa3 is Pro or Leu; Xaa4 is Pro, Leu, or Ser; Xaas is Cys or Pro; Xaa6 is Pro, His, Gln, or Arg; Xaa7 is Arg, Phe, or Leu; Xaa8 is Asp, Gly, or absent; Xaag is Ser, Pro, or Leu; Xaa10 is Pro or absent; Xaa11 is Ser, Ala, or absent; Xaa12 is Pro or Ala; Xaa13 is Ala, Phe, Ile, or Leu; Xaa14 is Pro, Lys, or Leu; Xaa15 is Val, Leu, or Trp; Xaa16 is Cys, His, or Val; Xaa17 is Asp, Ala, Ile, Thr, Pro, or Arg; Xaaig is Thr, Pro, or His; Xaaig is Val, Ile, Pro, Val, Ser, or Leu; Xaa2o is Arg, Ser, Ile, or Glu; Xaa21 is Val, Ile, Ala, or Pro; Xaa22 is Thr, Val, or Leu; Xaa23 is Leu, Ser, or His; Xaa24 is Gly or Ala; Xaa25 is Phe, Ser, Thr, or Leu; Xaa26 is Val, Asp, or Leu; Xaa27 is Val, Leu, or Ser; Xaa28 is Ser, Arg, or Leu; Xaa29 is Asn, Asp, Pro, or Thr; Xaa30 is His, Gln, Asn, or Thr; Xaa31 is Thr, Ile, or Ser; and Xaa32 is Pro, Leu, or Glu.
  • Disclosed is a method for diagnosing a heart condition in a patient, said method comprising: a) providing a biological sample from said patient; b) detecting the presence, absence, or level of BNP2 or BNP3 in said biological sample; and c) classifying said patient as having said heart condition or not having said heart condition based, at least in part, on the presence of BNP-2 or BNP-3, the level of BNP2 or BNP3, or the absence of BNP2 or BNP3.
  • Disclosed is the above method, wherein said heart condition is heart failure.
  • Disclosed is the above method, wherein said heart condition is unstable angina.
  • Disclosed is the above method, wherein said heart condition is acute myocardial infarction.
  • Disclosed is the above method, wherein said heart condition is hypertension.
  • Disclosed is the above method, wherein the presence, absence, or level of BNP2 is detected.
  • Disclosed is the above method, wherein the presence, absence, or level of BNP3 is detected.
  • Disclosed is also a method for diagnosing a heart condition in a patient, said method comprising: a) providing a biological sample from said patient; b) detecting the presence, absence, or level of a ribonucleic acid encoding BNP2 or BNP3 in said biological sample; and c) classifying said patient as having said heart condition or not having said heart condition based, at least in part, on the presence of said ribonucleic acid encoding BNP2 or BNP3, the level of said ribonucleic acid encoding BNP2 or BNP3, or the absence of said ribonucleic acid encoding BNP2 or BNP3. Disclosed is also said method, wherein said heart condition is heart failure, unstable angina, acute myocardial infarction or hypertension.
  • Disclosed is also a purified antibody, wherein said antibody binds to a BNP2 polypeptide, and wherein said antibody does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO : 16 or to a BNP3 polypeptide consisting of the sequence set forth in SEQ ID NO : 4. Disclosed is also said antibody, wherein said BNP2 polypeptide comprises the sequence set forth in SEQ ID NO: 1. Disclosed is also said antibody, wherein said antibody is a monoclonal antibody.
  • Disclosed is also a purified antibody, wherein said antibody binds to a BNP3 polypeptide, and wherein said antibody does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO : 16 or to a BNP2 polypeptide consisting of the sequence set forth in SEQ ID NO : 3.Disclosed is also said antibody, wherein said BNP3 polypeptide comprises the sequence set forth in SEQ ID NO : 2. Disclosed is also said antibody, wherein said antibody is a monoclonal antibody.
    Figure imgb0001
    Figure imgb0002
    Figure imgb0003
    Figure imgb0004
    Figure imgb0005
    Figure imgb0006
    Figure imgb0007
    Figure imgb0008
    Figure imgb0009
    Figure imgb0010
    Figure imgb0011

Claims (15)

  1. A purified BNP2 polypeptide selected from the group consisting of:
    a) a polypeptide comprising the amino acid sequence of SEQ ID NO:3, SEQ ID NO:36, or SEQ ID NO:1; and
    b) a polypeptide comprising an amino acid sequence with at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1.
  2. The purified BNP2 polypeptide of claim 1, wherein said polypeptide has an amino acid sequence with at least 75%, at least 80%, at least 90%, or at least 95% sequence identity to the amino acid sequence of SEQ ID NO:1.
  3. The purified BNP2 polypeptide of claim 1, wherein said polypeptide consists of the amino acid sequence of SEQ ID NO:36.
  4. A pharmaceutical composition comprising the purified BNP2 polypeptide of any one of claims 1 to 3 and a pharmaceutically acceptable carrier.
  5. An antibody having specific binding affinity for the polypeptide of claim 1.
  6. A chimeric natriuretic polypeptide comprising a first region and a second region, said first region having an amino acid sequence selected from the group consisting of:
    a) the sequence of residues 1 to 27 of SEQ ID NO:16;
    b) the sequence of residues 1 to 25 of SEQ ID NO:17;
    c) the sequence of residues 1 to 23 of SEQ ID NO:18;
    d) the sequence of residues 1 to 22 of SEQ ID NO:19; and
    e) the sequence of a), b), c), or d) with one to five amino acid substitutions;
    said second region having an amino acid sequence selected from the group consisting of:
    f) the sequence of SEQ ID NO:1; and
    g) a sequence having at least 65% sequence identity to the amino acid sequence of SEQ ID NO:1.
  7. An ex vivo method for diagnosing a heart condition in a patient, said method comprising:
    a) detecting the presence, absence, or level of the BNP2 polypeptide of any one of claims 1 to 3 in a biological sample from said patient; and
    b) classifying said patient as having said heart condition or not having said heart condition based, at least in part, on the presence of said BNP2 polypeptide, the level of said BNP2 polypeptide, or the absence of said BNP2 polypeptide.
  8. The method of claim 7, wherein said heart condition is selected from the group consisting of heart failure, unstable angina, acute myocardial infarction, and hypertension.
  9. An ex vivo method for diagnosing a heart condition in a patient, said method comprising:
    a) detecting the presence, absence, or level of a ribonucleic acid encoding the BNP2 polypeptide of any one of claims 1 to 3 in a biological sample from said patient; and
    b) classifying said patient as having said heart condition or not having said heart condition based, at least in part, on the presence of said ribonucleic acid encoding BNP2, the level of said ribonucleic acid encoding BNP2, or the absence of said ribonucleic acid encoding BNP2.
  10. The method of claim 9, wherein said heart condition is selected from the group consisting of heart failure, unstable angina, acute myocardial infarction, and hypertension.
  11. Use of a polypeptide of any one of claims 1 to 3 for the preparation of a medicament for treating a heart condition in a mammal.
  12. The use of claim 11, wherein said heart condition is selected from the group consisting of heart failure, unstable angina, acute myocardial infarction, and hypertension.
  13. A purified antibody, wherein said antibody binds to a BNP2 polypeptide, and wherein said antibody does not bind to a BNP polypeptide consisting of the sequence set forth in SEQ ID NO:16 or to a BNP3 polypeptide consisting of the sequence set forth in SEQ ID NO:4.
  14. The antibody of claim 13, wherein said BNP2 polypeptide comprises the sequence set forth in SEQ ID NO:1.
  15. The antibody of claim 13, wherein said antibody is a monoclonal antibody.
EP10187879.1A 2003-06-20 2004-06-02 Isoforms of brain natriuretic peptide Expired - Lifetime EP2308889B1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US48046003P 2003-06-20 2003-06-20
EP04754213A EP1638443B1 (en) 2003-06-20 2004-06-02 Isoforms of brain natriuretic peptide

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
EP04754213A Division EP1638443B1 (en) 2003-06-20 2004-06-02 Isoforms of brain natriuretic peptide
EP04754213.9 Division 2004-06-02

Publications (2)

Publication Number Publication Date
EP2308889A1 true EP2308889A1 (en) 2011-04-13
EP2308889B1 EP2308889B1 (en) 2018-05-23

Family

ID=33551922

Family Applications (2)

Application Number Title Priority Date Filing Date
EP10187879.1A Expired - Lifetime EP2308889B1 (en) 2003-06-20 2004-06-02 Isoforms of brain natriuretic peptide
EP04754213A Expired - Lifetime EP1638443B1 (en) 2003-06-20 2004-06-02 Isoforms of brain natriuretic peptide

Family Applications After (1)

Application Number Title Priority Date Filing Date
EP04754213A Expired - Lifetime EP1638443B1 (en) 2003-06-20 2004-06-02 Isoforms of brain natriuretic peptide

Country Status (12)

Country Link
US (2) US8354496B2 (en)
EP (2) EP2308889B1 (en)
JP (1) JP4881156B2 (en)
CN (1) CN101208353B (en)
AT (1) ATE485303T1 (en)
DE (1) DE602004029680D1 (en)
DK (1) DK1638443T3 (en)
ES (1) ES2354881T3 (en)
IL (1) IL172674A (en)
PL (1) PL1638443T3 (en)
PT (1) PT1638443E (en)
WO (1) WO2005000095A2 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9358270B2 (en) 2009-08-27 2016-06-07 Igisu Co., Ltd. Method of treating rhinitis with B-type and C-type natriuretic peptides
US9358269B2 (en) 2009-07-23 2016-06-07 Igisu Co., Ltd Method for treating dermatitis and improving skin texture using natriuretic peptides
US9480728B2 (en) 2011-01-21 2016-11-01 Igisu Co., Ltd. Agent for the treatment of alopecia

Families Citing this family (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005000095A2 (en) 2003-06-20 2005-01-06 Mayo Foundation For Medical Education And Research Isoforms of brain natriuretic peptide
GB0329288D0 (en) 2003-12-18 2004-01-21 Inverness Medical Switzerland Monitoring method and apparatus
WO2005060652A2 (en) * 2003-12-18 2005-07-07 Inverness Medical Switzerland Gmbh Monitoring method and apparatus
CA2559228C (en) 2004-04-21 2016-06-21 Enobia Pharma Inc. Bone delivery conjugates and method of using same to target proteins to bone
US20070042957A1 (en) * 2005-08-19 2007-02-22 Mayo Foundation For Medical Education And Research Type v phosphodiesterase inhibitors and natriuretic polypeptides
KR100702415B1 (en) * 2006-03-03 2007-04-09 안웅식 Human Papillomavirus Detection Kit and Method Using Oligonucleotide Probe Bead Array
KR100736442B1 (en) * 2006-03-10 2007-07-09 주식회사 나노텍세라믹스 Latex-bound low arsenic silica composition and method for preparing same
CN101501067B (en) * 2006-08-08 2013-01-16 梅约医学教育与研究基金会 Diuretic and natriuretic polypeptides
US8283318B2 (en) 2006-09-08 2012-10-09 Mayo Foundation For Medical Education And Research Aquaretic and natriuretic polypeptides lacking vasodilatory activity
WO2009036448A2 (en) * 2007-09-15 2009-03-19 Mayo Foundation For Medical Education And Research Natriuretic peptide receptor-c agonists
JP2012502290A (en) * 2008-09-11 2012-01-26 エフ.ホフマン−ラ ロシュ アーゲー Natriuretic peptides and adiponectin in patients with metabolic syndrome
WO2012088608A1 (en) 2010-12-27 2012-07-05 Enobia Canada Limited Partnership Compositions comprising natriuretic peptides and methods of use thereof
CN102174636B (en) * 2011-01-11 2013-10-30 中国食品药品检定研究院 Application of GCA stable transfection cell line to test BNP (Brain Natriuretic Peptide) activity
CN103906761B (en) 2011-08-30 2016-12-21 梅约医学教育与研究基金会 natriuretic peptide
WO2013070741A1 (en) * 2011-11-11 2013-05-16 Mayo Foundation For Medical Education And Research Methods and materials for regulating natriuretic polypeptide function
WO2013103896A1 (en) 2012-01-06 2013-07-11 Mayo Foundation For Medical Education And Research Treating cardiovascular or renal diseases
US10052366B2 (en) 2012-05-21 2018-08-21 Alexion Pharmaceuticsl, Inc. Compositions comprising alkaline phosphatase and/or natriuretic peptide and methods of use thereof
EP3025263A2 (en) * 2013-07-26 2016-06-01 Koninklijke Philips N.V. Computerization and visualization of clinical rules and definitions for patient monitoring systems.
WO2016007873A1 (en) 2014-07-11 2016-01-14 The Regents Of The University Of Michigan Compositions and methods for treating craniosynostosis
MX389350B (en) 2014-12-05 2025-03-19 Alexion Pharma Inc RECOMBINANT ALKALINE PHOSPHATASES AND THEIR USES FOR THE TREATMENT OF SEIZURES.
JP6868561B2 (en) 2015-01-28 2021-05-12 アレクシオン ファーマシューティカルズ, インコーポレイテッド How to treat subjects with alkaline phosphatase deficiency
CN108350440A (en) 2015-08-17 2018-07-31 阿雷克森制药公司 Manufacture of Alkaline Phosphates
JP6868617B2 (en) 2015-09-28 2021-05-12 アレクシオン ファーマシューティカルズ, インコーポレイテッド Identifying effective dosing regimens for tissue-nonspecific alkaline phosphatase (TNSALP) enzyme replacement therapy for hypophosphataseemia
JP2018533571A (en) 2015-10-30 2018-11-15 アレクシオン ファーマシューティカルズ, インコーポレイテッド Methods for treating cranial suture early healing disease in a patient
WO2017155569A1 (en) 2016-03-08 2017-09-14 Alexion Pharmaceuticals, Inc. Methods for treating hypophosphatasia in children
US10898549B2 (en) 2016-04-01 2021-01-26 Alexion Pharmaceuticals, Inc. Methods for treating hypophosphatasia in adolescents and adults
JP7613826B2 (en) 2016-04-01 2025-01-15 アレクシオン ファーマシューティカルズ, インコーポレイテッド Treating muscle weakness with alkaline phosphatase
US10988744B2 (en) 2016-06-06 2021-04-27 Alexion Pharmaceuticals, Inc. Method of producing alkaline phosphatase
EP3500289B1 (en) 2016-08-18 2024-10-09 Alexion Pharmaceuticals, Inc. Asfotase alfa for use in treating tracheobronchomalacia
EP3600383A4 (en) 2017-03-31 2020-10-28 Alexion Pharmaceuticals, Inc. METHODS FOR TREATMENT OF HYPOPHOSPHATASIA (HPP) IN ADULTS AND ADOLESCENTS
US11913039B2 (en) 2018-03-30 2024-02-27 Alexion Pharmaceuticals, Inc. Method for producing recombinant alkaline phosphatase
US12268733B2 (en) 2018-08-10 2025-04-08 Alexion Pharmaceuticals, Inc. Methods of treating neurofibromatosis type 1 and related conditions with alkaline phosphatase
CN119264211A (en) 2018-08-27 2025-01-07 瑞泽恩制药公司 Application of Raman spectroscopy in downstream purification
CA3161266A1 (en) 2019-12-09 2021-06-17 Alexion Pharmaceuticals, Inc. Alkaline phosphatase polypeptides and methods of use thereof
AU2021337652B2 (en) 2020-09-04 2025-01-30 Alexion Pharmaceuticals, Inc. Methods for treating bone mineralization disorders
BR112023016048A2 (en) 2021-02-12 2023-11-14 Alexion Pharma Inc ALKALINE PHOSPHATASE POLYPEPTIDES AND METHODS OF USE THEREOF
WO2024094747A1 (en) 2022-11-02 2024-05-10 Novo Nordisk A/S Cnp compounds

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4233402A (en) 1978-04-05 1980-11-11 Syva Company Reagents and method employing channeling
WO1984003285A1 (en) 1983-02-22 1984-08-30 Molecular Biosystems Inc Defined sequence single strand oligonucleotides incorporating reporter groups, process for the chemical synthesis thereof, and nucleosides useful in such synthesis
US4996143A (en) 1985-12-23 1991-02-26 Syngene, Inc. Fluorescent stokes shift probes for polynucleotide hybridization
US5296347A (en) 1991-02-08 1994-03-22 Ciba Corning Diagnostics Corp. Bridge immunoassay
US5565322A (en) 1991-11-07 1996-10-15 Nanogen, Inc. Hybridization of polynucleotides conjugated with chromophores and fluorophores to generate donor-to donor energy transfer system
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
WO2000071576A2 (en) * 1999-05-24 2000-11-30 Mayo Foundation For Medical Education And Research Adenovirus vectors encoding brain natriuretic peptide

Family Cites Families (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4506671A (en) 1983-03-30 1985-03-26 United States Surgical Corporation Apparatus for applying two-part surgical fasteners
US4496544A (en) 1983-11-10 1985-01-29 Washington University Atrial Peptides
US5212286A (en) 1984-04-19 1993-05-18 Scios Nova Inc. Atrial natriuretic/vasodilator peptide compounds
CA1339210C (en) * 1988-05-31 1997-08-05 John Lewicki Recombinant techniques for production of novel natriuretic and vasodilator peptides
US5114923A (en) 1988-05-31 1992-05-19 California Biotechnology Inc. Recombinant techniques for production of novel natriuretic and vasodilator peptides
JP2809533B2 (en) * 1991-01-31 1998-10-08 壽之 松尾 CNP analog peptide
WO1994020534A1 (en) * 1993-03-03 1994-09-15 Mayo Foundation For Medical Education And Research Vasonatrin peptide and analogs thereof
US5665704A (en) * 1993-11-12 1997-09-09 Genentech, Inc. Receptor specific atrial natriuretic peptides
US5846932A (en) 1993-11-12 1998-12-08 Genentech, Inc. Receptor specific atrial natriuretic peptides
AU2159895A (en) * 1994-03-11 1995-09-25 Ariad Pharmaceuticals, Inc. Methods and materials for identifying inhibitors of molecular interactions mediated by sh3 domains
DE69733560T2 (en) 1996-03-04 2006-05-11 Scios Inc., Fremont TEST PROCEDURE AND REAGENTS FOR QUANTIFYING hBNP
ES2256952T3 (en) * 1997-09-11 2006-07-16 SHIONOGI &amp; CO., LTD. IMMUNOANALYSIS FOR BNP.
US6551795B1 (en) 1998-02-18 2003-04-22 Genome Therapeutics Corporation Nucleic acid and amino acid sequences relating to pseudomonas aeruginosa for diagnostics and therapeutics
US6887481B1 (en) * 1998-12-16 2005-05-03 Agency For Science, Technology And Research Bacterial-derived molecules and therapeutic and diagnostic uses therefor
US6887470B1 (en) 1999-09-10 2005-05-03 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6849714B1 (en) 1999-05-17 2005-02-01 Conjuchem, Inc. Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
US6407211B1 (en) 1999-12-17 2002-06-18 Mayo Foundation For Medical Education And Research Chimeric natriuretic peptides
US20110131679A2 (en) * 2000-04-19 2011-06-02 Thomas La Rosa Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement
US6812339B1 (en) * 2000-09-08 2004-11-02 Applera Corporation Polymorphisms in known genes associated with human disease, methods of detection and uses thereof
WO2002024895A2 (en) 2000-09-22 2002-03-28 Incyte Genomics, Inc. Transcription factors and zinc finger proteins
US7214786B2 (en) * 2000-12-14 2007-05-08 Kovalic David K Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement
WO2005000095A2 (en) 2003-06-20 2005-01-06 Mayo Foundation For Medical Education And Research Isoforms of brain natriuretic peptide
CA2554599A1 (en) 2004-01-27 2005-08-11 Compugen Usa, Inc. Novel brain natriuretic peptide variants and methods of use thereof
US7332569B2 (en) 2004-01-27 2008-02-19 Compugen Ltd. Brain natriuretic peptide spliced variant
CN101501067B (en) 2006-08-08 2013-01-16 梅约医学教育与研究基金会 Diuretic and natriuretic polypeptides
WO2009036448A2 (en) 2007-09-15 2009-03-19 Mayo Foundation For Medical Education And Research Natriuretic peptide receptor-c agonists

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4034074A (en) 1974-09-19 1977-07-05 The Board Of Trustees Of Leland Stanford Junior University Universal reagent 2-site immunoradiometric assay using labelled anti (IgG)
US4098876A (en) 1976-10-26 1978-07-04 Corning Glass Works Reverse sandwich immunoassay
US4233402A (en) 1978-04-05 1980-11-11 Syva Company Reagents and method employing channeling
WO1984003285A1 (en) 1983-02-22 1984-08-30 Molecular Biosystems Inc Defined sequence single strand oligonucleotides incorporating reporter groups, process for the chemical synthesis thereof, and nucleosides useful in such synthesis
US4996143A (en) 1985-12-23 1991-02-26 Syngene, Inc. Fluorescent stokes shift probes for polynucleotide hybridization
US5580859A (en) 1989-03-21 1996-12-03 Vical Incorporated Delivery of exogenous DNA sequences in a mammal
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5296347A (en) 1991-02-08 1994-03-22 Ciba Corning Diagnostics Corp. Bridge immunoassay
US5565322A (en) 1991-11-07 1996-10-15 Nanogen, Inc. Hybridization of polynucleotides conjugated with chromophores and fluorophores to generate donor-to donor energy transfer system
US5849489A (en) 1991-11-07 1998-12-15 Nanogen, Inc. Hybridization of polynucleotides conjugated with chromophores and fluorophores to generate donor-to-donor energy transfer system
US6162603A (en) 1991-11-07 2000-12-19 Nanogen, Inc. Hybridization of polynucleotides conjugated with chromophores and fluorophores to generate donor-to-donor energy transfer system
WO2000071576A2 (en) * 1999-05-24 2000-11-30 Mayo Foundation For Medical Education And Research Adenovirus vectors encoding brain natriuretic peptide

Non-Patent Citations (17)

* Cited by examiner, † Cited by third party
Title
"PCR Primer: A Laboratory Manual", 1995, COLD SPRING HARBOR LABORATORY PRESS
"Short Protocols in Molecular Biologv", 1992, GREEN PUBLISHING ASSOCIATES AND JOHN WILEY & SONS
"Short Protocols in Molecular Biology", 1992, GREEN PUBLISHING ASSOCIATES AND JOHN WILEY & SONS
BEST ET AL., CARDIOVAS. RESEARCH, vol. 55, 2002, pages 375 - 384
BURGER; BURGER, CURR. OPIN. INVESTIG. DRUGS, vol. 2, no. 7, 2001, pages 929 - 35
COLE ET AL., PROC. NATL. ACAD. SCI USA, vol. 80, 1983, pages 2026
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1983, ALAN R. LISS, INC., pages: 77 - 96
GUATELLI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 1874 - 1878
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275
HYRUP ET AL., BIOORGAN. MED. CHEM., vol. 4, 1996, pages 5 - 23
KOHLER, G. ET AL., NATURE, vol. 256, 1975, pages 495
KOSBOR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72
LEWIS GENETIC ENGINEERING NEWS, vol. 12, no. 9, 1992
OGAWA Y ET AL: "Molecular cloning of the complementary DNA and gene that encode mouse brain natriuretic peptide and generation of transgenic mice that overexpress the brain natriuretic peptide gene.", May 1994, THE JOURNAL OF CLINICAL INVESTIGATION MAY 1994, VOL. 93, NR. 5, PAGE(S) 1911 - 1921, ISSN: 0021-9738, XP002492225 *
SUMMERTON; WELLER, ANTISENSE NUCLEIC ACID DRUG DEV., vol. 7, 1997, pages 187 - 195
VALLI N ET AL: "Review of 10 years of the clinical use of brain natriuretic peptide in cardiology.", November 1999, THE JOURNAL OF LABORATORY AND CLINICAL MEDICINE NOV 1999, VOL. 134, NR. 5, PAGE(S) 437 - 444, ISSN: 0022-2143, XP002492226 *
WEISS, SCIENCE, vol. 254, 1991, pages 1292

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9358269B2 (en) 2009-07-23 2016-06-07 Igisu Co., Ltd Method for treating dermatitis and improving skin texture using natriuretic peptides
US9968654B2 (en) 2009-07-23 2018-05-15 Igisu Co., Ltd. Method of treatment dermatitis with c-type natriuretic peptide derivatives
US10946072B2 (en) 2009-07-23 2021-03-16 Igisu Co., Ltd. Method for treating dermatitis and improving skin texture using B-type natriuretic peptides
US9358270B2 (en) 2009-08-27 2016-06-07 Igisu Co., Ltd. Method of treating rhinitis with B-type and C-type natriuretic peptides
US9962429B2 (en) 2009-08-27 2018-05-08 Igisu Co., Ltd. Method for treating rhinitis with B and C-type natriuretic peptide containing chimeric ring structures
US11452762B2 (en) 2009-08-27 2022-09-27 Igisu Co., Ltd. Method of treating rhinitis with C-type natriuretic peptides
US9480728B2 (en) 2011-01-21 2016-11-01 Igisu Co., Ltd. Agent for the treatment of alopecia
US9808511B2 (en) 2011-01-21 2017-11-07 Igisu Co., Ltd. Method for treating alopecia with B-type natriuretic peptide
US11571464B2 (en) 2011-01-21 2023-02-07 Igisu Co., Ltd. C-type natriuretic peptide agent for the treatment of alopecia

Also Published As

Publication number Publication date
IL172674A (en) 2011-08-31
JP4881156B2 (en) 2012-02-22
US8354496B2 (en) 2013-01-15
WO2005000095A2 (en) 2005-01-06
ES2354881T3 (en) 2011-03-18
US8912137B2 (en) 2014-12-16
CN101208353B (en) 2011-12-14
EP1638443A2 (en) 2006-03-29
EP1638443A4 (en) 2008-10-08
DK1638443T3 (en) 2011-02-07
JP2007525957A (en) 2007-09-13
CN101208353A (en) 2008-06-25
PL1638443T3 (en) 2011-04-29
US20070281887A1 (en) 2007-12-06
IL172674A0 (en) 2006-04-10
EP2308889B1 (en) 2018-05-23
EP1638443B1 (en) 2010-10-20
PT1638443E (en) 2011-01-25
WO2005000095A3 (en) 2008-01-24
ATE485303T1 (en) 2010-11-15
US20130143816A1 (en) 2013-06-06
DE602004029680D1 (en) 2010-12-02

Similar Documents

Publication Publication Date Title
EP2308889B1 (en) Isoforms of brain natriuretic peptide
US9102757B2 (en) Chimeric aquaretic and natriuretic polypeptides lacking vasodilatory activity
EP2054433B1 (en) Diuretic and natriuretic polypeptides
AU2008279379B2 (en) Natriuretic polypeptides
EP2307447B1 (en) Natriuretic polypeptides with unique pharmacologic profiles
WO2010048308A2 (en) Natriuretic polypeptides
HK1135136B (en) Natriuretic polypeptides

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

AC Divisional application: reference to earlier application

Ref document number: 1638443

Country of ref document: EP

Kind code of ref document: P

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR

17P Request for examination filed

Effective date: 20111012

17Q First examination report despatched

Effective date: 20131127

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: GRANT OF PATENT IS INTENDED

INTG Intention to grant announced

Effective date: 20171218

GRAS Grant fee paid

Free format text: ORIGINAL CODE: EPIDOSNIGR3

GRAA (expected) grant

Free format text: ORIGINAL CODE: 0009210

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE PATENT HAS BEEN GRANTED

AC Divisional application: reference to earlier application

Ref document number: 1638443

Country of ref document: EP

Kind code of ref document: P

AK Designated contracting states

Kind code of ref document: B1

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR

REG Reference to a national code

Ref country code: GB

Ref legal event code: FG4D

REG Reference to a national code

Ref country code: CH

Ref legal event code: EP

REG Reference to a national code

Ref country code: IE

Ref legal event code: FG4D

REG Reference to a national code

Ref country code: AT

Ref legal event code: REF

Ref document number: 1001422

Country of ref document: AT

Kind code of ref document: T

Effective date: 20180615

REG Reference to a national code

Ref country code: DE

Ref legal event code: R096

Ref document number: 602004052750

Country of ref document: DE

REG Reference to a national code

Ref country code: NL

Ref legal event code: MP

Effective date: 20180523

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: ES

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: SE

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: FI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: BG

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180823

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: NL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: GR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180824

REG Reference to a national code

Ref country code: AT

Ref legal event code: MK05

Ref document number: 1001422

Country of ref document: AT

Kind code of ref document: T

Effective date: 20180523

REG Reference to a national code

Ref country code: DE

Ref legal event code: R119

Ref document number: 602004052750

Country of ref document: DE

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: RO

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: EE

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: DK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: AT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: CZ

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: PL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

REG Reference to a national code

Ref country code: CH

Ref legal event code: PL

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: IT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

REG Reference to a national code

Ref country code: BE

Ref legal event code: MM

Effective date: 20180630

REG Reference to a national code

Ref country code: IE

Ref legal event code: MM4A

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LU

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180602

Ref country code: MC

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

PLBE No opposition filed within time limit

Free format text: ORIGINAL CODE: 0009261

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT

GBPC Gb: european patent ceased through non-payment of renewal fee

Effective date: 20180823

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: DE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20190101

Ref country code: FR

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180630

Ref country code: LI

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180630

Ref country code: CH

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180630

Ref country code: IE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180602

26N No opposition filed

Effective date: 20190226

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: BE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180630

Ref country code: SI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: GB

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20180823

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: TR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: PT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523

Ref country code: HU

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT; INVALID AB INITIO

Effective date: 20040602

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: CY

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20180523