EP1969006A2 - Detection of human platelet antigen (hpa) antibodies - Google Patents

Detection of human platelet antigen (hpa) antibodies

Info

Publication number
EP1969006A2
EP1969006A2 EP06808552A EP06808552A EP1969006A2 EP 1969006 A2 EP1969006 A2 EP 1969006A2 EP 06808552 A EP06808552 A EP 06808552A EP 06808552 A EP06808552 A EP 06808552A EP 1969006 A2 EP1969006 A2 EP 1969006A2
Authority
EP
European Patent Office
Prior art keywords
hpa
gpiiia
polypeptide
antibody
antibodies
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP06808552A
Other languages
German (de)
French (fr)
Inventor
Prachi Stafford
Nicholas Watkins
Willem Ouwehand
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cambridge Enterprise Ltd
Original Assignee
Cambridge Enterprise Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GB0523266A external-priority patent/GB0523266D0/en
Priority claimed from GB0611806A external-priority patent/GB0611806D0/en
Application filed by Cambridge Enterprise Ltd filed Critical Cambridge Enterprise Ltd
Publication of EP1969006A2 publication Critical patent/EP1969006A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70546Integrin superfamily
    • C07K14/70557Integrin beta3-subunit-containing molecules, e.g. CD41, CD51, CD61
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/22Haematology
    • G01N2800/222Platelet disorders
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/22Haematology
    • G01N2800/226Thrombotic disorders, i.e. thrombo-embolism irrespective of location/organ involved, e.g. renal vein thrombosis, venous thrombosis

Definitions

  • HPA Human Platelet Antigen
  • This invention relates to the detection of Human Platelet Antigen (HPA) antibodies, in particular human alloantibodies reactive with integrin GPIIIa.
  • HPA Human Platelet Antigen
  • Such detection may be useful, for example, in the diagnosis and therapy of HPA antibody disorders such as Neonatal Alloimmune Immune Thrombocytpenia (NAIT) , Post Transfusion Purpura (PTP) and Platelet Refractoriness (PR) .
  • HPA antibody disorders such as Neonatal Alloimmune Immune Thrombocytpenia (NAIT) , Post Transfusion Purpura (PTP) and Platelet Refractoriness (PR) .
  • NAIT Neonatal Alloimmune Immune Thrombocytpenia
  • PTP Post Transfusion Purpura
  • PR Platelet Refractoriness
  • HPA-Ia (previously known as ZwVPl*) 1 on platelet glycoprotein GPIIIa (CD61, ⁇ 3) is the clinically most important HPA antigen.
  • the HPA-I system is the clinically most relevant HPA system. Alloantibody formation is generally against HPA-Ia.
  • HPA-Ib antibodies are rare and are mainly observed in polytransfused patients and occasionally observed in pregnancy. Approximately 2-2.5% of Caucasoids are HPA-lblb. In pregnancy HPA- lblb women (HPA-Ia negative) are at high risk (with a 1 in 3 chance) of forming HPA-Ia antibodies if HLA DRB3*0101 positive. HPA-Ia antibody formation in HLA DRB3*0101 negative pregnant women is very rare (odds ratio of -150 when compared with HLA DRB3*0101 postive women) .
  • ICH occurs during or after delivery but may also occur in utero as early as 20- 24 weeks of gestation 7 ' 8 .
  • the availability of a simple diagnostic test which could differentiate with good sensitivity and reasonable specificity between HPA-Ia antibodies which cause severe bleeding and possible ICH and the less harmful HPA-Ia antibodies would be of great clinical value.
  • HPA antibodies Detection of HPA antibodies is based on solid phase based antigen- capture assays like the Monoclonal Antibody Immobilisation of
  • MAIPA Platelet Antigens
  • PSIFT Platelet Suspension Immunofluorescence Test
  • commercial ELISA kits in which the wells of the ELISA plates are coated with platelet membrane glycoprotein complexes obtained from human HPA typed platelets (e.g. GTI-Pakl2, GTI,
  • the MAIPA is cumbersome and time-consuming and requires panels of HPA genotyped donor platelets .
  • the PSIFT is laborious and not specific (HLA antibodies also produce positive results) .
  • GTI-Pak has a slightly lower sensitivity than either MAIPA or PSIFT.
  • Several groups have been attempting to develop recombinant or synthetic molecular probes that can be used for the sensitive and specific detection of HPA antibodies in general and HPA-I antibodies in particular. The latter studies have been hampered by the complexity of the integrin structure in general and of the HPA-I epitopes in particular. Many studies have tried to elucidate the exact nature of the HPA-I epitopes and the precise structural configuration of the HPA-I antibody binding sites, but success has been limited so far.
  • HPA-I antibodies bind to a GPIIIa fragment consisting of the amino-terminal 66 amino acids, when recombinantIy expressed in Escherichia coli (Bowditch et al Blood. 1992 Feb 1;79 (3) : 559-62) , but this fragment is not adequate for HPA-I antibody detection as many examples of clinically relevant HPA-Ia antibodies do not bind.
  • GPIIIa has been expressed as a soluble monomer by deleting the specificity-determining loop 16 , there is no indication that the HPA-I epitope is conserved in such monomers.
  • the present inventors have recognised that recombinant GPIIIa molecules that lack the ligand binding ⁇ A domain bind to HPA-I antibodies in monomeric form and can be recombinantly expressed at high levels.
  • One aspect of the invention provides a GPIIIa polypeptide comprising an amino acid sequence which has at least 80% sequence identity or sequence similarity with the sequence of SEQ ID NO: 1 from residue 1 to at least residue 54.
  • the GPIIIa polypeptide comprises an amino acid sequence which has at least 80% sequence identity or sequence similarity with the sequence of SEQ ID NO: 1 from residue 1 to at least residue 104, at least residue 192, at least residue 289, at least residue 322, at least residue 365, or residue 450.
  • the GPIIIa polypeptide comprises an amino acid sequence which shares greater than 85%, greater than 90%, greater than 95% or greater than 98% sequence identity or sequence similarity with such a sequence .
  • the polypeptide may have a sequence with one or more of addition, insertion, deletion or substitution of one or more amino acids from the corresponding sequence in SEQ ID NO: 1. For example, up to about 5, 10, 15, 20, 30 or 40 amino acids may be altered. Such alterations may be caused by one or more of addition, insertion, deletion or substitution of one or more nucleotides in the encoding nucleic acid.
  • GAP Garnier GCG package, Accelerys Inc, San Diego USA
  • Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. MoI. Biol. 215: 405-410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Waterman (1981) J. MoI Biol.
  • Similarity allows for "conservative variation”, i.e. substitution of one hydrophobic residue such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as arginine for lysine, glutamic for aspartic acid, or glutamine for asparagine. Similarity matrices such as the PAM 250 or Blosum 45 are commonly used in the art to determine similarity and conservative variation.
  • the GPIIIa polypeptide may comprise the amino acid sequence of SEQ ID NO: 1 from residue 1 to at least residue 54, at least residue 108, at least residue 192, at least residue 289, at least residue 322, at least residue 365 or residue 450
  • the GPIIIa polypeptide may comprise residues 1 to 54 of SEQ ID NO: 1, residues 1 to 108 of SEQ ID NO: 1, residues 1 to 192 of SEQ ID NO: 1, residues 1 to 289 of SEQ ID NO: 1, residues 1 to 322 of SEQ ID NO: 1, residues 1 to 365 of SEQ ID NO: 1 or most preferably, the entire sequence of SEQ ID NO: 1 (residues 1 to 450).
  • a GPIIIa polypeptide as described herein binds HPA-I antibodies.
  • HPA-I antibodies bind to a conformational epitope of GPIIIa which comprises the PSI domain.
  • HPA-I antibodies may be specific for the allele of GPIIIa which has leucine (L) at position 33 in the mature GPIIIa sequence (HPA-Ia) or the allele of GPIIIa which has proline (P) at position 33 (HPA-Ib) .
  • the amino acid sequence of GPIIIa has the database entry P05106 (P5106.1 GI: 124968) .
  • a GPIIIa polypeptide as described herein may have a leucine (L) at residue 33 and may bind preferentially to HPA-Ia antibodies relative to HPA-Ib antibodies.
  • L leucine
  • such a GPIIIa polypeptide binds specifically to HPA-Ia antibodies i.e. it binds to HPA-Ia antibodies but shows no binding or substantially no binding to HPA-Ib antibodies .
  • the GPIIIa polypeptide may have a proline (P) at residue 33 and may bind preferentially to HPA-Ib antibodies relative to HPA-Ia antibodies.
  • the GPIIIa polypeptide specifically binds to HPA-Ib antibodies i.e. it binds to HPA-Ib antibodies but shows no binding or substantially no binding to HPA- Ia antibodies.
  • a GPIIIa polypeptide as described herein may also bind other HPA antibodies.
  • a GPIIIa polypeptide in which Arginine 62 is replaced by Glutamine may be used to bind HPA-lObw antibodies
  • a GPIIIa polypeptide in which Proline 166 of SEQ ID NO: 1 (P407 of wild-type GPIIIa) is replaced by Alanine may be used to bind HPA-7bw antibodies
  • a GPIIIa polypeptide in which Arginine 248 of SEQ ID N0:l (R489 of wild-type GPIIIa) is replaced by Glutamine may be used to detect for HPA-6bw antibodies
  • a GPIIIa polypeptide in which Arginine 392 of SEQ ID NO: 1 (R633 of wild-type GPIIIa) is replaced by histidine may be used to detect HPA-llbw antibodies
  • a GPIIIa polypeptide may comprise two or more substitutions or deletions as set out above in order to bind to more than one type of HPA antibody.
  • one or more heterologous amino acids may be joined or fused to a polypeptide set out herein and a polypeptide may comprise a polypeptide sequence as described above linked or fused to one or more heterologous amino acids .
  • One or more heterologous amino acids may include non-GPIIIa amino acid sequences .
  • a GPIIIa polypeptide may comprise a tag, which may, for example, be an affinity tag which is useful for purification.
  • An affinity tag is a heterologous polypeptide sequence which forms one member of a specific binding pair.
  • the tag sequence may form an epitope which is bound by an antibody molecule.
  • Polypeptides comprising the tag may be purified though binding to the other member of the specific binding pair, which may be immobilised, for example on an affinity column.
  • Suitable affinity tags include for example, glutathione-S- transferase, (GST) , calmodulin, maltose binding domain (MBD) , MRGS(H) 6 , DYKDDDDK (FLAGTM), T7-, S- (KETAAAKFERQHMDS) , poly-Arg (R 5 . e) , poly-His (H 2-10 ), poly-Cys (C 4 ) poly-Phe (F 11 ) poly-Asp (D 5-16 ) , Strept-tag II (WSHPQFEK) , c-myc (EQKLISEEDL) , Influenza-HA tag
  • a calmodulin tag may be used.
  • the sequence of calmodulin has the database accession number BC072232.1 GI:47937654.
  • the GPIIIa polypeptide may, for example, comprise one or more protease recognition sites.
  • a protease recognition site may, for example, be positioned between the GPIIIa sequence and the affinity tag such that contacting the polypeptide with a site-specific protease cleaves the polypeptide at the recognition site to release the GPIIIa sequence from the tag.
  • protease recognition sites include Factor Xa, thrombin, rennin, TEV protease and enterokinase recognition sites.
  • the protease recognition site is a tobacco etch virus (TEV) protease recognition site have the sequence Glu-X-X-Tyr-X-Gln/Ser .
  • TEV tobacco etch virus
  • Other suitable protease recognition sites are described in Richter et al J. Biol. Chem. (2002) 277: 43888-43894.
  • the GPIIIa polypeptide may be coupled to an appropriate signal leader peptide to direct secretion of the GPIIIa polypeptide from cell into the culture medium.
  • the signal leader sequence may be removed following expression to produce the mature GPIIIa polypeptide.
  • a range of suitable signal leader peptides are known in the art .
  • the GPIIIa polypeptide may be immobilised, for example, by attachment to an insoluble support.
  • the support may be in particulate or solid form and may include a plate, test tube, bead, ball, filter or membrane.
  • a polypeptide may, for example, be fixed to an insoluble support that is suitable for use in affinity chromatography. Methods for fixing polypeptides to insoluble supports are known to those skilled in the art .
  • the invention also encompasses nucleic acids, vectors and cells which are suitable for use in methods of producing a GPIIIa polypeptide, as described above.
  • a nucleic acid may comprise a nucleic acid sequence which encodes a GPIIIa polypeptide as described above.
  • a suitable sequence may comprise the nucleic acid sequence of SEQ ID NO: 2 or a fragment of SEQ ID NO: 2 from base 1 to at least base 162, at least base 324, at least base 576, at least base 867, at least base 966 or at least base 1095, or a variant of any of these.
  • a nucleic acid sequence which is a variant of a nucleic acid sequence from SEQ ID NO: 2 as described above may share greater than 60% sequence identity, greater than 65%, greater than 70%, greater than about 80%, greater than 90% or greater than 95% with the nucleic acid sequence from SEQ ID NO: 2.
  • a variant may have one or more of addition, insertion, deletion or substitution of one or more nucleotides in the sequence of a nucleic acid sequence from SEQ ID NO: 2. Up to 10, 20, 30, 50 or 100 nucleotides may be added, inserted, deleted or substituted as described.
  • the nucleotide sequence encoding the GPIIIa polypeptide may be operably linked to a heterologous regulatory sequence. Suitable regulatory sequences to drive the expression of heterologous nucleic acid coding sequences in expression systems are well known in the art.
  • a heterologous regulatory sequence may be an inducible promoter.
  • Such a promoter may induce expression in response to a stimulus . This allows control of expression, for example, to allow optimal cell growth before recombinant polypeptide production is induced.
  • inducible promoters are known to those skilled in the art, including the Drosophila metallothionein (MT) promoter, which is inducible with copper sulphate (CuSO 4 ) .
  • MT Drosophila metallothionein
  • CuSO 4 copper sulphate
  • the heterologous regulatory sequence may be activated by a heterologous transcription factor, such as GAL4 or T7 polymerase.
  • a GAL4 transcription factor may be expressed using an inducible promoter and may drive expression of a coding sequence which is operably linked to the GAL4 promoter.
  • T7 polymerase may be expressed using an inducible promoter and may drive expression of a coding sequence which is operably linked to a T7 promoter.
  • heterologous indicates that the gene/sequence of nucleotides in question or a sequence regulating the gene/sequence in question, is a recombinant sequence which has been introduced into a construct, vector or cell, artificially, using genetic engineering or recombinant means, i.e. by human intervention.
  • Heterologous nucleotide sequences are sequences which do not naturally occur together in nature.
  • Nucleotide sequences which are heterologous to a cell may be non-naturally occurring in cells of that type, variety or species (i.e. exogenous or foreign) or may be sequences which are non-naturally occurring in that sub-cellular or genomic environment of the cells or may be sequences which are non- naturally regulated in the cells i.e. operably linked to a non- natural regulatory element .
  • Nucleic acid sequences and constructs as described above may be comprised within a vector.
  • Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
  • a vector may comprise a selectable marker to facilitate selection of the transgenes under an appropriate promoter.
  • nucleic acid constructs for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in
  • a nucleic acid construct or vector may be introduced into a host cell.
  • nucleic acid to be inserted should be assembled within a construct or vector which contains effective regulatory elements which will drive transcription. There must be available a method of transporting the constructor vector into the cell.
  • suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome- mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, ba ⁇ ulovirus .
  • suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage .
  • Marker genes such as antibiotic resistance or sensitivity genes may be used in identifying cells containing the nucleic acid of interest, as is well known in the art.
  • a method of producing a GPIIIa polypeptide as described herein may comprise; introducing a nucleic acid encoding a GPIIIa polypeptide as described above into a host cell, and; expressing said nucleic acid to produce the GPIIIa polypeptide.
  • Nucleic acid may be expressed by culturing the host cells (which may include cells actually transformed, although more likely the cells will be descendants of the transformed cells) under conditions for expression of the nucleic acid, so that the encoded GPIIIa polypeptide is produced.
  • the GPIIIa polypeptide may be isolated and/or purified from the host cell.
  • the GPIIIa polypeptide may be purified using an affinity tag, which may, optionally, be removed after purification, for example using a specific protease.
  • an affinity tag which may, optionally, be removed after purification, for example using a specific protease.
  • Further aspects of the invention provide a host cell comprising a vector or nucleic acid construct as described herein, and a method of producing a host cell as described herein may comprise introducing a nucleic acid as described herein into the host cell.
  • a host cell may contain a nucleic acid sequence encoding a GPIIIa polypeptide as a result of the introduction of the nucleic acid sequence into an ancestor cell.
  • Suitable host cells may include prokaryotic cells, in particular bacteria such as E. coli, and eukaryotic cells, including mammalian cells such as CHO and CHO- derived cell lines (Lee cells) , HeLa, COS, and HEK293 cells, amphibian cells such as Xenopus oocytes, insect cells such as Trichoplusia ni, S2, Sf9 and Sf21 and yeast cells.
  • prokaryotic cells in particular bacteria such as E. coli
  • eukaryotic cells including mammalian cells such as CHO and CHO- derived cell lines (Lee cells) , HeLa, COS, and HEK293 cells, amphibian cells such as Xenopus oocytes, insect cells such as Trichoplusia ni, S2, Sf9 and Sf21 and yeast cells.
  • a method of detecting an HPA antibody in a sample obtained from an individual may comprise: determining the binding of one or more antibodies in the sample to a GPIIIa polypeptide as described herein, wherein the binding of one or more antibodies to the polypeptide is indicative of the presence of an HPA antibody in the sample .
  • the presence of an HPA antibody in a sample obtained from an individual may be indicative that the individual has a condition associated with HPA antibodies, such as Neonatal Alloimmune Immune Thrombocytpenia (NAIT) , Post Transfusion Purpura (PTP) or Platelet Refractoriness (PR) or is a blood donor.
  • the sample may be a blood, serum or plasma sample. In some embodiments, the sample may be obtained from a pregnant female.
  • HPA antibody is an alloantibody which is reactive in vivo with a human platelet antigen (HPA) .
  • the HPA antibody may be an HPA-I antibody, for example an HPA-Ia, an HPA-Ib antibody or an HPA antibody against another HPA which is located on the GPIIIa polypeptide outside the ⁇ A domain, such as HPA-6w, HPA- 7w, HPA-8w, HPA-IOw, HPA-Hw or HPA-14bw.
  • a GPIIIa polypeptide that has a leucine (L) residue at position 33 may specifically bind to HPA-Ia antibodies.
  • a method of detecting HPA-Ia antibodies in a sample obtained from an individual may comprise: determining the binding of one or more antibodies in the sample to a GPIIIa polypeptide comprising L at residue 33 as described herein, wherein binding to the GPIIIa polypeptide is indicative of the presence of HPA-Ia antibodies in the sample.
  • the presence of one or more antibodies which bind to an L33 GPIIIa polypeptide which lacks EGF domains may be indicative of an increased risk of severe bleeding and/or an increased risk of cerebral bleeds in the individual .
  • L33 GPIIIa polypeptide which comprises EGF domains for example GPIIIa- ⁇ A- L33 (residues 1 to 450 of SEQ ID N0:l) but do not bind to L33 GPIIIa polypeptides which lack EGF domains, may be indicative of HPA-Ia antibodies which are not associated with a increased risk of severe bleeding or cerebral bleeding.
  • a method of detecting HPA-Ia antibodies in a sample obtained from an individual may comprise : determining the binding of one or more antibodies in the sample to a first GPIIIa polypeptide comprising L at residue 33 and a second GPIIIa polypeptide comprising L at residue 33, wherein the first GPIIIa polypeptide does not comprise EGF domains and the second first GPIIIa polypeptide comprises EGF domains, wherein binding to the first GPIIIa polypeptide but not the second GPIIIa polypeptide is indicative of an increased risk of severe bleeding and/or cerebral bleeds in the individual.
  • Suitable first GPIIIa polypeptides may include polypeptides consisting of residues 1 to 54 or residues 1 to 192 of SEQ ID NO:1 as described herein (e.g. GPIIIaPSI-A13L33 or GPIIIaPSIHyb-L33) .
  • Suitable second GPIIIa polypeptides may include peptides consisting of residues 1 to 450 of SEQ ID N0:l as described herein (e.g. GPIIIa- ⁇ A-L33) .
  • a set of polypeptides comprising a first GPIIIa polypeptide and a second GPIIIa polypeptide as described above.
  • a set of polypeptides may comprise a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-54 of SEQ ID N0:l, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-192 of SEQ ID NO:1, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-289 of SEQ ID NO:1, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-322 of SEQ ID NO:1, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-365 of SEQ ID NO:1 and/or a GPIIIa polypeptide having the sequence of SEQ ID N0:l.
  • a GPIIIa polypeptide that has a proline (P) residue at position 33 may specifically bind to HPA-Ib antibodies.
  • a method of detecting HPA-Ib antibodies in a sample obtained from an individual may comprise : determining the binding of one or more antibodies in the sample to a GPIIIa polypeptide comprising P at residue 33 as described herein, wherein binding to the GPIIIa polypeptide is indicative of the presence of HPA-Ib antibodies in the sample.
  • Methods of detecting HPA antibodies as described above may be carried out in any convenient format.
  • Immunological assays are well- known in the art and many suitable formats are available, for example ELISA, Western blotting, mirror resonance (e.g. Biacore®, (Biacore, Upsala, Sweden) , evanescence (DiaMed AG, Cressier sur Morat, Switzerland) or Luminex beads (Luminex ® system, Austin, TX, USA) .
  • a sandwich assay format may be employed.
  • a sandwich assay may employ an immobilised GPIIIa polypeptide to bind HPA antibodies in the sample and an antibody-binding molecule to detect the presence of antibodies which are bound to the polypeptide.
  • a sandwich assay may employ an immobilised antibody-binding molecule to bind antibodies in the sample and a GPIIIa polypeptide as described herein to detect the presence of HPA antibodies bound to the immobilised antibody-binding molecule.
  • a competition assay may employ an recombinant HPA-Ia antibody-binding molecule (e.g. CamTranOO7 or any other suitable recombinant antibody with HPA-Ia specificity) to bind the GPIIIa polypeptide with L at position 33 as described herein and the inhibition of binding of the GPIIIa-L33 polypetide to the recombinant HPA-Ia antibody by polyclonal HPA-Ia antibodies present in a serum, plasma or blood sample.
  • an recombinant HPA-Ia antibody-binding molecule e.g. CamTranOO7 or any other suitable recombinant antibody with HPA-Ia specificity
  • Suitable antibody-binding molecules for use in such methods may include immunoglobulin-binding antibodies, for example anti-human Ig antibodies, anti-human Ig antibodies, anti-human antibodies specific for Ig isotypes or for subclasses of IgG, Staphylococcal protein A and Staphylococcal protein G.
  • immunoglobulin-binding antibodies for example anti-human Ig antibodies, anti-human Ig antibodies, anti-human antibodies specific for Ig isotypes or for subclasses of IgG, Staphylococcal protein A and Staphylococcal protein G.
  • the non-immobilised antibody-binding molecule or polypeptide may comprise a detectable label as described above.
  • Linkage of detectable labels to an antibody-binding molecule or polypeptide may be direct or indirect, covalent, e.g. via a polypeptide bond, or non-covalent .
  • Linkage via a polypeptide bond may be as a result of recombinant expression of a gene fusion encoding specifc binding member (e.g. antibody) and label molecule.
  • Linkage via a non- covalent bond may be a result of a binding between a biotinylated antibody and a streptavidin/avidin linked label molecule.
  • Labels include fluorochromes such as fluorescein, rhodamine, phycoerythrin, Europium and Texas Red, chromogenic dyes such as diaminobenzidine, radioisotopes, macromolecular colloidal particles or particulate material such as latex beads that are coloured, magnetic or paramagnetic, binding agents such as biotin and digoxigenin, and biologically or chemically active agents that can directly or indirectly cause detectable signals to be visually observed, electronically detected or otherwise recorded, for example in a FACS, ELISA, Western blot, TRFIA, immunohistochemistry, evanescence, Luminex bead array, or dipstick or other lateral flow assay format .
  • fluorochromes such as fluorescein, rhodamine, phycoerythrin, Europium and Texas Red
  • chromogenic dyes such as diaminobenzidine
  • radioisotopes such as diaminobenzidine
  • Bioly or chemically active agents include enzymes, which catalyse reactions that develop or change colours or cause changes in electrical properties, for example. They may be molecularly excitable, such that electronic transitions between energy states result in characteristic spectral absorptions or emissions. They may include chemical entities used in conjunction with biosensors. Biotin/avidin or biotin/streptavidin and alkaline phosphatase detection systems may be employed. Further examples include horseradish peroxidase and chemiluminescence
  • the non-immobilised antibody-binding molecule or polypeptide may be detected using an antibody which binds to said non-immobilised antibody-binding molecule or polypeptide.
  • a suitable detection antibody may be labelled.
  • kits for detecting HPA antibodies relate to the provision of kits for detecting HPA antibodies .
  • a GPIIIa polypeptide as described above may form part of a kit for detecting or diagnosing HPA antibodies e.g. in a suitable container such as a vial in which the contents are protected from the external environment
  • a kit for detecting an HPA antibody in a sample may comprise: a GPIIIa polypeptide as described above, and; one or more detection reagents for determining binding of one or more antibodies in a sample to the GPIIIa polypeptide.
  • the GPIIIa polypeptide may be free in solution or may be immobilised on a solid support, such as a magnetic bead, tube or microplate well .
  • the kit may further comprise an antibody- binding molecule.
  • Suitable antibody-binding molecules include Staphylococcal protein A, Staphylococcal protein G and antibodies that bind to immunoglobulins, such as IgG 7 in particular human immunoglobulins .
  • the antibody-binding molecule may be a capture or detection reagent and may be free in solution or may be immobilised on a solid support, such as a magnetic bead, tube or microplate well.
  • the antibody-binding molecule or polypeptide may be labelled with a detectable label, for example a fluorescent or chromogenic label or a binding moiety such as biotin. Suitable labels are described in more detail above.
  • the detection reagents may further comprise a substrate, for example a chromogenic, fluorescent or chemiluminescent substrate, which reacts with the label, or with molecules, such as enzyme conjugates, which bind to the label, to produce a signal.
  • the detection reagents may further comprise buffer solutions, wash solutions etc.
  • the kit may also comprise one or both of: apparatus for handling and/or storing the sample obtained from the individual; and, apparatus for obtaining the sample from the individual .
  • apparatus for handling and/or storing the sample obtained from the individual may include, for example, a needle or lancet.
  • the kit may also include instructions for use of the GPIIIa polypeptide, e.g. in a method of detecting a HPA antibodies in a test sample, as described herein.
  • HPA-Ia and HPA-Ib specific recombinant antibodies may be used for HPA-Ia and HPA-Ib phenotyping of individuals.
  • Antibodies which bind GPIIIa may be used therapeutically, e.g. to prevent binding of fibrinogen or other extracellular matrix proteins to GPIIIa or to ameliorate the binding of harmful viruses to the PSI domain of GPIIIa (e.g.
  • a method of producing an antibody which binds GPIIIa may comprise: administering an immunogen comprising a GPIIIa polypeptide as described herein to an animal, and; isolating from said animal an antibody which binds to said polypeptide.
  • the immunogen may comprise a protein carrier, such as Keyhole Limpet Haemocyanin.
  • a protein carrier such as Keyhole Limpet Haemocyanin.
  • Other suitable carriers are well known in the art.
  • Antibodies may be obtained from immunised animals using any of a variety of techniques known in the art, and screened, preferably using binding of antibody to antigen of interest. For instance, Western blotting techniques or immunoprecipitation may be used (Armitage et al . (1992) Nature 357 80-82).
  • an antibody molecule may be a monoclonal antibody.
  • Methods of producing monoclonal antibodies are well known in the art (see, for example, Harlow et al Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory (Cold Spring Harbor, NY, 1988) pp. 353-355) and are described in more detail below.
  • antibody-producing cells may be isolated from an immunised mammal and fused with immortalised cells to produce a population of antibody-producing hybridoma cells, which can then be screened to identify a hybridoma cell that produces an antibody which displays optimal binding characteristics.
  • a hybridoma may be produced by a method comprising; immunising a non-human mammal with an immunogen comprising a GPIIIa polypeptide as described above, producing one or more fusions of antibody producing cells from said mammal and immortalised cells to provide a population of hybridoma cells, and; screening said population to identify a hybridoma cell which produces an antibody which binds the GPIIIa polypeptide.
  • the population of hybridoma cells is preferably screened by testing the binding of antibodies produced by cells of the population to one or more GPIIIa polypeptides as described herein.
  • the relative binding of antibodies to GPIIIa polypeptides with L at position 33 relative to GPIIIa polypeptides with P at position 33 may be determined. Conventional techniques such as western blotting or immunoprecipitation may be used.
  • Hybridoma cells identified as producing antibodies which bind to the GPIIIa polypeptide may be isolated and/or purified from the population.
  • hybridoma may be expanded, maintained and/or cultured in a culture medium using methods which are well- known in the art .
  • Antibodies produced by the hybridoma may be isolated from said culture medium.
  • a method of producing an antibody may comprise; culturing a hybridoma cell produced as described above in a culture medium,- and, isolating from the medium an antibody as described above, for example, an antibody which binds to the GPIIIa polypeptide.
  • a monoclonal antibody specific for a GPIIIa polypeptide may be obtained from a recombinantly produced library of expressed immunoglobulin variable domains or other molecules comprising antibody antigen-binding domains, e.g. using lambda bacteriophage or filamentous bacteriophage which display functional immunoglobulin binding domains on their surfaces; for instance see WO92/01047.
  • the library may be immunologically naive, that is constructed from sequences obtained from an organism which has not been immunised with a polypeptide comprising the epitope, or may be one constructed using sequences obtained from an organism which has been exposed to the antigen of interest.
  • a method of producing an anti-GPIIIa binding member comprising: contacting a GPIIIa polypeptide as described above with a diverse population of antibody antigen-binding domains, and; determining the binding of members of said population to said polypeptide.
  • the antibody antigen-binding domains may be comprised in antibodies or scFv, Fab, Fv, dAb, Fd or diabody molecules
  • An antibody antigen-binding domain may be identified in said population which binds to the GPIIIa polypeptide. In some embodiments, an antibody antigen-binding domain may be identified in said population which binds to GPIIIa polypeptides comprising leucine at position 33 but does not bind to GPIIIa polypeptides comprising proline at position 33 or which binds to GPIIIa polypeptides comprising proline at position 33 but does not bind to GPIIIa polypeptides comprising leucine at position 33.
  • Antibody antigen-binding domains may be displayed on the surface of virus particles i.e. the diverse population may be a phage display library.
  • the virus particle which displays the identified antibody antigen- binding domain may be isolated and/or purified and the nucleic acid encoding the antibody antigen-binding domain obtained from said particle.
  • the nucleic acid encoding the antibody antigen-binding domain may be sequenced and/or expressed to produce the encoded antibody antigen- binding domain that binds to the GPIIIa polypeptide.
  • An antibody antigen-binding domain produced as described above may be further tested using routine methodology to determine its specificity e.g. to determine whether it binds specifically to GPIIIa polypeptide with L or P at position 33.
  • the binding properties of the antibody antigen- binding domain may be further optimised using standard antibody engineering techniques, including affinity maturation, for example by chain shuffling, and site-specific, random or combinatorial mutagenesis .
  • An antibody antigen-binding domain which is comprised in an antibody or antibody molecule may be reformatted, for example into an IgG antibody, using standard techniques for subsequent use, for example in a method of HPA phenotyping .
  • Antibodies, specific binding members and antibody antigen-binding domains which bind GPIIIa polypeptides as described herein may be useful methods of HPA-I phenotyping.
  • a method of HPA-I typing an individual may comprise; contacting a specific binding member comprising an antibody antigen-binding domain which specifically binds to GPIIIa polypeptides comprising leucine at position 33, for example an antibody antigen-binding domain identified as described herewith, with a sample of platelets obtained from an individual, and; determining the binding of the specific binding member to platelets in the sample.
  • Binding may be indicative that the individual is an HPA-Ia homo- or heterozygote . Absence of binding may be indicative that the individual is HPA-Ia negative.
  • a method of HPA-I typing an individual may comprise; contacting a specific binding member comprising an antibody antigen-binding domain which specifically binds to GPIIIa polypeptides comprising proline at position 33, for example an antibody antigen-binding domain identified as described herewith, with a sample of platelets obtained from an individual, and; determining the binding of the specific binding member to platelets in the sample.
  • Binding may be indicative that the individual is an HPA-Ib homo- or heterozygote . Absence of binding may be indicative that the individual is HPA-Ib negative.
  • a suitable sample may be any platelet-containing sample, for example a blood sample or a fraction or extract thereof.
  • GPIIIa polypeptides as described herein may also be useful in the treatment of blood to remove harmful HPA-I antibodies.
  • a method of removing or depleting HPA-I antibodies from a sample may- comprise : contacting a sample with an immobilised GPIIIa polypeptide as described herein, wherein HPA-I antibodies in said sample bind to the polypeptide, and; separating the sample from the polypeptide, such that HPA-I antibodies are removed from the sample.
  • the sample may be a blood, serum or plasma sample.
  • the sample may, for example, be a blood or plasma sample obtained from an individual with HPA-Ia antibodies.
  • the GPIIIa polypeptide may be immobilised on a column or other solid phase.
  • the blood or plasma sample may be brought in contact with the
  • GPIIIa polypeptide for example by passing the sample over the solid phase, thereby allowing binding of polyclonal HPA-Ia antibodies to the polypeptide, to remove completely or reduce the concentration of HPA-Ia antibodies in the blood (apheresis) .
  • Apheresis procedures are routinely used in the art to obtain plasma from donors or to remove plasma containing harmful antibodies from a patient.
  • GPIIIa polypeptides as described herein may also be useful in the identification of therapeutic compounds.
  • a method of identifying a compound useful in the treatment of a GPIIIa mediated condition comprising; contacting a GPIIIa polypeptide as described herein with a test compound, and; determining binding of the polypeptide with test compound.
  • the presence of binding is indicative that the compound is useful in the treatment of a GPIIIa mediated condition.
  • GPIIIa mediated conditions include viral infections, such as Hantavirus infection, and atherothrombosis.
  • a compound may, for example, inhibit the binding of Hantavirus to the PSI domain of GPIIIa or reduce the homotypic interaction between platelets or the heterotypic interaction between platelets and the endothelial cells lining the blood vessel wall, by inhibiting the interaction between glycoprotein HbIIIa and fibrinogen or other extracellular matrix or blood proteins important to atherothrombosis .
  • Compounds which may be screened using the methods described herein may be natural or synthetic chemical compounds used in drug screening programmes. Extracts of plants, microbes or other organisms which contain several characterised or uncharacterised components may also be used.
  • Combinatorial library technology provides an efficient way of testing a potentially vast number of different compounds for ability to modulate an interaction.
  • Such libraries and their use are known in the art, for all manner of natural products, small molecules and peptides, among others.
  • the use of peptide libraries may be preferred in certain circumstances.
  • test compound or compound which may be added to a method of the invention will normally be determined by trial and error depending upon the type of compound used. Typically, from about 0.001 nM to 1 mM or more of test compound may be used, for example from 0.01 nM to 100 ⁇ M, e.g. 0.1 to 50 ⁇ M, such as about 10 ⁇ M.
  • a method may comprise identifying the test compound as a compound which binds GPIIIa.
  • a compound may, for example be useful in the treatment of a GPIIIa-mediated condition.
  • a test compound identified using one or more initial screens as having ability to bind a GPIIIa polypeptide may be assessed further using one or more secondary screens.
  • a secondary screen may, for example, involve testing for a biological function such as the inhibition of viral infection and amelioration of symptoms of GPIIIa-mediated conditions in animal models.
  • test compound may be isolated and/or purified or alternatively, it may be synthesised using conventional techniques of recombinant expression or chemical synthesis. Furthermore, it may be manufactured and/or used in preparation, i.e. manufacture or formulation, of a composition such as a medicament, pharmaceutical composition or drug. These may be administered to individuals for the treatment of a GPIIIa-mediated condition. Methods may thus comprise formulating the test compound in a pharmaceutical composition with a pharmaceutically acceptable excipient, vehicle or carrier for therapeutic application. Various further aspects and embodiments of the present invention will be apparent to those skilled in the art in view of the present disclosure. All documents mentioned in this specification are incorporated herein by reference in their entirety.
  • Comprising' as used herein encompasses embodiments which include other components and embodiments which do not include other components.
  • the term may be replaced by the term 'consisting of when referring only to the latter embodiments.
  • the invention encompasses each and every combination and sub- combination of the features that are described above.
  • Figure 1 shows a schematic diagram of the domains of GPIIIa employed in the constructs described herein.
  • Figure 2 shows a schematic diagram of the cloning of GPIIIaPSIHyb fragment and GPIIIa ⁇ A in puC119-MH.
  • Figure 3 shows the results of nucleotide sequencing of the gene constructs used for the generation of the GPIIIa ⁇ SDL-P33 (lower panel) which was derived from the GPIIIa ⁇ SDL-L33 (upper panel) by site-directed mutagenesis.
  • Figure 4 shows the expression of recombinant GPIIIa ⁇ SDL in CHO Lee 3.2.8.1 cell supernatant.
  • Bound murine monoclonal IgG (Y2/51, a monoclonal antibody specific for GPIIIa in the absence of GPIIb; 9E10, a isotype matched 'negative control' monoclonal antibody against the Myc antigen) was detected with horseradish peroxidase- conjugated goat anti-mouse antibody and absorbance read at 450 nm. Each data point represents an average of three replicate samples .
  • Figure 5 shows the reactivity of GPIIIa ⁇ SDL-L33 and GPIIIa ⁇ SDL-P33 with a panel of monoclonal antibodies by ELISA (monoclonal antiby Y2/51 as per Figure 4; monoclonal antibody RFGP56 against GPIIbIIIa and known not to react with GPIIIa in the absence of GPIIb; monoclonal antibody 9E10 as per Figure 4) .
  • Absorbance was read at 450 nm; Sup - supernatant; Lys - Lysate. Each OD represents the mean of duplicate determinations.
  • Figure 6 shows ELISA analysis of the binding of secreted GPIIIa ⁇ SDL- L33 (black) or GPIIIa ⁇ SDL-P33 (grey) to a panel of human recombinant HPA-Ia antibodies (Antibodies CamTranOO7, 19.7 and 23.15 are recombinant human phage antibodies [re-engineered to human IgG] and specific for HPA-Ia,- antibody Fog is against an irrelevant antigen, RhD) .
  • Absorbance was read at 450 nm; X-axis, monoclonal antibodies; Y-axis, absorbance value. Each OD represents the mean of duplicate determinations .
  • Figure 7 shows ELISA analysis of the binding of secreted GPIIIa ⁇ SDL- L33 (black) or GPIIIa ⁇ SDL-P33 (grey) to three polyclonal human sera (diluted 1:20; anti-HPA-la contains alloantibodies against HPA-Ia; anti-HPA-lb, contains alloantibodies against HPA-Ib; AB, inert serum from a donor with blood group AB) .
  • Absorbance was read at 450 nm; X- axis, human samples with polyclonal antibodies; Y-axis, absorbance value. Each OD represents the mean of duplicate determinations.
  • Figure 9 shows the reactivity of GPIIIa calmodulin tagged fragments with GPIIIa MAbs .
  • Figure 10 shows the reactivity of murine GPIIIa specific monoclonal antibodies with recombinant GPIIIa in ELISA.
  • Top panel shows the binding of three mouse GPIIIa antibodies CRC54, Y2/51 and RFGP56 (10 ⁇ g/mL) with the recombinant GPIIIa in ELISA.
  • Bottom panel shows binding of the mouse monoclonal antibody SZ21 at two concentrations 1 ⁇ g/mL and 10 ⁇ g/mL with recombinant GPIIIa fragments.
  • Figure 11 shows the reactivity of the human HPA-Ia 19-7, 23-15 and CamTranOO7 to recombinant GPIIIa fragments in ELISA.
  • Figure 12A shows the reactivity of the WHO anti-HPA-la minimum potency standard (NIBSC 93/710) with recombinant GPIIIa fragments ⁇ A and ⁇ SDL by ELISA.
  • Figure 12B shows the reactivity of the WHO proposed anti-HPA-la sensitivity standard (NIBSC 03/152) with recombinant GPIIIa fragments ⁇ A and ⁇ SDL by ELISA.
  • the level of detection achieved in the MAIPA is shown by the dotted lines in both panels. Points represent the means + SD of triplicate wells in 1 experiment, representative at least 2 experiments
  • Figure 13 shows the reactivity of HPA-Ib antibodies with the recombinant GPIIIa fragments.
  • Five HPA-Ib antibodies were tested for reactivity with the recombinant calmodulin-tagged GPIIIa fragments by ELISA.
  • As positive control reactivity of the leucine 33 form of ⁇ SDL with the anti-HPA-la CamTran007 was included and as negative control, all anti-HPA-lbs were also tested for reactivity with recombinant GPVI (D1D2) .
  • Table 1 shows the domain structure of the GPIIIa ⁇ BA polypeptide.
  • Table 2 shows the reactivity of 132 polyclonal NAIT samples with recombinant calmodulin-tagged GPIIIa in ELISA.
  • the samples were divided into four distinct clinical groups: (a) cases resulting in intracranial haemorrhage (ICH) , (b) platelet count ⁇ 20X109/L, (c) platelet count ⁇ 20X109/L and (4) cases with a history of antenatal treatment .
  • Anti-GPIIIa, clone Y2/51 11 was from Dako, Cambridge, UK and anti-c-
  • Myc, clone 9E10 12 was from the International Blood Group Reference Laboratory (IBGRL) , Bristol, UK.
  • Recombinant human anti-D Fog-B 13 (FOG in the figures) and IgGl anti-HPA-la, clone CamTranOO7 14 were from IBGRL.
  • Human HPA-Ia monoclonal antibodies 19-7 ⁇ Proulx, 1997 #169 ⁇ and 23-15 ⁇ Proulx, 1997 #169 ⁇ were kindly provided by Dr. R. Lemieux, Hema-Quebec, Canada.
  • Human polyclonal sera were from the National Blood Service Platelet Immunology serum archives
  • the GPIIIa ⁇ SDL-P33 mutant was generated using the Quick Change XL site-directed mutagenesis kitTM (Stratagene, Amsterdam, The Netherlands) according to manufacturer's instructions and using the mutagenic primers 5'-GAGGTGAGCCCGGAGGCAGGGCCTC-S' and 3'- GAGGCCCTGCCTCCGGGCTCACCTC-5 ' .
  • Each 50 ⁇ L reaction contained 50 ng DNA, 5 ⁇ L of 1OX reaction buffer, 125 ng of each oligonucleotide primer, 1 ⁇ L dNTP, 3 ⁇ L QuickSolution, 2.5 U Pfu Turbo.
  • Amplification was performed over 20 cycles consisting of an initial denaturing period at 95° C for 1 min, 18 cycles each consisting of 50 s at 95° C, 50 s at 60° C and 9 min 40 s at 68° C and a final extension time of 7 min at 68° C.
  • the amplified product was digested with 10 U Dpnl for 1 h at 37° C to degrade the parental plasmid.
  • Electrocompetent E. coli TOPlO (Invitrogen) cells were transformed with 2 ⁇ L of the Dpnl-treated plasmid. Mutation was confirmed by sequencing as described below.
  • the GPIIIa ⁇ SDL- P33/pEFl-puroHis construct generated by site-directed mutagenesis (SDM) was digested with BamHI to recover a GPIIIa fragment containing the P33 mutation. This fragment was then recloned into BamHI digested pEFl-puroHis plasmid to avoid the possibility of introducing unwanted mutations in the vector backbone from the SDM reaction.
  • Chinese Hamster Ovary (CHO) cell Lee 3.2.8.1 strain was originally engineered to incorporate 4 mutations such that all the glycoproteins are produced with the N-linked carbohydrates in the Man5 oligomannosyl forms and all O-linked carbohydrates truncated to a single GaINAc 17 .
  • the single GalcNac was preserved as it has been documented that in some cases, GalcNac is required for the glycoprotein activity.
  • the CHO Lee cells were maintained in Dulbecco's Modified Eagle's medium (DMEM) (Invitrogen, Groningen, The Netherlands) supplemented with 10% fetal calf serum (Invitrogen), 0.1 mM non-essential amino acids (Invitrogen) , 2 mM L-glutamine (Invitrogen) , and 1% vol/vol penicillin and streptomycin (Invitrogen) (complete media) .
  • DMEM Dulbecco's Modified Eagle's medium
  • Invitrogen fetal calf serum
  • Invitrogen 0.1 mM non-essential amino acids
  • 2 mM L-glutamine Invitrogen
  • 1% vol/vol penicillin and streptomycin Invitrogen
  • CHO Lee 3.2.8.1 cells were transfected by electroporation with either plasmid containing the allele-specific recombinant GPIIIa ⁇ SDL gene segments.
  • the cells were resuspended in electroporation buffer (NaH 2 PO 4 -H 2 O, Na 2 HPO 4 .7H 2 O, NaCl, pH 7.2) at a concentration of ⁇ lxl ⁇ 7 cells/mL.
  • electroporation buffer NaH 2 PO 4 -H 2 O, Na 2 HPO 4 .7H 2 O, NaCl, pH 7.2
  • 800 ⁇ L resuspended cells were incubated for 10 min on dry ice with DNA (10 ⁇ g, GPIIIa ⁇ SDL in pEFlpuro and with C-terminal hexahistidine tag) before electroporation (370 V, 960 ⁇ F) .
  • the cells were allowed to recover for 15 min, resuspended in 9 mL complete media and seeded in a 10 cm tissue culture plate. They were incubated overnight (0/N) at 37 0 C and 5% CO 2 . Twenty-four hours post-transfection, the cells were washed once and seeded into the original plate. The following day, they were treated with trypsin/EDTA (Invitrogen) and resuspended in selection media (complete media and puromycin 8 ⁇ g/mL) before seeding into a 96-well plate (5xlO 3 cells/mL; 200 ⁇ L/well) . Fourteen days post transfection the culture supernatants were assayed for secreted GPIIIa oligopeptide by ELISA.
  • Stable clones were screened for secretion of His-tagged GPIIIa ⁇ SDL by ELISA, using the Ni-NTA HisSorb strips (QIAGEN, Crawley, UK) , according to manufacturer's instructions. All incubation steps were carried out at room temperature (RT) on a plate shaker. Briefly, the Ni-NTA strips were coated for 2 h with 200 ⁇ L of neat supernatant.
  • the wells were washed four times with Phosphate Buffered Saline (PBS) containing 0.05% Tween20 (PBST) before incubation with the MoAb Y2/51 (1 ⁇ g/ml in PBS/0.2% Bovine serum albumin (BSA) ; 200 ⁇ L/well) for 2 h.
  • PBS Phosphate Buffered Saline
  • BSA Bovine serum albumin
  • the wells were then washed with PBST and incubated with horseradish peroxidase (HRP) -conjugated goat anti-mouse immunoglobulin G (1:5000 in PBS/0.2% BSA, Sigma) .
  • HRP horseradish peroxidase
  • Immune complexes were detected by the addition of 3, 3', 5,5'- tetramethylbenzidine (TMB; Sure Blue, KPL, Guildford, UK) and the reaction was stopped with 2.5 M H 2 SO 4 . Absorbance was read at 450 nm.
  • TMB 3, 3', 5,5'- tetramethylbenzidine
  • the recombinant GPIIIa fragments expressed were GPIIIa ⁇ SDL (residues 1-690 with residues 160-188 deleted) , GPIIIa ⁇ A (residues 1-109 fused to residues 352 to 690 with a serine residue inserted after residue 109) , GPIIIaPSIHyb (residues 1-109 fused to residues 352-433 with a serine residue inserted between residue 109 and 352) and GPIIIaPSIA13 (residues 1-54 with the cysteine residue at position 13 mutated to alanine) . Each fragment was expressed with either leucine (L) or proline (P) at position 33.
  • GPIIIaASDL The longest fragment to be expressed is the GPIIIa ⁇ SDL. This fragment consists of residues 1 to 690 with residues 160-188 deleted. The deleted residues form part of the specificity- determining loop (SDL) region and has been shown to form the interface with the GPIIb subunit 16 .
  • GPIIIa ⁇ SDL was cloned into pMT-CaM as a BsmBl insert. Since, GPIIIa contains most of the restriction sites present in the multiple cloning site of the pMT-CaM vector amongst which Ncol and Notl, the fragment could not be cloned directly into the vector. Instead, the BsmBl restriction sites were appended at both ends of the PCR product as this enzyme recognises a non-palindromic site and cuts outside this region. Thus, by designing primers such that digestion of the PCR products will generate compatible overhangs it was possible to clone GPIIIa ⁇ SDL into the pMT-CaM. GPIIIa ⁇ SDL was amplified by PCR using the primer pairs 5'-
  • TTTCGTCTCACATGGCCGGGCCCAACATCTGTACC (GPIIIaBsmBlF) and 5 ' - TTTCGTCTCTGGCCGCGGGCCCTTGGGACACTCTGGC (GPIIIa ⁇ SDLBsmBlR) and the GPIIIa ⁇ SDL insert in pEFl-His-puro as template.
  • Each 50 ⁇ L PCR reaction contained typically 50 ng DNA, 5 ⁇ L of 1OX reaction buffer, 125 ng of each primer, 2 mM dNTP, MgCl 2 and 2.5 U Amplitag Gold
  • Amplification was performed over 30 cycles consisting of an initial denaturing period at 95° C for 5 min, 30 cycles each consisting of 1 min at 94° C, 30 s at 60° C and 1 min 30 s at 72° C. The final extension time was 7 min at 72° C.
  • GPIIIaHyb ⁇ TD Another GPIIIa fragment called GPIIIaHyb ⁇ TD consisting of residues encoding residues 428 to 690 was also amplified by PCR using GPIIIa ⁇ SDL as template and primers GPIIIaHyb and GPIIIa ⁇ SDLBsmBlR.
  • the GPIIIaHyb ⁇ TD PCR product was purified using the QIAquick gel purification kit according to manufacturer's instructions was then digested with BsmBl and BstEII O/N at 55°C before gel purification. The digested BstEIl/BsmBl GPIIIaHyb ⁇ TD was then ligated into
  • FIG. 2 is a schematic diagram illustrating the various cloning steps leading to PSIHyb and GPIIIa ⁇ A.
  • GPIIIa gene fusions (L33 and P33), containing the PSI fused to the hybrid domain, were generated by overlapping polymerase chain reaction (PCR) .
  • PCR polymerase chain reaction
  • GPIIIa gene fragments encoding residues 1-109 (both the L33 and P33 forms) plus an additional codon for a serine (named residue 109A) at the 3 '-end were amplified by PCR using the primers 5' -AACTGCGGCCCAGC CGGCCATGGCCGGGCCCAACATCTGTACCACGCGA (GPIIIa-PSIF) and 5 ' -AGAACGAGAATCCTCCACCTGCCGCACTTGGATGGAGAA.
  • Another gene fragment encompassing residues 352-437 of GPIIIa was amplified using the primers : 5' -CGGCAGGTGGAGGATTCTCGTTCTAAAGTAGAGCTGGAGGTG and primers 5'-ACTTGCGGCCGCGCCTGGCAGGCACAGTCACAATC (GPIIIa-HybridR) .
  • Each 50 ⁇ L PCR reaction contained typically 50 ng DNA, 5 ⁇ L of 10 x reaction buffer, 125 ng of each primer, 2 mM dNTP, MgCl 2 and 2.5 U Amplitag Gold (Promega) .
  • Amplification was performed over 30 cycles consisting of an initial denaturing period at 95° C for 5 min, 30 cycles each consisting of 1 min at 94° C, 30 s at 60° C and 1 min 30 s at 72° C. The final extension time was 7 min at 72° C.
  • the PCR products were separated by electrophoresis and the purified products were used as templates to generate the fusion fragments by overlapping PCR using the primers GPIIIa-PSIF and GPIIIa-HybridR.
  • the purified PSIHyb-L33 and PSIHyb-P33 products were digested with Ncol and WotI before ligation into the bacterial expression vector pUC119-MycHis to check for recombinant GPIIIaPSIHyb expression and reactivity with anti-HPA-la and anti- HPAIb polyclonal antibodies.
  • the PSIHyb inserts L33 and P33 were then cloned into pMT-CaM as Ncol/Notl inserts.
  • the PSI domain consists of residues 1 to 54 inclusive and contains an odd number of cysteine residues namely 7. Cysl3 forms a long- range disulphide bond with Cys435 18 . To express the PSI domain only and to ensure that the correct disulphide bridges are formed, the cysteine residue at position 13 was mutated to alanine.
  • PSIA13L33 and PSIA13 P33 were generated, sequenced using the plasmid specific primers pMTF and pMTCamR and were then cloned as Ncol/Notl inserts in pMT-CaM vector.
  • Recombinant protein was expressed in Schneider's Drosophila S2 cells using the Invitrogen's Drosophila Expression System (DES ® ) , which enables recombinant protein expression from both stable mammalian and insect expression systems.
  • This expression system is non-lytic and uses simple plasmids for stable expression. Protein expression occurs in healthy, logarithmically growing cells such that high levels and high-quality recombinant protein can be produced.
  • the gene of interest is sub-cloned into the pMT/Bip/Calmodulin expression vector (a modified version of the Invitrogen vector pMT/Bip/V5-His DES ® in which the V5His tag has been replaced by calmodulin) and co-transfected into S2 cells using the pCoBlast selection vector for stable and inducible expression of secreted protein.
  • the pMT/BiP/V5-His DES ® vector contains the Drosophila metallothionein (MT) promoter 19 which allows the inducible expression of the gene of interest . This promoter is tightly regulated, but is easily induced by the addition of copper sulphate (CuSO 4 ) to the culture medium.
  • the Drosophila BiP gene which encodes an immunoglobulin-binding chaperone protein leads to the channeling of BiP into the S2 secretory pathway and directs the recombinant protein into the culture medium 20 .
  • Drosophila Melanogaster Schneider's S2 cells (Invitrogen) 21 were maintained at 2xlO 6 cells/ml, in DESTM Expression Media (Invitrogen) supplemented with 10% heat-inactivated fetal calf serum, 100 units/ml penicillin, 100 units/ml streptomycin, at 25°C with air as the gas phase.
  • Cells were generally maintained at a density in the range of 6 to 15xlO s cells/mL and were seeded at a minimum density of 2xlO 5 cells/mL.
  • Drosophila Schneider's S2 cells were transfected using the Calcium Phosphate transfection kit (Invitrogen) according to manufacturer's instructions. S2 cells were transfected with DNA-calcium phosphate coprecipitates using the pCoBlast plasmid as the selectable marker to confer blasticidin resistance 22 . The cells were washed the following day to remove the calcium phosphate solution and 4 days post-transfection, blasticidin (12.5 ⁇ g, Sigma) was added to select for stable cells. The cells were washed every 4 th day to remove dead cells and replated into the same wells with blasticidin containing media to expand blasticidin-resistant cells. Secreted recombinant proteins were assayed by Western blotting.
  • the calmodulin tag was detected by a calmodulin-binding peptide, here referred to as N9A 23 .
  • BSA-conjugated N9A was prepared by the method of Bernatowicz and Matsueda (1986) 24 . Following conjugation, the BSA-N9A was dialysed into 100 inM NaCl, 50 mM Na-Borate at pH 8.3 and stored at -20 ° C, at a concentration of 19 mg/ml as determined by BCA assay (Perbio, Chester, UK) .
  • HRP-conjugated-N9A was prepared by mixing N9A peptide with polymerized, maleimide-activated peroxidase (Sigma: P-1834) dissolved in PBS, pH 7.4.
  • Proteins were then electro-blotted onto the nitrocellulose membrane for -75 ran at 0.1 mA/cm 2 .
  • the membrane was then blocked in 1% BSA in TBST (25 mM Tris HCl (pH 7.4), 0.15 M NaCl, 0.1% Tween) for 2 hours at room temperature.
  • the membrane was incubated with the peroxidase-conjugated 9NA peptide (diluted 1: 3 000 in TBST supplemented with 0.5 inM CaCl 2 ), for 20 min at RT with agitation. Following incubation, the membrane was washed in TBST 3 times for 10 min. Bound antibody-peroxidase conjugate was visualised using ECL detection reagents (Amersham Pharmacia Biotech, UK) according to manufacturer's instructions.
  • Stably transfected S2 cells were passaged into Ex-Cell 420 (JRH) serum free media (200 ml in 500 ml Erlenmeyer flasks) at a density of 3-4 x 10 6 cells/ml and incubated overnight at 26°C in an orbital shaker (110 rpm) . Protein expression was induced by the addition of 500 ⁇ M copper sulphate and the cells were grown for up to a further 7 days, following which the supernatant was harvested. The supernatant was cleared by centrifugation at 10 000 rpm for 20 minutes at 4°C and then passed through a 2 ⁇ M filter.
  • JRH Ex-Cell 420
  • CaM-tagged protein was purified from the clarified supernatant on an N- (6- Aminohexyl) -5-chloro-l-naphthalenesulfonamide hydrochloride (W-7) - agarose column.
  • W-7 Twenty milligrams of W-7 was dissolved at RT in 10 ml ethanol . The dissolved W-7 was then diluted in an equal volume of 50 mM sodium borate, pH 8.3 prior to being recirculated for 3 hours on a 1 ml NHS-activated HiTrap column (Amersham Pharmacia Biotech) prepared according to manufacturer's instructions. All purification steps were carried out at 4°C. A flow rate of 0.5 ml/min was used for column preparation and this was increased to 1-1.5 ml/min for protein purification.
  • the W7-agarose column was washed with 20 ml of equilibration buffer (0.5 M NaCl, 50 mM Tris, 1 mM CaCl 2 , pH 7.4), 10 ml of elution buffer (0.15 M NaCl, 50 mM Tris, 10 mM EDTA, pH 7.4) and then a further 10 ml of equilibration buffer.
  • the clarified culture supernatants were supplemented with 0.3 M NaCl, 50 mM Tris, 1 mM CaCl 2 , filtered though a 2 ⁇ M filter before loading onto the W7-agarose column.
  • the W7 column was washed with 20 ml equilibration buffer and recombinant CaM-tagged proteins eluted with elution buffer. One ml fractions were collected and analysed by SDS-PAGE.
  • GPIIIa mouse monoclonal antibodies and human V gene phage antibodies The specificity of the CaM-tagged domain deleted GPIIIa mutants was investigated by ELISA.
  • the GPIIIa specific murine MoAbs CRC54 (Yorkshire Biosciences Ltd, York, UK) (Mazurov, Khaspekova et al. 1996), Y2/51 (Dako, Cambridge, UK) (Gatter, Cordell et al . 1988), SZ21 (Xi, Zhao et al . 1992; Weiss, Goldschmidt-Clermont et al . 1995) and the murine GPIIbIIIa complex specific MoAb RFGP56 (Goodall 1991) was screened for reactivity.
  • GPVI As a negative control recombinant GPVI, consisting of the two immunoglobulin folds [D1D2] was included. Fusion proteins were captured via the calmodulin tag in the presence of Ca 2+ and binding was detected as described previously (Smethurst et al . , 2004, O'Connor et al . , 2005). Monoclonal murine antibodies were used at 1 ⁇ g/ml and 10 ⁇ g/ml and detected with HRP conjugated goat-anti-mouse (1: 1000 in TBST/Ca 2+ ) .
  • the cut-off for the HPA-I antibody detection assay was determined by screening 40 anonymous male plasma samples (diluted 1:20 and 1:40, Wellcome Trust Case Control Consortium study, National Blood Service, Cambridge, UK) for reactivity with rGPIIIa ⁇ SDL and rGPIIIa ⁇ A.
  • the MAIPA binding of both the World Health Organisation (WHO) anti-HPA-la minimum potency reagent (NIBSC 93/710, National Institute for Biological Standards and Control- NIBSC; Potters Bar, UK) and the WHO proposed anti-HPA-la standard (NIBSC 03/152, 100 AU) with ⁇ SDL-L33 and ⁇ SDL-P33 were investigated. Serial dilutions (1:20 followed by 1:2) of both standards were made and binding to CaM-tagged ⁇ SDL was detected as above.
  • WHO World Health Organization
  • NIBSC 93/710 National Institute for Biological Standards and Control- NIBSC; Potters Bar, UK
  • the WHO proposed anti-HPA-la standard NIBSC 03/152, 100 AU
  • HPA-Ia and HPA-Ib human polyclonal samples Human polyclonal HPA-I samples (132 HPA-Ia and 6 HPA-Ib) were obtained from the Platelet Immunology Reference Laboratory (PIRL) at NBS, Cambridge UK. The HPA-Ia antibodies had been referred to the PIRL, Cambridge and were all positive by MAIPA. The HPA-Ia positive samples (diluted 1:20) were screened for reactivity against all four GPIIIa-Leu33 fragments and the GPIIIa ⁇ SDLPro33 fragments by ELISA. Similarly, 5 HPA-Ib positive samples from platelet refractory cases were screened for reactivity with all four GPIIIa-Pro33 fragments and the GPIIIa ⁇ SDL-Leu33 fragment.
  • GPIIIa ⁇ SDL transformants GPIIIa ⁇ SDL-P33 was generated by site-directed mutagenesis from the GPIIIa ⁇ SDL-L33/pEF-His-puro plasmid. After transfection of CHO Lee 3.2.8.1 cells with the pEFl-His-puro plasmids, cells were selected for puromycin resistance over a period of 14 days to isolate stable transfectants . The puromycin-resistant cells were screened for expression of GPIIIa ⁇ SDL by ELISA with the GPIIIa specific mouse MoAbY2/51 and positive clones were expanded and their protein expression level analysed.
  • HPA-Ia antiserum was from a NAIT referral
  • HPA-Ib antiserum from a PTP patient
  • inert control from a non-transfused group AB male donor.
  • GPIIIa ⁇ SDL-L33 expressed in mammalian cells carries the HPA-Ia epitope
  • 8 GPIIIa recombinant gene fragments were cloned in the Drosophila S2 expression vector pMT and recombinant calmodulin tagged protein expressed in the Drosophila Schneider's S2 cells. Both the PSIA13 and the PSIHyb forms were cloned as Ncol/Notl fragments.
  • GPIIIa ⁇ A and GPIIIa ⁇ SDL were cloned as BsmBl fragments into Ncol/Notl digested pMT-CaM as both Ncol and Notl restriction sites are contained with the GPIIIa gene insert .
  • a serine residue (residue 109A) was inserted at the carboxy-terminus of residue 109 to fuse the ⁇ -pleated sheets of the two parts of the hybrid domain.
  • the protein was truncated at residue 437 leaving the long-range disulfide bridge between cysteine 13 in the PSI domain and cysteine 435 intact.
  • rGPIIIa proteins were purified using a NHS-activated column and several 1 ml fractions were collected and analysed by SDS-PAGE and typically, rGPIIIa was eluted in fractions 3 to 5. Protein quantification by BCA assay confirmed yields of 10 mg/L for PSIA13-L33, 15 mg/L for PSIHyb-P33 and 14 mg/L for GPIIIa ⁇ A-L33 , 14 mg/L for GPIIIa ⁇ SDL-L33 and 5 mg/L for GPIIIa ⁇ SDL-P33.
  • the recombinant CaM-tagged GPIIIa fragments were screened for reactivity with a panel of 18 human polyclonal HPA-Ia samples from NAIT referrals using the calmodulin-based ELISA. All the 18 samples did react with the two longest fragments ( ⁇ SDL and D ⁇ A) , albeit reactions were weak for some. Five samples also showed reboust reactivity with the two smallest fragments (PSI and PsiHyb) . The reactivity with the control antigen D1D2 and with GPIIIa ⁇ SDL-proline 33 was negligible, indicating the interactions between the HPA-Ia antibodies and the GPIIIa fragments were allele-specific .
  • CamTran007 only reacted with the two longest Leu33 fragments, ⁇ A and ⁇ SDL while the other two HPA-Ia antibodies 19-7 and 23-15 also reacted with the two shortest fragments, PSI-Hybrid and PSI.
  • the four GPIIIa-Leu33 and GPIIIa-Pro33- ⁇ SDL fragments and GPVI-D1D2 as irrelevant antigen were reacted with the 1 in 20 diluted samples from 132 NAIT cases with HPA-Ia antibodies and IgG binding determined by ELISA. All 132 samples contained HPA-Ia antibodies as determined by immunofluorescence and MAIPA at the time of referral and were confirmed again by MAIPA during this study.
  • the cut-off of the ELISA assay was determined by testing 40 inert samples. The average and 1 x S. D. of the absorbance values was 0.110 and 0.0085 respectively and a cut-off of 0.15 was chosen, resulting in a specificity of 90%. Four of 40 inert samples produced absorbances above the cut-off (0.1585, 0.1675, 0.1995, 0.1855) .
  • the 132 anti-HPA-la NAIT samples were categorised in four clinical groups: (a) 15 ICH (intracranial haemorrhage) cases with a platelet count ⁇ 20 x 109/L, (b) 49 with a platelet count ⁇ 20 x 109/L, (c) 35 with a platelet count > 20 x 109/L and (d) 33 cases with a history of severe HPA-Ia immunisation and who underwent antenatal treatment.
  • the potency of the samples ranged from 5-193 au/ml and there was no correlation between potency and severity of thrombocytopenia or risk of ICH (Ghevaert et al . , 2006).
  • the samples producing positive results with the two longer and the two shorter fragments may contain a mixture of Type I and II antibodies, whilst the 25% of samples only reactive with the two longer fragments contain Type II antibodies only.
  • a detailed analysis of the type of HPA-Ia antibodies showed no significant correlations with the clinical categories or the number of pregnancies, e.g. between primi- or multi-parous women. There was no correlation between the strength of reactivity on the two shorter fragments when compared with that on the two longer ones .

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Analytical Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

This invention relates to recombinant GPIIIa molecules that lack the ligand binding A domain and bind to HPA-1 antibodies in monomeric form. These GPIIIa molecules can be recombinantly expressed at high levels and may be useful, for example, in the detection of HPA-1 antibodies. Such detection may be useful, for example, in the diagnosis and therapy of HPA antibody disorders such as Neonatal Alloimmune Immune Thrombocytpenia (NAIT), Post Transfusion Purpura (PTP) and Platelet Refractoriness (PR).

Description

Detection of Human Platelet Antigen (HPA) Antibodies
This invention relates to the detection of Human Platelet Antigen (HPA) antibodies, in particular human alloantibodies reactive with integrin GPIIIa. Such detection may be useful, for example, in the diagnosis and therapy of HPA antibody disorders such as Neonatal Alloimmune Immune Thrombocytpenia (NAIT) , Post Transfusion Purpura (PTP) and Platelet Refractoriness (PR) .
Antibodies against Human Platelet Antigens (HPA) are involved in three clinical syndromes of Neonatal Alloimmune Immune Thrombocytpenia (NAIT) , Post Transfusion Purpura (PTP) and Platelet Refractoriness (PR) . In the Caucasoid population, HPA-Ia (previously known as ZwVPl*)1 on platelet glycoprotein GPIIIa (CD61, β3) is the clinically most important HPA antigen. The HPA-la/lb dimorphism is based on a thymidine (t) for cytosine (c) Single Nucleotide Polymorphism (SNP) at position 17S of the ITGB3 gene (NCBI SNP database entry rs5918, see http: //www.ncbi .nlm.nih.gov/entrez/query. fcgi?db=snp) , resulting in a leucine (HPA-Ia) to proline (HPA-Ib) substitution at position 33 of the mature protein2'3. The HPA-I system is the clinically most relevant HPA system. Alloantibody formation is generally against HPA-Ia. HPA-Ib antibodies are rare and are mainly observed in polytransfused patients and occasionally observed in pregnancy. Approximately 2-2.5% of Caucasoids are HPA-lblb. In pregnancy HPA- lblb women (HPA-Ia negative) are at high risk (with a 1 in 3 chance) of forming HPA-Ia antibodies if HLA DRB3*0101 positive. HPA-Ia antibody formation in HLA DRB3*0101 negative pregnant women is very rare (odds ratio of -150 when compared with HLA DRB3*0101 postive women) .
Several prospective screening studies in pregnant women have shown that 1 in 365 (1 in 9 of the HPA-lblb ones) women form HPA-Ia antibodies and severe thrombocytopenia in the fetus/neonate occurs in 1 in 1200 cases4"6. Intra-cerebral haemorrhage (ICH) and other major bleeds only present in a small subset of cases with severe thrombocytopenia. There are currently no reliable laboratory tests to predict the risk of severe thrombocytopenia and of severe bleeding in fetuses/ neonates born to mothers with HPA-Ia alloantibodies . The precise incidence of severe thrombocytopenia with ICH is not known but it is thought to be as high as 1 in 10 -20 000 term pregnancies (30-60 cases per annum in the UK) . ICH occurs during or after delivery but may also occur in utero as early as 20- 24 weeks of gestation7'8. The availability of a simple diagnostic test which could differentiate with good sensitivity and reasonable specificity between HPA-Ia antibodies which cause severe bleeding and possible ICH and the less harmful HPA-Ia antibodies would be of great clinical value.
Currently, there is no routine antenatal screening for HPA-Ia antibodies because cases at risk of severe bleeding and/or ICH cannot be reliably identified within the group of women with HPA-Ia antibodies. Therefore, investigations are generally only carried out in response to a clinical referral from a neonate with an isolated and low platelet count, if there is a history of HPA-Ia alloimmunisation or if a low platelet count in the neonate has been identified coincidentally because a full blood count was performed.
Detection of HPA antibodies is based on solid phase based antigen- capture assays like the Monoclonal Antibody Immobilisation of
Platelet Antigens (MAIPA) assay, the indirect Platelet Suspension Immunofluorescence Test (PSIFT, either read by microscopy or by FACS) or commercial ELISA kits in which the wells of the ELISA plates are coated with platelet membrane glycoprotein complexes obtained from human HPA typed platelets (e.g. GTI-Pakl2, GTI,
Milwaukee, WI, USA) . These methods are widely used, but have major drawbacks. The MAIPA is cumbersome and time-consuming and requires panels of HPA genotyped donor platelets . The PSIFT is laborious and not specific (HLA antibodies also produce positive results) . GTI-Pak has a slightly lower sensitivity than either MAIPA or PSIFT. Several groups have been attempting to develop recombinant or synthetic molecular probes that can be used for the sensitive and specific detection of HPA antibodies in general and HPA-I antibodies in particular. The latter studies have been hampered by the complexity of the integrin structure in general and of the HPA-I epitopes in particular. Many studies have tried to elucidate the exact nature of the HPA-I epitopes and the precise structural configuration of the HPA-I antibody binding sites, but success has been limited so far.
It has been shown that the tertiary structure of GPIIIa, and in particular that of the amino terminal domains, is critical for the binding of many HPA-I antibodies9 as HPA-I antibodies do not bind overlapping linear 13-mer polypeptides straddling residue 33 (Flug et al 1991; Blood 77 (9) : 1964-9) .
Some examples of HPA-I antibodies bind to a GPIIIa fragment consisting of the amino-terminal 66 amino acids, when recombinantIy expressed in Escherichia coli (Bowditch et al Blood. 1992 Feb 1;79 (3) : 559-62) , but this fragment is not adequate for HPA-I antibody detection as many examples of clinically relevant HPA-Ia antibodies do not bind. Further studies using site-directed mutagenesis of the amino terminal cysteines in GPIIIa have shown the importance of the long range disulfide bond between cysteine 5 (now remapped to cysteine 13) and 435, as the replacement of cysteine 435 by alanine was detrimental to the binding of so called category II type HPA-Ia antibodies (Valentin et al 1995 Jun 1; 85 (11) : 3028-33)
Although GPIIIa has been expressed as a soluble monomer by deleting the specificity-determining loop16, there is no indication that the HPA-I epitope is conserved in such monomers.
More recently, we have observed the importance of residue 93 in the GPIIIa hybrid domain for maintaining the integrity of the HPA-Ia epitope since the replacement of glutamine-93 by glycine resulted in the loss of binding of all three known examples of recombinant human HPA-Ia antibodies (Watkins et al Blood. 2002 Mar 1; 99 (5) :1833-9. ) . Finally, we have observed that even a minor modification of residue 33 from leucine to valine (which is the result of a very rare GPIIIa sequence haplotype) has a detrimental effect on the binding of our recombinant HPA-Ia antibody CamTranOO7 but not of two other recombinant human HPA-Ia antibodies, clones 19.7 and 23.15. Thus several studies have confirmed that for adequate HPA-I antibody binding GPIIIa residues outside the plexin-semaphorin-integrin (PSI) domain are critical.
The present inventors have recognised that recombinant GPIIIa molecules that lack the ligand binding βA domain bind to HPA-I antibodies in monomeric form and can be recombinantly expressed at high levels.
One aspect of the invention provides a GPIIIa polypeptide comprising an amino acid sequence which has at least 80% sequence identity or sequence similarity with the sequence of SEQ ID NO: 1 from residue 1 to at least residue 54.
Preferably, the GPIIIa polypeptide comprises an amino acid sequence which has at least 80% sequence identity or sequence similarity with the sequence of SEQ ID NO: 1 from residue 1 to at least residue 104, at least residue 192, at least residue 289, at least residue 322, at least residue 365, or residue 450.
Preferably, the GPIIIa polypeptide comprises an amino acid sequence which shares greater than 85%, greater than 90%, greater than 95% or greater than 98% sequence identity or sequence similarity with such a sequence .
For example, the polypeptide may have a sequence with one or more of addition, insertion, deletion or substitution of one or more amino acids from the corresponding sequence in SEQ ID NO: 1. For example, up to about 5, 10, 15, 20, 30 or 40 amino acids may be altered. Such alterations may be caused by one or more of addition, insertion, deletion or substitution of one or more nucleotides in the encoding nucleic acid.
Sequence similarity and identity are commonly defined with reference to the algorithm GAP (Wisconsin GCG package, Accelerys Inc, San Diego USA) . GAP uses the Needleman and Wunsch algorithm to align two complete sequences that maximizes the number of matches and minimizes the number of gaps. Generally, default parameters are used, with a gap creation penalty = 12 and gap extension penalty = 4. Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. MoI. Biol. 215: 405-410), FASTA (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Waterman (1981) J. MoI Biol. 147: 195-197), or the TBLASTN program, of Altschul et al. (1990) supra, generally employing default parameters. In particular, the psi-Blast algorithm (Nucl . Acids Res. (1997) 25 3389-3402) may be used. Sequence identity and similarity may also be determined using Genomequest™ software (Gene-IT, Worcester MA USA) .
Sequence comparisons are preferably made over the entire length of the relevant sequence described herein.
Similarity allows for "conservative variation", i.e. substitution of one hydrophobic residue such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as arginine for lysine, glutamic for aspartic acid, or glutamine for asparagine. Similarity matrices such as the PAM 250 or Blosum 45 are commonly used in the art to determine similarity and conservative variation. In some preferred embodiments, the GPIIIa polypeptide may comprise the amino acid sequence of SEQ ID NO: 1 from residue 1 to at least residue 54, at least residue 108, at least residue 192, at least residue 289, at least residue 322, at least residue 365 or residue 450 For example, the GPIIIa polypeptide may comprise residues 1 to 54 of SEQ ID NO: 1, residues 1 to 108 of SEQ ID NO: 1, residues 1 to 192 of SEQ ID NO: 1, residues 1 to 289 of SEQ ID NO: 1, residues 1 to 322 of SEQ ID NO: 1, residues 1 to 365 of SEQ ID NO: 1 or most preferably, the entire sequence of SEQ ID NO: 1 (residues 1 to 450).
A GPIIIa polypeptide as described herein binds HPA-I antibodies. HPA-I antibodies bind to a conformational epitope of GPIIIa which comprises the PSI domain. HPA-I antibodies may be specific for the allele of GPIIIa which has leucine (L) at position 33 in the mature GPIIIa sequence (HPA-Ia) or the allele of GPIIIa which has proline (P) at position 33 (HPA-Ib) . The amino acid sequence of GPIIIa has the database entry P05106 (P5106.1 GI: 124968) .
A GPIIIa polypeptide as described herein may have a leucine (L) at residue 33 and may bind preferentially to HPA-Ia antibodies relative to HPA-Ib antibodies. Preferably, such a GPIIIa polypeptide binds specifically to HPA-Ia antibodies i.e. it binds to HPA-Ia antibodies but shows no binding or substantially no binding to HPA-Ib antibodies .
In other embodiments, the GPIIIa polypeptide may have a proline (P) at residue 33 and may bind preferentially to HPA-Ib antibodies relative to HPA-Ia antibodies. Preferably, the GPIIIa polypeptide specifically binds to HPA-Ib antibodies i.e. it binds to HPA-Ib antibodies but shows no binding or substantially no binding to HPA- Ia antibodies.
A GPIIIa polypeptide as described herein may also bind other HPA antibodies. For example, a GPIIIa polypeptide in which Arginine 62 is replaced by Glutamine may be used to bind HPA-lObw antibodies, a GPIIIa polypeptide in which Proline 166 of SEQ ID NO: 1 (P407 of wild-type GPIIIa) is replaced by Alanine may be used to bind HPA-7bw antibodies, a GPIIIa polypeptide in which Arginine 248 of SEQ ID N0:l (R489 of wild-type GPIIIa) is replaced by Glutamine may be used to detect for HPA-6bw antibodies, a GPIIIa polypeptide in which Arginine 392 of SEQ ID NO: 1 (R633 of wild-type GPIIIa) is replaced by histidine may be used to detect HPA-llbw antibodies, a GPIIIa polypeptide in which Lysine 370 of SEQ ID NO: 1 (K611 of wild-type GPIIIa) is deleted may be used to detect HPA-14bw antibodies and a GPIIIa polypeptide in which Arginine 395 of SEQ ID NO: 1 (R636 of wild-type GPIIIa) is replaced by Cysteine may be used to detect HPA- 8bw antibodies (for source data, see the EMBL EBI IPD-HPA database; www. ebi . ac .uk/ipd/hpa) .
In some embodiments, a GPIIIa polypeptide may comprise two or more substitutions or deletions as set out above in order to bind to more than one type of HPA antibody.
In some embodiments, one or more heterologous amino acids may be joined or fused to a polypeptide set out herein and a polypeptide may comprise a polypeptide sequence as described above linked or fused to one or more heterologous amino acids .
One or more heterologous amino acids may include non-GPIIIa amino acid sequences .
A GPIIIa polypeptide may comprise a tag, which may, for example, be an affinity tag which is useful for purification. An affinity tag is a heterologous polypeptide sequence which forms one member of a specific binding pair. For example, the tag sequence may form an epitope which is bound by an antibody molecule. Polypeptides comprising the tag may be purified though binding to the other member of the specific binding pair, which may be immobilised, for example on an affinity column. Suitable affinity tags include for example, glutathione-S- transferase, (GST) , calmodulin, maltose binding domain (MBD) , MRGS(H)6, DYKDDDDK (FLAG™), T7-, S- (KETAAAKFERQHMDS) , poly-Arg (R5. e) , poly-His (H2-10), poly-Cys (C4) poly-Phe (F11) poly-Asp (D5-16) , Strept-tag II (WSHPQFEK) , c-myc (EQKLISEEDL) , Influenza-HA tag
(Murray, P. J. et al (1995) Anal Biochem 229, 170-9), Glu-Glu-Phe tag (Stammers, D. K. et al (1991) FEBS Lett 283, 298-302), Tag.100
(Qiagen,- 12 aa tag derived from mammalian MAP kinase 2) , Cruz tag 09™ (MKAEFRRQESDR, Santa Cruz Biotechnology Inc.) and Cruz tag 22™ (MRDALDRLDRLA, Santa Cruz Biotechnology Inc.). Known tag sequences are reviewed in Terpe (2003) Appl . Microbiol. Biotechnol. 60 523- 533.
In preferred embodiments, a calmodulin tag may be used. The sequence of calmodulin has the database accession number BC072232.1 GI:47937654.
In some embodiments, it may be desirable to remove the affinity tag after purification. The GPIIIa polypeptide may, for example, comprise one or more protease recognition sites. A protease recognition site may, for example, be positioned between the GPIIIa sequence and the affinity tag such that contacting the polypeptide with a site-specific protease cleaves the polypeptide at the recognition site to release the GPIIIa sequence from the tag.
Various suitable protease recognition sites are known in the art, including Factor Xa, thrombin, rennin, TEV protease and enterokinase recognition sites. In some preferred embodiments, the protease recognition site is a tobacco etch virus (TEV) protease recognition site have the sequence Glu-X-X-Tyr-X-Gln/Ser . Other suitable protease recognition sites are described in Richter et al J. Biol. Chem. (2002) 277: 43888-43894.
In some embodiments, the GPIIIa polypeptide may be coupled to an appropriate signal leader peptide to direct secretion of the GPIIIa polypeptide from cell into the culture medium. The signal leader sequence may be removed following expression to produce the mature GPIIIa polypeptide. A range of suitable signal leader peptides are known in the art .
For some applications, the GPIIIa polypeptide may be immobilised, for example, by attachment to an insoluble support. The support may be in particulate or solid form and may include a plate, test tube, bead, ball, filter or membrane. A polypeptide may, for example, be fixed to an insoluble support that is suitable for use in affinity chromatography. Methods for fixing polypeptides to insoluble supports are known to those skilled in the art .
The invention also encompasses nucleic acids, vectors and cells which are suitable for use in methods of producing a GPIIIa polypeptide, as described above.
Accordingly, a nucleic acid may comprise a nucleic acid sequence which encodes a GPIIIa polypeptide as described above. A suitable sequence may comprise the nucleic acid sequence of SEQ ID NO: 2 or a fragment of SEQ ID NO: 2 from base 1 to at least base 162, at least base 324, at least base 576, at least base 867, at least base 966 or at least base 1095, or a variant of any of these.
A nucleic acid sequence which is a variant of a nucleic acid sequence from SEQ ID NO: 2 as described above may share greater than 60% sequence identity, greater than 65%, greater than 70%, greater than about 80%, greater than 90% or greater than 95% with the nucleic acid sequence from SEQ ID NO: 2.
A variant may have one or more of addition, insertion, deletion or substitution of one or more nucleotides in the sequence of a nucleic acid sequence from SEQ ID NO: 2. Up to 10, 20, 30, 50 or 100 nucleotides may be added, inserted, deleted or substituted as described. The nucleotide sequence encoding the GPIIIa polypeptide may be operably linked to a heterologous regulatory sequence. Suitable regulatory sequences to drive the expression of heterologous nucleic acid coding sequences in expression systems are well known in the art.
A heterologous regulatory sequence may be an inducible promoter.
Such a promoter may induce expression in response to a stimulus . This allows control of expression, for example, to allow optimal cell growth before recombinant polypeptide production is induced.
Many examples of inducible promoters are known to those skilled in the art, including the Drosophila metallothionein (MT) promoter, which is inducible with copper sulphate (CuSO4) .
The heterologous regulatory sequence may be activated by a heterologous transcription factor, such as GAL4 or T7 polymerase.
For example, a GAL4 transcription factor may be expressed using an inducible promoter and may drive expression of a coding sequence which is operably linked to the GAL4 promoter. In other embodiments, T7 polymerase may be expressed using an inducible promoter and may drive expression of a coding sequence which is operably linked to a T7 promoter.
The term "heterologous" indicates that the gene/sequence of nucleotides in question or a sequence regulating the gene/sequence in question, is a recombinant sequence which has been introduced into a construct, vector or cell, artificially, using genetic engineering or recombinant means, i.e. by human intervention. Heterologous nucleotide sequences are sequences which do not naturally occur together in nature. Nucleotide sequences which are heterologous to a cell may be non-naturally occurring in cells of that type, variety or species (i.e. exogenous or foreign) or may be sequences which are non-naturally occurring in that sub-cellular or genomic environment of the cells or may be sequences which are non- naturally regulated in the cells i.e. operably linked to a non- natural regulatory element .
Nucleic acid sequences and constructs as described above may be comprised within a vector. Those skilled in the art are well able to construct vectors and design protocols for recombinant gene expression, for example in a microbial or host cell. Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate. A vector may comprise a selectable marker to facilitate selection of the transgenes under an appropriate promoter. For further details see, for example, Molecular Cloning: a Laboratory Manual: 3rd edition, Sambrook & Russell , 2001, Cold Spring Harbor Laboratory Press.
Many known techniques and protocols for manipulation of nucleic acid, for example in preparation of nucleic acid constructs, mutagenesis, sequencing, introduction of DNA into cells and gene expression, and analysis of proteins, are described in detail in
Protocols in Molecular Biology, Second Edition, Ausubel et al . eds. John Wiley & Sons, 1992.
A nucleic acid construct or vector may be introduced into a host cell.
When introducing or incorporating a nucleic acid construct into a cell, certain considerations must be taken into account, well known to those skilled in the art. The nucleic acid to be inserted should be assembled within a construct or vector which contains effective regulatory elements which will drive transcription. There must be available a method of transporting the constructor vector into the cell. For eukaryotic cells, suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome- mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, baσulovirus . For bacterial cells, suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage .
The particular choice of a transformation technology will be determined by its efficiency to transform the particular host cells employed as well as the experience and preference of the operator with a particular methodology of choice.
Marker genes such as antibiotic resistance or sensitivity genes may be used in identifying cells containing the nucleic acid of interest, as is well known in the art.
A method of producing a GPIIIa polypeptide as described herein may comprise; introducing a nucleic acid encoding a GPIIIa polypeptide as described above into a host cell, and; expressing said nucleic acid to produce the GPIIIa polypeptide.
Nucleic acid may be expressed by culturing the host cells (which may include cells actually transformed, although more likely the cells will be descendants of the transformed cells) under conditions for expression of the nucleic acid, so that the encoded GPIIIa polypeptide is produced.
The GPIIIa polypeptide may be isolated and/or purified from the host cell.
In some embodiments, the GPIIIa polypeptide may be purified using an affinity tag, which may, optionally, be removed after purification, for example using a specific protease. Further aspects of the invention provide a host cell comprising a vector or nucleic acid construct as described herein, and a method of producing a host cell as described herein may comprise introducing a nucleic acid as described herein into the host cell.
A host cell may contain a nucleic acid sequence encoding a GPIIIa polypeptide as a result of the introduction of the nucleic acid sequence into an ancestor cell.
A range of host cells suitable for the production of GPIIIa polypeptides are known in the art. Suitable host cells may include prokaryotic cells, in particular bacteria such as E. coli, and eukaryotic cells, including mammalian cells such as CHO and CHO- derived cell lines (Lee cells) , HeLa, COS, and HEK293 cells, amphibian cells such as Xenopus oocytes, insect cells such as Trichoplusia ni, S2, Sf9 and Sf21 and yeast cells.
Other aspects of the invention relate to the detection of HPA antibodies using the GPIIIa polypeptides described herein.
A method of detecting an HPA antibody in a sample obtained from an individual may comprise: determining the binding of one or more antibodies in the sample to a GPIIIa polypeptide as described herein, wherein the binding of one or more antibodies to the polypeptide is indicative of the presence of an HPA antibody in the sample .
The presence of an HPA antibody in a sample obtained from an individual may be indicative that the individual has a condition associated with HPA antibodies, such as Neonatal Alloimmune Immune Thrombocytpenia (NAIT) , Post Transfusion Purpura (PTP) or Platelet Refractoriness (PR) or is a blood donor. The sample may be a blood, serum or plasma sample. In some embodiments, the sample may be obtained from a pregnant female.
An HPA antibody is an alloantibody which is reactive in vivo with a human platelet antigen (HPA) . In preferred embodiments, the HPA antibody may be an HPA-I antibody, for example an HPA-Ia, an HPA-Ib antibody or an HPA antibody against another HPA which is located on the GPIIIa polypeptide outside the βA domain, such as HPA-6w, HPA- 7w, HPA-8w, HPA-IOw, HPA-Hw or HPA-14bw.
For example, a GPIIIa polypeptide that has a leucine (L) residue at position 33 may specifically bind to HPA-Ia antibodies. A method of detecting HPA-Ia antibodies in a sample obtained from an individual may comprise: determining the binding of one or more antibodies in the sample to a GPIIIa polypeptide comprising L at residue 33 as described herein, wherein binding to the GPIIIa polypeptide is indicative of the presence of HPA-Ia antibodies in the sample.
The presence of one or more antibodies which bind to an L33 GPIIIa polypeptide which lacks EGF domains, for example a polypeptide consisting of the sequence of residues 1 to 54 of SEQ ID NO: 1 (e.g. GPIIIaPSI-A13L33) or the sequence of residues 1 to 192 of SEQ ID NO: 1 (e.g. GPIIIaPSIHyb-L33) may be indicative of an increased risk of severe bleeding and/or an increased risk of cerebral bleeds in the individual .
The presence of one or more antibodies which bind to an L33 GPIIIa polypeptide which comprises EGF domains, for example GPIIIa-ΔβA- L33 (residues 1 to 450 of SEQ ID N0:l) but do not bind to L33 GPIIIa polypeptides which lack EGF domains, may be indicative of HPA-Ia antibodies which are not associated with a increased risk of severe bleeding or cerebral bleeding. A method of detecting HPA-Ia antibodies in a sample obtained from an individual may comprise : determining the binding of one or more antibodies in the sample to a first GPIIIa polypeptide comprising L at residue 33 and a second GPIIIa polypeptide comprising L at residue 33, wherein the first GPIIIa polypeptide does not comprise EGF domains and the second first GPIIIa polypeptide comprises EGF domains, wherein binding to the first GPIIIa polypeptide but not the second GPIIIa polypeptide is indicative of an increased risk of severe bleeding and/or cerebral bleeds in the individual.
Suitable first GPIIIa polypeptides may include polypeptides consisting of residues 1 to 54 or residues 1 to 192 of SEQ ID NO:1 as described herein (e.g. GPIIIaPSI-A13L33 or GPIIIaPSIHyb-L33) .
Suitable second GPIIIa polypeptides may include peptides consisting of residues 1 to 450 of SEQ ID N0:l as described herein (e.g. GPIIIa-ΔβA-L33) .
Another aspect of the invention provides a set of polypeptides comprising a first GPIIIa polypeptide and a second GPIIIa polypeptide as described above. For example, a set of polypeptides may comprise a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-54 of SEQ ID N0:l, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-192 of SEQ ID NO:1, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-289 of SEQ ID NO:1, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-322 of SEQ ID NO:1, a GPIIIa polypeptide having an amino acid sequence which shows at least 80% sequence identity with residues 1-365 of SEQ ID NO:1 and/or a GPIIIa polypeptide having the sequence of SEQ ID N0:l. A GPIIIa polypeptide that has a proline (P) residue at position 33 may specifically bind to HPA-Ib antibodies. A method of detecting HPA-Ib antibodies in a sample obtained from an individual may comprise : determining the binding of one or more antibodies in the sample to a GPIIIa polypeptide comprising P at residue 33 as described herein, wherein binding to the GPIIIa polypeptide is indicative of the presence of HPA-Ib antibodies in the sample.
Methods of detecting HPA antibodies as described above may be carried out in any convenient format. Immunological assays are well- known in the art and many suitable formats are available, for example ELISA, Western blotting, mirror resonance (e.g. Biacore®, (Biacore, Upsala, Sweden) , evanescence (DiaMed AG, Cressier sur Morat, Switzerland) or Luminex beads (Luminex® system, Austin, TX, USA) .
In some preferred embodiments, a sandwich assay format may be employed.
In some embodiments, a sandwich assay may employ an immobilised GPIIIa polypeptide to bind HPA antibodies in the sample and an antibody-binding molecule to detect the presence of antibodies which are bound to the polypeptide.
In other embodiments, a sandwich assay may employ an immobilised antibody-binding molecule to bind antibodies in the sample and a GPIIIa polypeptide as described herein to detect the presence of HPA antibodies bound to the immobilised antibody-binding molecule.
In other embodiments, a competition assay may employ an recombinant HPA-Ia antibody-binding molecule (e.g. CamTranOO7 or any other suitable recombinant antibody with HPA-Ia specificity) to bind the GPIIIa polypeptide with L at position 33 as described herein and the inhibition of binding of the GPIIIa-L33 polypetide to the recombinant HPA-Ia antibody by polyclonal HPA-Ia antibodies present in a serum, plasma or blood sample.
Suitable antibody-binding molecules for use in such methods may include immunoglobulin-binding antibodies, for example anti-human Ig antibodies, anti-human Ig antibodies, anti-human antibodies specific for Ig isotypes or for subclasses of IgG, Staphylococcal protein A and Staphylococcal protein G.
The non-immobilised antibody-binding molecule or polypeptide may comprise a detectable label as described above. Linkage of detectable labels to an antibody-binding molecule or polypeptide may be direct or indirect, covalent, e.g. via a polypeptide bond, or non-covalent . Linkage via a polypeptide bond may be as a result of recombinant expression of a gene fusion encoding specifc binding member (e.g. antibody) and label molecule. Linkage via a non- covalent bond may be a result of a binding between a biotinylated antibody and a streptavidin/avidin linked label molecule.
Labels include fluorochromes such as fluorescein, rhodamine, phycoerythrin, Europium and Texas Red, chromogenic dyes such as diaminobenzidine, radioisotopes, macromolecular colloidal particles or particulate material such as latex beads that are coloured, magnetic or paramagnetic, binding agents such as biotin and digoxigenin, and biologically or chemically active agents that can directly or indirectly cause detectable signals to be visually observed, electronically detected or otherwise recorded, for example in a FACS, ELISA, Western blot, TRFIA, immunohistochemistry, evanescence, Luminex bead array, or dipstick or other lateral flow assay format .
Biologically or chemically active agents include enzymes, which catalyse reactions that develop or change colours or cause changes in electrical properties, for example. They may be molecularly excitable, such that electronic transitions between energy states result in characteristic spectral absorptions or emissions. They may include chemical entities used in conjunction with biosensors. Biotin/avidin or biotin/streptavidin and alkaline phosphatase detection systems may be employed. Further examples include horseradish peroxidase and chemiluminescence
In some embodiments, the non-immobilised antibody-binding molecule or polypeptide may be detected using an antibody which binds to said non-immobilised antibody-binding molecule or polypeptide. A suitable detection antibody may be labelled.
Other aspects of the invention relate to the provision of kits for detecting HPA antibodies .
A GPIIIa polypeptide as described above may form part of a kit for detecting or diagnosing HPA antibodies e.g. in a suitable container such as a vial in which the contents are protected from the external environment
A kit for detecting an HPA antibody in a sample may comprise: a GPIIIa polypeptide as described above, and; one or more detection reagents for determining binding of one or more antibodies in a sample to the GPIIIa polypeptide.
The GPIIIa polypeptide may be free in solution or may be immobilised on a solid support, such as a magnetic bead, tube or microplate well .
In some embodiments, the kit may further comprise an antibody- binding molecule. Suitable antibody-binding molecules include Staphylococcal protein A, Staphylococcal protein G and antibodies that bind to immunoglobulins, such as IgG7 in particular human immunoglobulins . The antibody-binding molecule may be a capture or detection reagent and may be free in solution or may be immobilised on a solid support, such as a magnetic bead, tube or microplate well.
The antibody-binding molecule or polypeptide may be labelled with a detectable label, for example a fluorescent or chromogenic label or a binding moiety such as biotin. Suitable labels are described in more detail above.
The detection reagents may further comprise a substrate, for example a chromogenic, fluorescent or chemiluminescent substrate, which reacts with the label, or with molecules, such as enzyme conjugates, which bind to the label, to produce a signal. The detection reagents may further comprise buffer solutions, wash solutions etc.
The kit may also comprise one or both of: apparatus for handling and/or storing the sample obtained from the individual; and, apparatus for obtaining the sample from the individual . This may include, for example, a needle or lancet.
The kit may also include instructions for use of the GPIIIa polypeptide, e.g. in a method of detecting a HPA antibodies in a test sample, as described herein.
Other aspects of the invention relate to the identification of specific binding members and antibody antigen-binding domains which bind to GPIIIa, and may therefore be useful in therapeutic and diagnostic methods HPA-Ia and HPA-Ib specific recombinant antibodies may be used for HPA-Ia and HPA-Ib phenotyping of individuals. Antibodies which bind GPIIIa may be used therapeutically, e.g. to prevent binding of fibrinogen or other extracellular matrix proteins to GPIIIa or to ameliorate the binding of harmful viruses to the PSI domain of GPIIIa (e.g. Hanta virus) A method of producing an antibody which binds GPIIIa may comprise: administering an immunogen comprising a GPIIIa polypeptide as described herein to an animal, and; isolating from said animal an antibody which binds to said polypeptide.
The immunogen may comprise a protein carrier, such as Keyhole Limpet Haemocyanin. Other suitable carriers are well known in the art.
Antibodies may be obtained from immunised animals using any of a variety of techniques known in the art, and screened, preferably using binding of antibody to antigen of interest. For instance, Western blotting techniques or immunoprecipitation may be used (Armitage et al . (1992) Nature 357 80-82).
More preferably, an antibody molecule may be a monoclonal antibody. Methods of producing monoclonal antibodies are well known in the art (see, for example, Harlow et al Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory (Cold Spring Harbor, NY, 1988) pp. 353-355) and are described in more detail below. For example, antibody-producing cells may be isolated from an immunised mammal and fused with immortalised cells to produce a population of antibody-producing hybridoma cells, which can then be screened to identify a hybridoma cell that produces an antibody which displays optimal binding characteristics.
In some embodiments, a hybridoma may be produced by a method comprising; immunising a non-human mammal with an immunogen comprising a GPIIIa polypeptide as described above, producing one or more fusions of antibody producing cells from said mammal and immortalised cells to provide a population of hybridoma cells, and; screening said population to identify a hybridoma cell which produces an antibody which binds the GPIIIa polypeptide. The population of hybridoma cells is preferably screened by testing the binding of antibodies produced by cells of the population to one or more GPIIIa polypeptides as described herein. In some embodiments, the relative binding of antibodies to GPIIIa polypeptides with L at position 33 relative to GPIIIa polypeptides with P at position 33 may be determined. Conventional techniques such as western blotting or immunoprecipitation may be used.
Hybridoma cells identified as producing antibodies which bind to the GPIIIa polypeptide may be isolated and/or purified from the population.
Following isolation, the hybridoma may be expanded, maintained and/or cultured in a culture medium using methods which are well- known in the art . Antibodies produced by the hybridoma may be isolated from said culture medium. A method of producing an antibody may comprise; culturing a hybridoma cell produced as described above in a culture medium,- and, isolating from the medium an antibody as described above, for example, an antibody which binds to the GPIIIa polypeptide.
Alternatively, a monoclonal antibody specific for a GPIIIa polypeptide may be obtained from a recombinantly produced library of expressed immunoglobulin variable domains or other molecules comprising antibody antigen-binding domains, e.g. using lambda bacteriophage or filamentous bacteriophage which display functional immunoglobulin binding domains on their surfaces; for instance see WO92/01047. The library may be immunologically naive, that is constructed from sequences obtained from an organism which has not been immunised with a polypeptide comprising the epitope, or may be one constructed using sequences obtained from an organism which has been exposed to the antigen of interest. A method of producing an anti-GPIIIa binding member comprising: contacting a GPIIIa polypeptide as described above with a diverse population of antibody antigen-binding domains, and; determining the binding of members of said population to said polypeptide.
The antibody antigen-binding domains may be comprised in antibodies or scFv, Fab, Fv, dAb, Fd or diabody molecules
An antibody antigen-binding domain may be identified in said population which binds to the GPIIIa polypeptide. In some embodiments, an antibody antigen-binding domain may be identified in said population which binds to GPIIIa polypeptides comprising leucine at position 33 but does not bind to GPIIIa polypeptides comprising proline at position 33 or which binds to GPIIIa polypeptides comprising proline at position 33 but does not bind to GPIIIa polypeptides comprising leucine at position 33.
Antibody antigen-binding domains may be displayed on the surface of virus particles i.e. the diverse population may be a phage display library.
The virus particle which displays the identified antibody antigen- binding domain may be isolated and/or purified and the nucleic acid encoding the antibody antigen-binding domain obtained from said particle.
The nucleic acid encoding the antibody antigen-binding domain may be sequenced and/or expressed to produce the encoded antibody antigen- binding domain that binds to the GPIIIa polypeptide.
An antibody antigen-binding domain produced as described above may be further tested using routine methodology to determine its specificity e.g. to determine whether it binds specifically to GPIIIa polypeptide with L or P at position 33. In some embodiments, the binding properties of the antibody antigen- binding domain may be further optimised using standard antibody engineering techniques, including affinity maturation, for example by chain shuffling, and site-specific, random or combinatorial mutagenesis .
An antibody antigen-binding domain which is comprised in an antibody or antibody molecule, for example an scFv, Fab, Fv, dAb, Fd or diabody molecule, may be reformatted, for example into an IgG antibody, using standard techniques for subsequent use, for example in a method of HPA phenotyping .
Antibodies, specific binding members and antibody antigen-binding domains which bind GPIIIa polypeptides as described herein may be useful methods of HPA-I phenotyping. For example, in some embodiments, a method of HPA-I typing an individual may comprise; contacting a specific binding member comprising an antibody antigen-binding domain which specifically binds to GPIIIa polypeptides comprising leucine at position 33, for example an antibody antigen-binding domain identified as described herewith, with a sample of platelets obtained from an individual, and; determining the binding of the specific binding member to platelets in the sample.
Binding may be indicative that the individual is an HPA-Ia homo- or heterozygote . Absence of binding may be indicative that the individual is HPA-Ia negative.
In other embodiments, a method of HPA-I typing an individual may comprise; contacting a specific binding member comprising an antibody antigen-binding domain which specifically binds to GPIIIa polypeptides comprising proline at position 33, for example an antibody antigen-binding domain identified as described herewith, with a sample of platelets obtained from an individual, and; determining the binding of the specific binding member to platelets in the sample.
Binding may be indicative that the individual is an HPA-Ib homo- or heterozygote . Absence of binding may be indicative that the individual is HPA-Ib negative.
A suitable sample may be any platelet-containing sample, for example a blood sample or a fraction or extract thereof.
GPIIIa polypeptides as described herein may also be useful in the treatment of blood to remove harmful HPA-I antibodies.
A method of removing or depleting HPA-I antibodies from a sample may- comprise : contacting a sample with an immobilised GPIIIa polypeptide as described herein, wherein HPA-I antibodies in said sample bind to the polypeptide, and; separating the sample from the polypeptide, such that HPA-I antibodies are removed from the sample.
The sample may be a blood, serum or plasma sample.
The sample may, for example, be a blood or plasma sample obtained from an individual with HPA-Ia antibodies.
The GPIIIa polypeptide may be immobilised on a column or other solid phase. The blood or plasma sample may be brought in contact with the
GPIIIa polypeptide, for example by passing the sample over the solid phase, thereby allowing binding of polyclonal HPA-Ia antibodies to the polypeptide, to remove completely or reduce the concentration of HPA-Ia antibodies in the blood (apheresis) . Apheresis procedures are routinely used in the art to obtain plasma from donors or to remove plasma containing harmful antibodies from a patient.
GPIIIa polypeptides as described herein may also be useful in the identification of therapeutic compounds.
A method of identifying a compound useful in the treatment of a GPIIIa mediated condition comprising; contacting a GPIIIa polypeptide as described herein with a test compound, and; determining binding of the polypeptide with test compound.
The presence of binding is indicative that the compound is useful in the treatment of a GPIIIa mediated condition.
GPIIIa mediated conditions include viral infections, such as Hantavirus infection, and atherothrombosis.
A compound may, for example, inhibit the binding of Hantavirus to the PSI domain of GPIIIa or reduce the homotypic interaction between platelets or the heterotypic interaction between platelets and the endothelial cells lining the blood vessel wall, by inhibiting the interaction between glycoprotein HbIIIa and fibrinogen or other extracellular matrix or blood proteins important to atherothrombosis .
Compounds which may be screened using the methods described herein may be natural or synthetic chemical compounds used in drug screening programmes. Extracts of plants, microbes or other organisms which contain several characterised or uncharacterised components may also be used.
Combinatorial library technology provides an efficient way of testing a potentially vast number of different compounds for ability to modulate an interaction. Such libraries and their use are known in the art, for all manner of natural products, small molecules and peptides, among others. The use of peptide libraries may be preferred in certain circumstances.
The amount of test compound or compound which may be added to a method of the invention will normally be determined by trial and error depending upon the type of compound used. Typically, from about 0.001 nM to 1 mM or more of test compound may be used, for example from 0.01 nM to 100μM, e.g. 0.1 to 50 μM, such as about 10 μM.
A method may comprise identifying the test compound as a compound which binds GPIIIa. Such a compound may, for example be useful in the treatment of a GPIIIa-mediated condition.
A test compound identified using one or more initial screens as having ability to bind a GPIIIa polypeptide may be assessed further using one or more secondary screens. A secondary screen may, for example, involve testing for a biological function such as the inhibition of viral infection and amelioration of symptoms of GPIIIa-mediated conditions in animal models.
The test compound may be isolated and/or purified or alternatively, it may be synthesised using conventional techniques of recombinant expression or chemical synthesis. Furthermore, it may be manufactured and/or used in preparation, i.e. manufacture or formulation, of a composition such as a medicament, pharmaceutical composition or drug. These may be administered to individuals for the treatment of a GPIIIa-mediated condition. Methods may thus comprise formulating the test compound in a pharmaceutical composition with a pharmaceutically acceptable excipient, vehicle or carrier for therapeutic application. Various further aspects and embodiments of the present invention will be apparent to those skilled in the art in view of the present disclosure. All documents mentioned in this specification are incorporated herein by reference in their entirety.
Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment and apply equally to all aspects and embodiments of the invention.
The term Comprising' as used herein encompasses embodiments which include other components and embodiments which do not include other components. The term may be replaced by the term 'consisting of when referring only to the latter embodiments.
The invention encompasses each and every combination and sub- combination of the features that are described above.
Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures described below.
Figure 1 shows a schematic diagram of the domains of GPIIIa employed in the constructs described herein.
Figure 2 shows a schematic diagram of the cloning of GPIIIaPSIHyb fragment and GPIIIaΔβA in puC119-MH.
Figure 3 shows the results of nucleotide sequencing of the gene constructs used for the generation of the GPIIIaΔSDL-P33 (lower panel) which was derived from the GPIIIaΔSDL-L33 (upper panel) by site-directed mutagenesis.
Figure 4 shows the expression of recombinant GPIIIaΔSDL in CHO Lee 3.2.8.1 cell supernatant. Bound murine monoclonal IgG (Y2/51, a monoclonal antibody specific for GPIIIa in the absence of GPIIb; 9E10, a isotype matched 'negative control' monoclonal antibody against the Myc antigen) was detected with horseradish peroxidase- conjugated goat anti-mouse antibody and absorbance read at 450 nm. Each data point represents an average of three replicate samples .
Figure 5 shows the reactivity of GPIIIaΔSDL-L33 and GPIIIaΔSDL-P33 with a panel of monoclonal antibodies by ELISA (monoclonal antiby Y2/51 as per Figure 4; monoclonal antibody RFGP56 against GPIIbIIIa and known not to react with GPIIIa in the absence of GPIIb; monoclonal antibody 9E10 as per Figure 4) . Absorbance was read at 450 nm; Sup - supernatant; Lys - Lysate. Each OD represents the mean of duplicate determinations.
Figure 6 shows ELISA analysis of the binding of secreted GPIIIaΔSDL- L33 (black) or GPIIIaΔSDL-P33 (grey) to a panel of human recombinant HPA-Ia antibodies (Antibodies CamTranOO7, 19.7 and 23.15 are recombinant human phage antibodies [re-engineered to human IgG] and specific for HPA-Ia,- antibody Fog is against an irrelevant antigen, RhD) . Absorbance was read at 450 nm; X-axis, monoclonal antibodies; Y-axis, absorbance value. Each OD represents the mean of duplicate determinations .
Figure 7 shows ELISA analysis of the binding of secreted GPIIIaΔSDL- L33 (black) or GPIIIaΔSDL-P33 (grey) to three polyclonal human sera (diluted 1:20; anti-HPA-la contains alloantibodies against HPA-Ia; anti-HPA-lb, contains alloantibodies against HPA-Ib; AB, inert serum from a donor with blood group AB) . Absorbance was read at 450 nm; X- axis, human samples with polyclonal antibodies; Y-axis, absorbance value. Each OD represents the mean of duplicate determinations.
Figure 8 shows ELISA analysis of the binding of secreted GPIIIa fragments (PSI-A33L33, PHyb-L33 [=PSIHyb-L33 in other figures], ΔβA- L33 ΔSDL-L33; ΔSDL-P33 and the two Ig folds of human glycoprotein VI [D1D2] as negative controls) to 18 human plasma or serum samples (labelled A-R) containing IgG HPA-Ia antibodies from cases of neonatal alloimmune thrombocytopenia (NAIT) . in each of the three panels recombinant HPA-Ia antibody CamTran0007 has been used as a positive control) . This antibody does not react with the two shortest fragments (PSI-A13L33 and PHyb-L33)
Figure 9 shows the reactivity of GPIIIa calmodulin tagged fragments with GPIIIa MAbs .
Figure 10 shows the reactivity of murine GPIIIa specific monoclonal antibodies with recombinant GPIIIa in ELISA. Top panel shows the binding of three mouse GPIIIa antibodies CRC54, Y2/51 and RFGP56 (10 μg/mL) with the recombinant GPIIIa in ELISA. Bottom panel shows binding of the mouse monoclonal antibody SZ21 at two concentrations 1 μg/mL and 10 μg/mL with recombinant GPIIIa fragments.
Figure 11 shows the reactivity of the human HPA-Ia 19-7, 23-15 and CamTranOO7 to recombinant GPIIIa fragments in ELISA.
Figure 12A shows the reactivity of the WHO anti-HPA-la minimum potency standard (NIBSC 93/710) with recombinant GPIIIa fragments ΔβA and ΔSDL by ELISA. Figure 12B shows the reactivity of the WHO proposed anti-HPA-la sensitivity standard (NIBSC 03/152) with recombinant GPIIIa fragments ΔβA and ΔSDL by ELISA. The level of detection achieved in the MAIPA is shown by the dotted lines in both panels. Points represent the means + SD of triplicate wells in 1 experiment, representative at least 2 experiments
Figure 13 shows the reactivity of HPA-Ib antibodies with the recombinant GPIIIa fragments. Five HPA-Ib antibodies were tested for reactivity with the recombinant calmodulin-tagged GPIIIa fragments by ELISA. As positive control, reactivity of the leucine 33 form of ΔSDL with the anti-HPA-la CamTran007 was included and as negative control, all anti-HPA-lbs were also tested for reactivity with recombinant GPVI (D1D2) .
Table 1 shows the domain structure of the GPIIIaΔBA polypeptide.
Table 2 shows the reactivity of 132 polyclonal NAIT samples with recombinant calmodulin-tagged GPIIIa in ELISA. The samples were divided into four distinct clinical groups: (a) cases resulting in intracranial haemorrhage (ICH) , (b) platelet count <20X109/L, (c) platelet count≥20X109/L and (4) cases with a history of antenatal treatment .
Experiments Materials and Methods Chemicals
All chemicals used in this study were of analytical purity and unless otherwise stated, were obtained from Sigma (Poole, UK) . All restriction enzymes were from New England Biolabs (Hitchin, UK) .
Antibodies
Anti-GPIIIa, clone Y2/5111 was from Dako, Cambridge, UK and anti-c-
Myc, clone 9E1012 was from the International Blood Group Reference Laboratory (IBGRL) , Bristol, UK. Recombinant human anti-D Fog-B13 (FOG in the figures) and IgGl anti-HPA-la, clone CamTranOO714 were from IBGRL. Human HPA-Ia monoclonal antibodies 19-7{Proulx, 1997 #169} and 23-15 {Proulx, 1997 #169} were kindly provided by Dr. R. Lemieux, Hema-Quebec, Canada. Human polyclonal sera were from the National Blood Service Platelet Immunology serum archives
(Cambridge, UK) and were obtained from patients previously referred for investigation of NAIT, PTP and PR. All HPA-I polyclonal samples (sera or plasma) were obtained from the Platelet Immunology Reference Laboratory (PIRL) at NBS, Cambridge UK. These anti-HPA- la's had been referred to the PIRL, Cambridge from the South East of England, including London and covering a population of 16 million with 240 000 births annually. Since, there are currently no routine screening in place in England, all samples were referred by physicians based on clinical suspicion of NAIT.
Cloning of GPIIIaΔSDL-P33 specific allele and site-directed mutagenesis
The GPIIIaΔSDL-P33 mutant was generated using the Quick Change XL site-directed mutagenesis kit™ (Stratagene, Amsterdam, The Netherlands) according to manufacturer's instructions and using the mutagenic primers 5'-GAGGTGAGCCCGGAGGCAGGGCCTC-S' and 3'- GAGGCCCTGCCTCCGGGCTCACCTC-5 ' . Each 50 μL reaction contained 50 ng DNA, 5 μL of 1OX reaction buffer, 125 ng of each oligonucleotide primer, 1 μL dNTP, 3 μL QuickSolution, 2.5 U Pfu Turbo. Amplification was performed over 20 cycles consisting of an initial denaturing period at 95° C for 1 min, 18 cycles each consisting of 50 s at 95° C, 50 s at 60° C and 9 min 40 s at 68° C and a final extension time of 7 min at 68° C. The amplified product was digested with 10 U Dpnl for 1 h at 37° C to degrade the parental plasmid. Electrocompetent E. coli TOPlO (Invitrogen) cells were transformed with 2 μL of the Dpnl-treated plasmid. Mutation was confirmed by sequencing as described below. The GPIIIaΔSDL- P33/pEFl-puroHis construct generated by site-directed mutagenesis (SDM) , was digested with BamHI to recover a GPIIIa fragment containing the P33 mutation. This fragment was then recloned into BamHI digested pEFl-puroHis plasmid to avoid the possibility of introducing unwanted mutations in the vector backbone from the SDM reaction.
DNA sequencing
All constructs were confirmed by nucleotide sequencing using dye terminator chemistry following manufacturer's instructions (ABI ready reaction mixture,- Applied Biosystems, Warrington, UK) using both internal and plasmid-specific primers. Individual clones were sequenced using both forward and reverse primers in separate reactions to ensure concordant results and analysed by gel electrophoresis on an Applied Biosystems 3100 DNA sequencer. Sequences were analysed using the Sequence Navigator™ Software.
Cell culture
Chinese Hamster Ovary (CHO) cell Lee 3.2.8.1 strain was originally engineered to incorporate 4 mutations such that all the glycoproteins are produced with the N-linked carbohydrates in the Man5 oligomannosyl forms and all O-linked carbohydrates truncated to a single GaINAc 17. The single GalcNac was preserved as it has been documented that in some cases, GalcNac is required for the glycoprotein activity.
The CHO Lee cells were maintained in Dulbecco's Modified Eagle's medium (DMEM) (Invitrogen, Groningen, The Netherlands) supplemented with 10% fetal calf serum (Invitrogen), 0.1 mM non-essential amino acids (Invitrogen) , 2 mM L-glutamine (Invitrogen) , and 1% vol/vol penicillin and streptomycin (Invitrogen) (complete media) .
Transfection of CHO Lee 3.2.8.1 cells
CHO Lee 3.2.8.1 cells were transfected by electroporation with either plasmid containing the allele-specific recombinant GPIIIaΔSDL gene segments. The cells were resuspended in electroporation buffer (NaH2PO4-H2O, Na2HPO4.7H2O, NaCl, pH 7.2) at a concentration of ~lxlθ7 cells/mL. For each construct, 800 μL resuspended cells were incubated for 10 min on dry ice with DNA (10 μg, GPIIIaΔSDL in pEFlpuro and with C-terminal hexahistidine tag) before electroporation (370 V, 960 μF) . Following transfection, the cells were allowed to recover for 15 min, resuspended in 9 mL complete media and seeded in a 10 cm tissue culture plate. They were incubated overnight (0/N) at 370C and 5% CO2. Twenty-four hours post-transfection, the cells were washed once and seeded into the original plate. The following day, they were treated with trypsin/EDTA (Invitrogen) and resuspended in selection media (complete media and puromycin 8 μg/mL) before seeding into a 96-well plate (5xlO3 cells/mL; 200 μL/well) . Fourteen days post transfection the culture supernatants were assayed for secreted GPIIIa oligopeptide by ELISA.
Production and detection of soluble recombinant monomeric GPIIIa oligopeptides
Stable clones were screened for secretion of His-tagged GPIIIaΔSDL by ELISA, using the Ni-NTA HisSorb strips (QIAGEN, Crawley, UK) , according to manufacturer's instructions. All incubation steps were carried out at room temperature (RT) on a plate shaker. Briefly, the Ni-NTA strips were coated for 2 h with 200 μL of neat supernatant. The wells were washed four times with Phosphate Buffered Saline (PBS) containing 0.05% Tween20 (PBST) before incubation with the MoAb Y2/51 (1 μg/ml in PBS/0.2% Bovine serum albumin (BSA) ; 200 μL/well) for 2 h. The wells were then washed with PBST and incubated with horseradish peroxidase (HRP) -conjugated goat anti-mouse immunoglobulin G (1:5000 in PBS/0.2% BSA, Sigma) . Immune complexes were detected by the addition of 3, 3', 5,5'- tetramethylbenzidine (TMB; Sure Blue, KPL, Guildford, UK) and the reaction was stopped with 2.5 M H2SO4. Absorbance was read at 450 nm.
Expression in Drosophila Schneider's S2 cells
Eight rGPIIIa fragments were designed and cloned in the pMT-CaM vectors for expression in the Drosophila Schneider's S2 cells.
The recombinant GPIIIa fragments expressed were GPIIIaΔSDL (residues 1-690 with residues 160-188 deleted) , GPIIIaΔβA (residues 1-109 fused to residues 352 to 690 with a serine residue inserted after residue 109) , GPIIIaPSIHyb (residues 1-109 fused to residues 352-433 with a serine residue inserted between residue 109 and 352) and GPIIIaPSIA13 (residues 1-54 with the cysteine residue at position 13 mutated to alanine) . Each fragment was expressed with either leucine (L) or proline (P) at position 33.
GPIIIaASDL The longest fragment to be expressed is the GPIIIaΔSDL. This fragment consists of residues 1 to 690 with residues 160-188 deleted. The deleted residues form part of the specificity- determining loop (SDL) region and has been shown to form the interface with the GPIIb subunit16.
GPIIIaΔSDL was cloned into pMT-CaM as a BsmBl insert. Since, GPIIIa contains most of the restriction sites present in the multiple cloning site of the pMT-CaM vector amongst which Ncol and Notl, the fragment could not be cloned directly into the vector. Instead, the BsmBl restriction sites were appended at both ends of the PCR product as this enzyme recognises a non-palindromic site and cuts outside this region. Thus, by designing primers such that digestion of the PCR products will generate compatible overhangs it was possible to clone GPIIIaΔSDL into the pMT-CaM. GPIIIaΔSDL was amplified by PCR using the primer pairs 5'-
TTTCGTCTCACATGGCCGGGCCCAACATCTGTACC (GPIIIaBsmBlF) and 5 ' - TTTCGTCTCTGGCCGCGGGCCCTTGGGACACTCTGGC (GPIIIaΔSDLBsmBlR) and the GPIIIaΔSDL insert in pEFl-His-puro as template. Each 50 μL PCR reaction contained typically 50 ng DNA, 5 μL of 1OX reaction buffer, 125 ng of each primer, 2 mM dNTP, MgCl2 and 2.5 U Amplitag Gold
(Promega) . Amplification was performed over 30 cycles consisting of an initial denaturing period at 95° C for 5 min, 30 cycles each consisting of 1 min at 94° C, 30 s at 60° C and 1 min 30 s at 72° C. The final extension time was 7 min at 72° C.
GPIIIΔβA
To investigate the role of the βA domain in the HPA-I epitopes, both allelic forms of GPIIIΔβA constructs were generated. The PSIHyb fusion construct was cloned into the pUC119-MycHis vector, which contains residues 1-438 with the ΔβA deleted, was digested with BstEII, a restriction enzyme which cuts in the PSIHyb insert at nucleotide position 597 (amino acid position 199) . Another GPIIIa fragment called GPIIIaHybβTD consisting of residues encoding residues 428 to 690 was also amplified by PCR using GPIIIaΔSDL as template and primers GPIIIaHyb and GPIIIaΔSDLBsmBlR. The GPIIIaHybβTD PCR product was purified using the QIAquick gel purification kit according to manufacturer's instructions was then digested with BsmBl and BstEII O/N at 55°C before gel purification. The digested BstEIl/BsmBl GPIIIaHybβTD was then ligated into
GPIIIaPSIHyb/puC119MycHis previously digested with BstEII and BsmBl. Figure 2 is a schematic diagram illustrating the various cloning steps leading to PSIHyb and GPIIIaΔβA.
GPIIIa PSIHybrid fusion gene
GPIIIa gene fusions (L33 and P33), containing the PSI fused to the hybrid domain, were generated by overlapping polymerase chain reaction (PCR) . GPIIIa gene fragments encoding residues 1-109 (both the L33 and P33 forms) plus an additional codon for a serine (named residue 109A) at the 3 '-end were amplified by PCR using the primers 5' -AACTGCGGCCCAGC CGGCCATGGCCGGGCCCAACATCTGTACCACGCGA (GPIIIa-PSIF) and 5 ' -AGAACGAGAATCCTCCACCTGCCGCACTTGGATGGAGAA. Another gene fragment encompassing residues 352-437 of GPIIIa was amplified using the primers : 5' -CGGCAGGTGGAGGATTCTCGTTCTAAAGTAGAGCTGGAGGTG and primers 5'-ACTTGCGGCCGCGCCTGGCAGGCACAGTCACAATC (GPIIIa-HybridR) .
Each 50 μL PCR reaction contained typically 50 ng DNA, 5 μL of 10 x reaction buffer, 125 ng of each primer, 2 mM dNTP, MgCl2 and 2.5 U Amplitag Gold (Promega) . Amplification was performed over 30 cycles consisting of an initial denaturing period at 95° C for 5 min, 30 cycles each consisting of 1 min at 94° C, 30 s at 60° C and 1 min 30 s at 72° C. The final extension time was 7 min at 72° C. The PCR products were separated by electrophoresis and the purified products were used as templates to generate the fusion fragments by overlapping PCR using the primers GPIIIa-PSIF and GPIIIa-HybridR. Reactions were out carried as described above and the products were gel-purified. The purified PSIHyb-L33 and PSIHyb-P33 products were digested with Ncol and WotI before ligation into the bacterial expression vector pUC119-MycHis to check for recombinant GPIIIaPSIHyb expression and reactivity with anti-HPA-la and anti- HPAIb polyclonal antibodies. The PSIHyb inserts L33 and P33 were then cloned into pMT-CaM as Ncol/Notl inserts.
GPIIIa PSI
The PSI domain consists of residues 1 to 54 inclusive and contains an odd number of cysteine residues namely 7. Cysl3 forms a long- range disulphide bond with Cys43518. To express the PSI domain only and to ensure that the correct disulphide bridges are formed, the cysteine residue at position 13 was mutated to alanine. This was carried out by amplifying a segment of the GPIIIa gene consisting of residues 8 to 438 using the primer pairs 5'- CGAGGTGTGAGCTCCGCCCAGCAGTGCCTGGC (GPIIIaAlal3F) , which binds at nucleotide 22 of GPIIIa and codes for Ala instead of Cys at residue 13, and primer 5'- ACTTGCGGCCGCGGCCTGGCAGGCACAGTCACAATC (HybNotlR) . Following the Cysl3Ala mutation, the first few GPIIIa residues and the restriction sites Ncol and Notl were appended by amplifying the PSI domain by PCR using the primer pairs 5'-
AACTGCGGCCCAGCCGGCCATGGCCGGGCCCAACATCTGTACCACGCGA (PSI NcolF) & 5'- ACTTGCGGCCGCGATGGATTCTGGGGCACAGTTATCCTT (PSINOtIR) . Both PSIA13L33 and PSIA13 P33 were generated, sequenced using the plasmid specific primers pMTF and pMTCamR and were then cloned as Ncol/Notl inserts in pMT-CaM vector.
Drosophila expression vector pMT/Bip/Calmodulin
Recombinant protein was expressed in Schneider's Drosophila S2 cells using the Invitrogen's Drosophila Expression System (DES®) , which enables recombinant protein expression from both stable mammalian and insect expression systems. This expression system is non-lytic and uses simple plasmids for stable expression. Protein expression occurs in healthy, logarithmically growing cells such that high levels and high-quality recombinant protein can be produced.
The gene of interest is sub-cloned into the pMT/Bip/Calmodulin expression vector (a modified version of the Invitrogen vector pMT/Bip/V5-His DES® in which the V5His tag has been replaced by calmodulin) and co-transfected into S2 cells using the pCoBlast selection vector for stable and inducible expression of secreted protein. The pMT/BiP/V5-His DES® vector contains the Drosophila metallothionein (MT) promoter 19 which allows the inducible expression of the gene of interest . This promoter is tightly regulated, but is easily induced by the addition of copper sulphate (CuSO4) to the culture medium. The Drosophila BiP gene, which encodes an immunoglobulin-binding chaperone protein leads to the channeling of BiP into the S2 secretory pathway and directs the recombinant protein into the culture medium 20.
Maintenance of S2 cells
Drosophila Melanogaster Schneider's S2 cells (Invitrogen)21 were maintained at 2xlO6 cells/ml, in DES™ Expression Media (Invitrogen) supplemented with 10% heat-inactivated fetal calf serum, 100 units/ml penicillin, 100 units/ml streptomycin, at 25°C with air as the gas phase. Cells were generally maintained at a density in the range of 6 to 15xlOs cells/mL and were seeded at a minimum density of 2xlO5 cells/mL.
Transfection and Selection Drosophila Schneider's S2 cells were transfected using the Calcium Phosphate transfection kit (Invitrogen) according to manufacturer's instructions. S2 cells were transfected with DNA-calcium phosphate coprecipitates using the pCoBlast plasmid as the selectable marker to confer blasticidin resistance22. The cells were washed the following day to remove the calcium phosphate solution and 4 days post-transfection, blasticidin (12.5 μg, Sigma) was added to select for stable cells. The cells were washed every 4th day to remove dead cells and replated into the same wells with blasticidin containing media to expand blasticidin-resistant cells. Secreted recombinant proteins were assayed by Western blotting.
Calmodulin tag detection reagent
The calmodulin tag was detected by a calmodulin-binding peptide, here referred to as N9A23. BSA-conjugated N9A was prepared by the method of Bernatowicz and Matsueda (1986) 24. Following conjugation, the BSA-N9A was dialysed into 100 inM NaCl, 50 mM Na-Borate at pH 8.3 and stored at -20°C, at a concentration of 19 mg/ml as determined by BCA assay (Perbio, Chester, UK) . HRP-conjugated-N9A was prepared by mixing N9A peptide with polymerized, maleimide-activated peroxidase (Sigma: P-1834) dissolved in PBS, pH 7.4. This was followed by the addition of 1 mg peroxidase to 4.5 nmoles peptide and the reaction was incubated overnight at 4°C. The free maleimide groups were blocked with 2-mercaptoethanol . HRP-conjugated-9NA was purified using a desalting column and eluted in PBS, pH 7.4. NDSB-201 (0.5 M final; Calbiochem-Novabiochem; Nottingham, UK:) and thimerosal
(0.02% final; Sigma) was then added to the HRP-conjugated-9NA and the resulting mixture was stored at -20°C until required.
Detection of CaM-tagged proteins by Western blotting CaM-Tagged rGPIIIa contained in the S2 supernatant was detected by Western blotting using a semi-dry transblot apparatus (Atto) . Following electrophoresis, proteins were transferred onto nitrocellulose membrane (Protran, Schleicher and Schuell, Dassel, USA) . The membrane was first soaked with transfer buffer (5.8 gl"1 Tris-base, 2.9 gl"1 glycine, 0.37 gl"1 SDS , 200 ml/L methanol).
Proteins were then electro-blotted onto the nitrocellulose membrane for -75 ran at 0.1 mA/cm2. The membrane was then blocked in 1% BSA in TBST (25 mM Tris HCl (pH 7.4), 0.15 M NaCl, 0.1% Tween) for 2 hours at room temperature. After equilibration, the membrane was incubated with the peroxidase-conjugated 9NA peptide (diluted 1: 3 000 in TBST supplemented with 0.5 inM CaCl2), for 20 min at RT with agitation. Following incubation, the membrane was washed in TBST 3 times for 10 min. Bound antibody-peroxidase conjugate was visualised using ECL detection reagents (Amersham Pharmacia Biotech, UK) according to manufacturer's instructions.
Purification of CaM-tagged rGPIIIa proteins
Stably transfected S2 cells were passaged into Ex-Cell 420 (JRH) serum free media (200 ml in 500 ml Erlenmeyer flasks) at a density of 3-4 x 106 cells/ml and incubated overnight at 26°C in an orbital shaker (110 rpm) . Protein expression was induced by the addition of 500 μM copper sulphate and the cells were grown for up to a further 7 days, following which the supernatant was harvested. The supernatant was cleared by centrifugation at 10 000 rpm for 20 minutes at 4°C and then passed through a 2 μM filter. CaM-tagged protein was purified from the clarified supernatant on an N- (6- Aminohexyl) -5-chloro-l-naphthalenesulfonamide hydrochloride (W-7) - agarose column.
Twenty milligrams of W-7 was dissolved at RT in 10 ml ethanol . The dissolved W-7 was then diluted in an equal volume of 50 mM sodium borate, pH 8.3 prior to being recirculated for 3 hours on a 1 ml NHS-activated HiTrap column (Amersham Pharmacia Biotech) prepared according to manufacturer's instructions. All purification steps were carried out at 4°C. A flow rate of 0.5 ml/min was used for column preparation and this was increased to 1-1.5 ml/min for protein purification. The W7-agarose column was washed with 20 ml of equilibration buffer (0.5 M NaCl, 50 mM Tris, 1 mM CaCl2, pH 7.4), 10 ml of elution buffer (0.15 M NaCl, 50 mM Tris, 10 mM EDTA, pH 7.4) and then a further 10 ml of equilibration buffer. The clarified culture supernatants, were supplemented with 0.3 M NaCl, 50 mM Tris, 1 mM CaCl2, filtered though a 2 μM filter before loading onto the W7-agarose column. Following protein loading, the W7 column was washed with 20 ml equilibration buffer and recombinant CaM-tagged proteins eluted with elution buffer. One ml fractions were collected and analysed by SDS-PAGE.
Characterisation of recombinantly expressed CaM-tagged GPIIIa The reactivity of five purified recombinant CaM-tagged GPIIIa proteins: PSI-L33, PSIHyb-L33 , ΔβA-L33, aΔSDL-L33 and the proline control ΔSDL-P33 (and the two Ig folds of glycoprotein VI [D1D2] as a negative control) with 18 human samples of serum or plasma containing polyclonal HPA-Ia antibodies was investigated by ELISA. Recombinant human anti-HPA-la CamTranOO7 was used as a positive control .
The wells of a 96 well Maxisorp Plate (Nunc) were coated with 50 μl BSA-9NA (5 μg/ml in 0.05 M Borate buffer) overnight at 4°C. The wells were washed once with 200 μl Wash buffer TBST (50 mM Tris, pH 7.4, 150 mM NaCl, 0.1% Tween, 0.1 mM CaCl2) before blocking with 10% BSA in Wash buffer for 2 hours at 37°C. Following another 3 washes, the wells were incubated with saturating concentrations of CaM- tagged protein (diluted in TBST supplemented with 1 mM Ca2+) for 30 min at RT. Excess CaM-tagged protein was removed by washing the wells 3 times with 200 μl Wash buffer. After a further 3 washes with TBST/Ca2+, the wells were incubated with a 1 in 20 diluted human serum/plasma sample for 1 h at RT. Following incubation, the wells were washed 5 times with TBST/Ca2+ and bound IgG antibodies were detected with HRP-conjugated goat-anti-human IgG (1:10,000 in
TBST/BSA; Jackon, Cambridge, UK) . Wells were then washed 6 times with TBST/Ca2+. Antibody-HRP complexes were detected by the addition of 3 , 3' , 5, 5'-tetramethylbenzidine (TMB; Sure Blue, KPL, Guildford, UK) and the reaction was stopped with 2.5 M H2SO4 after 2 minutes of development. Absorbance was read at 450 nm.
GPIIIa mouse monoclonal antibodies and human V gene phage antibodies The specificity of the CaM-tagged domain deleted GPIIIa mutants was investigated by ELISA. The GPIIIa specific murine MoAbs CRC54 (Yorkshire Biosciences Ltd, York, UK) (Mazurov, Khaspekova et al. 1996), Y2/51 (Dako, Cambridge, UK) (Gatter, Cordell et al . 1988), SZ21 (Xi, Zhao et al . 1992; Weiss, Goldschmidt-Clermont et al . 1995) and the murine GPIIbIIIa complex specific MoAb RFGP56 (Goodall 1991) was screened for reactivity. As a negative control recombinant GPVI, consisting of the two immunoglobulin folds [D1D2] was included. Fusion proteins were captured via the calmodulin tag in the presence of Ca2+ and binding was detected as described previously (Smethurst et al . , 2004, O'Connor et al . , 2005). Monoclonal murine antibodies were used at 1 μg/ml and 10 μg/ml and detected with HRP conjugated goat-anti-mouse (1: 1000 in TBST/Ca2+) .
Similarly, three HPA-Ia specific human monoclonal antibodies 23-15 and 19-7 (both kindly provided by Dr. R. Lemieux, Hema-Quebec, Canada) (Proulx, Chartrand et al. 1997) and the IgGl anti-HPA-la clone CamTran007 (International Blood Group Reference Laboratory, Bristol, UK) (Griffin and Ouwehand 1995) , were screened. Bound antibodies were detected with HRP-conjugated goat-anti-human (1:10 000 in TBST/BSA; Jackson, Cambridge, UK) .
Determination of HPA-I ELISA cut-off
The cut-off for the HPA-I antibody detection assay was determined by screening 40 anonymous male plasma samples (diluted 1:20 and 1:40, Wellcome Trust Case Control Consortium study, National Blood Service, Cambridge, UK) for reactivity with rGPIIIaΔSDL and rGPIIIaΔβA.
Human HPA-I polyclonal antibodies
To investigate whether the proposed ELISA will detect HPA-Ia polyclonal antibodies and how it compares to the current gold standard assay, the MAIPA, binding of both the World Health Organisation (WHO) anti-HPA-la minimum potency reagent (NIBSC 93/710, National Institute for Biological Standards and Control- NIBSC; Potters Bar, UK) and the WHO proposed anti-HPA-la standard (NIBSC 03/152, 100 AU) with ΔSDL-L33 and ΔSDL-P33 were investigated. Serial dilutions (1:20 followed by 1:2) of both standards were made and binding to CaM-tagged ΔSDL was detected as above.
Epitope mapping of HPA-Ia and HPA-Ib human polyclonal samples Human polyclonal HPA-I samples (132 HPA-Ia and 6 HPA-Ib) were obtained from the Platelet Immunology Reference Laboratory (PIRL) at NBS, Cambridge UK. The HPA-Ia antibodies had been referred to the PIRL, Cambridge and were all positive by MAIPA. The HPA-Ia positive samples (diluted 1:20) were screened for reactivity against all four GPIIIa-Leu33 fragments and the GPIIIaΔSDLPro33 fragments by ELISA. Similarly, 5 HPA-Ib positive samples from platelet refractory cases were screened for reactivity with all four GPIIIa-Pro33 fragments and the GPIIIaΔSDL-Leu33 fragment.
Results
Selection of positive GPIIIaΔSDL transformants GPIIIaΔSDL-P33 was generated by site-directed mutagenesis from the GPIIIaΔSDL-L33/pEF-His-puro plasmid. After transfection of CHO Lee 3.2.8.1 cells with the pEFl-His-puro plasmids, cells were selected for puromycin resistance over a period of 14 days to isolate stable transfectants . The puromycin-resistant cells were screened for expression of GPIIIaΔSDL by ELISA with the GPIIIa specific mouse MoAbY2/51 and positive clones were expanded and their protein expression level analysed.
Secretion of GPIIIaΔSDL To test whether GPIIIaΔSDL was being secreted by the CHO Lee cells, His-tagged proteins contained in 200 μl of supernatant or cell lysate were immobilised in the wells of 'Ni-NTA' coated ELISA plates. Following washing of unbound proteins, the wells were incubated for 1 h with MoAb Y2/51 (0.005-10 μg/mL) , a murine antibody against a GPIIIa epitope. The result of the binding of the MoAb Y2/51 at different concentrations to the captured His-tagged protein is shown in Figure 4. From this data, it was concluded that GPIIIaΔSDL was present in the supernatant but not in the lysate. As expected, no signal was obtained with the negative control MoAb
9E10. Attempts to purify the GPIIIaΔSDL proteins from the CHO Lee supernatant by affinity chromatography were unsuccessful. Hence, further characterisation assays were carried out using recombinant GPIIIaΔSDL captured from neat supernatants .
Reactivity of monoclonal HPA-Ia antibodies with GPIIIaΔSDL The two allelic forms of GPIIIaΔSDL (133 and P33) were coated on the wells of microtitre plates and tested for reactivity with the murine MoAbs Y2/51 and RFGP56, the latter being an antibody against a compound GPIIbIIIa epitope. Monoclonal antibody Y2/51 was reactive with both allelo-forms of GPIIIaΔSDL whilst, as expected, the negative control MoAbs RFGP56 and 9E10, did not bind (Fig. 5) .
Reactivity of monoclonal and polyclonal HPA-I antibodies with recombinant GPIIIaΔSDL
The reactivity of the three human recombinant HPA-Ia antibodies, CamTran007, 19.7 and 23.15 with both alleloforms of GPIIIaΔSDL, coated on microtiter plates, was investigated. All three antibodies showed robust reactivity with the GPIIIaΔSDL-L33 form whilst CamTranOO7 and 19.7 were both negative with GPIIIaΔSDL-P33 (Figure 6) . Interestingly, some reactivity of antibody 23.15 with the proline form of GPIIIaΔSDL was observed. As expected, reactivity of the IgG anti-D Fog-B (Fog in Figure 6) was negative.
Similarly, two human polyclonal antisera with HPA-Ia (anti-HPA-la) and HPA-Ib (anti-HPA-lb) antibodies and a negative control serum (AB) were used in further ELISA experiments with the recombinant GPIIIaΔSDL fragments. The HPA-Ia antiserum was from a NAIT referral, the HPA-Ib antiserum from a PTP patient and the inert control from a non-transfused group AB male donor. The reactivity of both immune sera with the recombinant GPIIIaΔSDL fragments was as expected; anti-HPA-la bound GPIIIaΔSDL-L33 and anti-HPA-lb bound GPIIIaΔSDL-P33 (Figure 7) .
Cloning and expression of rGPIIIa in Drosophila S2 expression pMT-
CaM
Having validated that recombinant GPIIIaΔSDL-L33 expressed in mammalian cells carries the HPA-Ia epitope, 8 GPIIIa recombinant gene fragments were cloned in the Drosophila S2 expression vector pMT and recombinant calmodulin tagged protein expressed in the Drosophila Schneider's S2 cells. Both the PSIA13 and the PSIHyb forms were cloned as Ncol/Notl fragments. GPIIIaΔβA and GPIIIaΔSDL were cloned as BsmBl fragments into Ncol/Notl digested pMT-CaM as both Ncol and Notl restriction sites are contained with the GPIIIa gene insert . To minimise any constraint between the first and second part of the hybrid domain in both PSIHyb and ΔβA, a serine residue (residue 109A) was inserted at the carboxy-terminus of residue 109 to fuse the β-pleated sheets of the two parts of the hybrid domain. In addition to the removal of the βA domain, the protein was truncated at residue 437 leaving the long-range disulfide bridge between cysteine 13 in the PSI domain and cysteine 435 intact.
Expression of rGPIIIa in Drosophila S2 cells
All the rGPIIIa gene fragments ligated into pMT-CaM and the plasmids were used to transfect S2 cells. Stable cells were selected over a period of 2-3 weeks. Protein expression was induced by the addition of 500 μM CuSO4 for 6-7 days. Levels of expressed proteins were assayed by Western blotting using HRP-conjugated-BSA-9NA against CaM. All the 8 rGPIIIa fragments were successfully expressed as CaM-tagged proteins. Purification of CaM-tagged rGPIIIa proteins
Cam-tagged rGPIIIa proteins were purified using a NHS-activated column and several 1 ml fractions were collected and analysed by SDS-PAGE and typically, rGPIIIa was eluted in fractions 3 to 5. Protein quantification by BCA assay confirmed yields of 10 mg/L for PSIA13-L33, 15 mg/L for PSIHyb-P33 and 14 mg/L for GPIIIaΔβA-L33 , 14 mg/L for GPIIIaΔSDL-L33 and 5 mg/L for GPIIIaΔSDL-P33.
Reactivity of polyclonal anti-HPA-la antibodies with recombinant CaM-tagged GPIIIa
The recombinant CaM-tagged GPIIIa fragments were screened for reactivity with a panel of 18 human polyclonal HPA-Ia samples from NAIT referrals using the calmodulin-based ELISA. All the 18 samples did react with the two longest fragments (ΔSDL and DβA) , albeit reactions were weak for some. Five samples also showed reboust reactivity with the two smallest fragments (PSI and PsiHyb) . The reactivity with the control antigen D1D2 and with GPIIIaΔSDL-proline 33 was negligible, indicating the interactions between the HPA-Ia antibodies and the GPIIIa fragments were allele-specific .
Reactivity with GPIIIa specific mouse monoclonal antibodies The two sets of four fragments were immobilised on the wells of microtitre plates by targeted binding to BSA derivatised with N9A peptide and the binding of three murine GPIIIa-specific monoclonal antibodies CRC54, Y2/51 and SZ21 was determined (Fig. 10) . Clone CRC54 showed robust binding to all 8 fragments and binding was not influenced by the Leu-Pro mutation. Clone Y2/51 is known to bind to a linear amino-terminal GPIIIa oligopeptide of unknown location and here bound to the two sets of the three longest fragments, but was inert against the PSI domain. As expected SZ21 binding to the Leu form was stronger than to the Pro form and at a concentration of 10 μg/mL binding to all 4 Leu-33 fragments was observed while there was minimal reactivity with the two shortest Pro33 fragments. As expected, none of the eight fragments reacted with the control antibodies, anti-GPIIbllla RFGP56.
Reactivity with human V gene phage antibodies against HPA-Ia Three unique V gene phage antibodies specific for HPA-Ia and with similar nanomolar affinities were used to investigate the HPA-Ia epitope on the four Leu33 containing GPIIIa fragments. One of the three antibodies CamTranOO7 (Griffin and Ouwehand 1995) was derived from the B-cells of a HPA-Ia immunised mother due to NAIT while both 19-7 and 23-15 (Proulx, Chartrand et al . 1997) were derived form the same V gene phage display library derived form the B-cells of a patient with post transfusion purpura (PTP) . Recent studies from our laboratory have shown that the latter two also are reactive with the HPA-Ic (Valine33) allele whilst the replacement of Leu33 (HPA- Ia) with Valine abolishes CamTran007 binding (Santoso, Kroll et al . 2006) . A similar split in reactivity was also observed with another low frequency ITGB3 allele which leads to the mutation of residue 93 in the hybrid domain from arginine to glutamine (Watkins, Schaffner- Reckinger et al . 2002).
CamTran007 only reacted with the two longest Leu33 fragments, ΔβA and ΔSDL while the other two HPA-Ia antibodies 19-7 and 23-15 also reacted with the two shortest fragments, PSI-Hybrid and PSI.
None of the three phage antibodies showed binding to the four Pro33 recombinant proteins, confirming their strict specificity for HPA-Ia (Figure 11) .
Reactivity with the WHO anti-HPA-la standards Binding of both the WHO anti-HPA-la minimum potency reagent (NIBSC
93/710) and the WHO proposed anti-HPA-la standard (NIBSC 03/152, 100 AU) with ΔSDL-L33 and ΔSDL-P33 were investigated. Both standards could be detected and the ELISA assay was found to be comparable to the MAIPA (Fig. 12) . Reactivity with polyclonal human HPA-Ia antibodies from 132 NAIT referrals
The four GPIIIa-Leu33 and GPIIIa-Pro33-ΔSDL fragments and GPVI-D1D2 as irrelevant antigen were reacted with the 1 in 20 diluted samples from 132 NAIT cases with HPA-Ia antibodies and IgG binding determined by ELISA. All 132 samples contained HPA-Ia antibodies as determined by immunofluorescence and MAIPA at the time of referral and were confirmed again by MAIPA during this study.
First, the cut-off of the ELISA assay was determined by testing 40 inert samples. The average and 1 x S. D. of the absorbance values was 0.110 and 0.0085 respectively and a cut-off of 0.15 was chosen, resulting in a specificity of 90%. Four of 40 inert samples produced absorbances above the cut-off (0.1585, 0.1675, 0.1995, 0.1855) .
The 132 anti-HPA-la NAIT samples were categorised in four clinical groups: (a) 15 ICH (intracranial haemorrhage) cases with a platelet count < 20 x 109/L, (b) 49 with a platelet count < 20 x 109/L, (c) 35 with a platelet count > 20 x 109/L and (d) 33 cases with a history of severe HPA-Ia immunisation and who underwent antenatal treatment. The potency of the samples ranged from 5-193 au/ml and there was no correlation between potency and severity of thrombocytopenia or risk of ICH (Ghevaert et al . , 2006). Of the 132 samples tested, 126 were positive with ΔβA-Leu33 (Table 2) , including all 15 ICH cases, resulting in a sensitivity of 95%. Six samples with HPA-Ia antibodies at the time of referral were negative by ELISA irrespective of the fragment used. However, these six samples were also observed to have low titers when they last tested in the MAIPA. It was interesting to note that four ΔβA-Leu33 positive samples did not react with ΔSDL-Leu33. Approximately 70% of the 126 samples also showed reactivity with the two shorter Leu33 containing fragments, PSI-hybrid and PSI only. The samples producing positive results with the two longer and the two shorter fragments may contain a mixture of Type I and II antibodies, whilst the 25% of samples only reactive with the two longer fragments contain Type II antibodies only. A detailed analysis of the type of HPA-Ia antibodies showed no significant correlations with the clinical categories or the number of pregnancies, e.g. between primi- or multi-parous women. There was no correlation between the strength of reactivity on the two shorter fragments when compared with that on the two longer ones .
Similarly, to determine whether the recombinant Pro33 containing fragments are suitable for HPA-Ib antibody detection, five samples with HPA-Ib antibodies all from platelet refractoriness cases were tested. Three of the five samples showed increased IgG binding to the two longest Pro33 fragments, ΔβA and ΔSDL when compared with the corresponding Leu33 fragments (Figure 13). One of the samples (Sample B) was more positive with ΔβA-Pro and ΔSDL-Pro when compared to the other sample while Sample E was cross-reactive with all the fragments tested. No reactivity with the shorter fragments was observed, an observation compatible with the assumed low affinity of HPA-Ib antibodies because of lack of T cell help.
References :
1. Mueller-Eckhardt C et al . Lancet. 1989;1 :363-366.
2. Newman PJ et al J Clin Invest. 1989; 83 : 1778-1781. 3. Goldberger A et al Blood. 1991; 78 : 681-687.
4. Williamson LM et al . Blood. 1998; 92 :2280-2287.
5. Ahya R et al 2001; 25 : 139-145.
6. Husebekk A et al Tidsskr Nor Laegeforen. 1996 ; 116 : 1219-1222.
7. Burrows RF et al N Engl J Med. 1993 ; 329 : 1463-1466. 8. Giovangrandi Y et al Lancet. 1990 ; 336 : 310.
9. Kunicki TJ et al Blood Cells MoI Dis. 1995/21 : 131-141.
10. Goodall AH Blood Coagul Fibrinolysis. 1991/2:377-382.
11. Gatter KC et al . Histopathology. 1988/13:257-267.
12. Evan GI et al . Cell. 1985/43:253-261. 13. Hughes-Jones NC et al Biochem J. 1990/268:135-140.
14. Griffin HM et al Blood. 1995/86:4430-4436.
15. Proulx C et al Vox Sang. 1997/72:52-60.
16. Takagi J et al Biochemistry. 2002/41:4339-4347.
17. Stanley P et al Molecular Cell Biology. 1989/9:377-383. 18. Xiao T et al Nature. 2004/432:59-67.
19. Bunch TA et al Nucleic Acids Res. 1988/16:1043-1061.
20. Kirkpatrick RB et al . J Biol Chem. 1995/270:19800-19805.
21. Schneider I. J Embryol Exp Morphol . 1972/27:353-365.
22. Kimura M et al Biochim Biophys Acta. 1994/1219:653-659. 23. Montigiani S et al J MoI Biol. 1996/258:6-13.
24. Bernatowicz MS et al Anal Biochem. 1986/155:95-102.
25. Barron-Casella, E. A. et al . (1999) Blood 93(9): 2959-67.
26. Gatter, K. C. et al . (1988). Histopathology 13(3): 257-67.
27. Goodall, A. H. (1991). Blood Coagul Fibrinolysis 2(2): 377-82, 28. Mazurov, A. V. et al . (1996). FEBS Lett 391(1-2): 84-8.
29. Newman, P. J. et al. (1989). J Clin Invest 83(5): 1778-81.
30. Proulx, C. et al . (1997). " Vox Sang 72(1): 52-60.
31. Santoso, S., H. Kroll, et al . (2006) Transfusion 46(5): 790-9,
32. Valentin, N. et al . (1995). Blood 85(11): 3028-33. 33. Watkins, N. A. et al . (2002). Blood 99(5): 1833-9. 34. Weiss, E. J. et al . (1995) Tissue Antigens 46(5): 374-81.
35. Williamson, L. M. et al . (1998) Blood 92(7): 2280-7.
37. Xi, X., Y. Zhao, et al. (1992). Nouv Rev Fr Hematol 34(3):
239-42.
Sequences
SEQ ID NO:1 (GPIIIaΔBA) :
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRP LSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVΞDSRSKVELEVRDLPEELSLSFNATCLNN
EVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNS
HRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDF
GKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKC
ECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDREPYMTENTCNRYCRDEIESVKELKDTG KDAVNCTYKNEDDCWRFQYYEDSSGKSILYWEEPΞCPKGP
SEQ ID NO: 2 (GPIIIaΔBA) :
GGGCCCAACATCTGTACCACGCGAGGTGTGAGCTCCTGCCAGCAGTGCCTGGCTGTGAGCCCCATGTG
TGCCTGGTGCTCTGATGAGGCCCTGCCTCTGGGCTCACCTCGCTGTGACCTGAAGGAGAATCTGCTGA AGGATAACTGTGCCCCAGAATCCATCGAGTTCCCAGTGAGTGAGGCCCGAGTACTAGAGGACAGGCCC CTCAGCGACAAGGGCTCTGGAGACAGCTCCCAGGTCACTCAAGTCAGTCCCCAGAGGATTGCACTCCG GCTCCGGCCAGATGATTCGAAGAATTTCTCCATCCAAGTGCGGCAGGTGGAGGATTCTCGTTCTAAAG TAGAGCTGGAAGTGCGTGACCTCCCTGAAGAGTTGTCTCTATCCTTCAATGCCACCTGCCTCAACAAT GAGGTCATCCCTGGCCTCAAGTCTTGTATGGGACTCAAGATTGGAGACACGGTGAGCTTCAGCATTGA GGCCAAGGTGCGAGGCTGTCCCCAGGAGAAGGAGAAGTCCTTTACCATAAAGCCCGTGGGCTTCAAGG ACAGCCTGATCGTCCAGGTCACCTTTGATTGTGACTGTGCCTGCCAGGCCCAAGCTGAACCTAATAGC CATCGCTGCAACAATGGCAATGGGACCTTTGAGTGTGGGGTATGCCGTTGTGGGCCTGGCTGGCTGGG ATCCCAGTGTGAGTGCTCAGAGGAGGACTATCGCCCTTCCCAGCAGGACGAATGCAGCCCCCGGGAGG GTCAGCCCGTCTGCAGCCAGCGGGGCGAGTGCCTCTGTGGTCAATGTGTCTGCCACAGCAGTGACTTT GGCAAGATCACGGGCAAGTACTGCGAGTGTGACGACTTCTCCTGTGTCCGCTACAAGGGGGAGATGTG CTCAGGCCATGGCCAGTGCAGCTGTGGGGACTGCCTGTGTGACTCCGACTGGACCGGCTACTACTGCA ACTGTACCACGCGTACTGACACCTGCATGTCCAGCAATGGGCTGCTGTGCAGCGGCCGCGGCAAGTGT GAATGTGGCAGCTGTGTCTGTATCCAGCCGGGCTCCTATGGGGACACCTGTGAGAAGTGCCCCACCTG CCCAGATGCCTGCACCTTTAAGAAAGAATGTGTGGAGTGTAAGAAGTTTGACCGGGAGCCCTACATGA CCGAAAATACCTGCAACCGTTACTGCCGTGACGAGATTGAGTCAGTGAAAGAGCTTAAGGACACTGGC AAGGATGCAGTGAATTGTACCTATAAGAATGAGGATGACTGTGTCGTCAGATTCCAGTACTATGAAGA TTCTAGTGGAAAGTCCATCCTGTATGTGGTAGAAGAGCCAGAGTGTCCCAAGGGCCCT
Table 1
Table 2

Claims

Claims :
1. A GPIIIa polypeptide comprising an amino acid sequence which has at least 80% sequence identity with the sequence of SEQ ID NO: 1 from residue 1 to at least residue 54.
2. A polypeptide according to claim 1 comprising an amino acid sequence which has at least 80% sequence identity with SEQ ID NO: 1.
3. A polypeptide according to claim 1 comprising an amino acid sequence which has at least 80% sequence identity with a sequence selected from the group consisting of; residues 1 to 54 of SEQ ID NO: 1, residues 1 to 108 of SEQ ID NO: 1, residues 1 to 192 of SEQ ID NO: 1, residues 1 to 289 of SEQ ID NO: 1, residues 1 to 322 of SEQ ID NO: 1 and residues 1 to 365 of SEQ ID NO: 1.
4. A polypeptide according to any one of the preceding claims wherein the polypeptide has a L at position 33.
5. A polypeptide according to any one of claims 1 to 3 wherein the polypeptide has a P at position 33.
6. A polypeptide according to any of claims 1 to 6 wherein the polypeptide has one or more of a Q at position 62, an A at position
166, a Q at position 248 and a C at position 395.
7. A polypeptide according to any one of claims 1 to 4 comprising an amino acid sequence selected from the group consisting of; residues 1 to 54 of SEQ ID NO: 1, residues 1 to 108 of SEQ ID NO: 1, residues 1 to 192 of SEQ ID NO: 1, residues 1 to 289 of SEQ ID NO:
1, residues 1 to 322 of SEQ ID NO: 1, residues 1 to 365 of SEQ ID
NO: 1 and SEQ ID NO: 1.
8. A polypeptide according to claim 7 comprising a L to P substitution at residue 33.
9. A polypeptide according to any one of the preceding claims comprising an affinity tag.
10. A polypeptide according to claim 9 wherein the tag is calmodulin.
11. A polypeptide according to any one of claims 1 to 10 which is immobilised on a solid support.
12. A nucleic acid encoding a polypeptide according to any one of claims 1 to 10.
13. A nucleic acid according to claim 12 operably linked to a heterologous promoter.
14. A vector comprising a nucleic acid according to claim 12 or claim 13.
15. A host cell comprising a vector according to claim 14.
16. A method of detecting an HPA antibody in a sample obtained from an individual comprising: determining the binding of one or more antibodies in the sample to a polypeptide according to any one of claims 1 to 11, wherein the binding of one or more antibodies to the polypeptide is indicative of the presence of an HPA antibody in the sample .
17. A method according to claim 16 wherein the sample is a blood, serum or plasma sample.
18. A method according to claim 16 or claim 17 wherein the HPA antibody is an HPA-I antibody.
19. A method according to claim 18 wherein the GPIIIa polypeptide comprises L at position 33 and the HPA-I antibody is an HPA-Ia antibody.
20. A method according to claim 18 wherein the GPIIIa polypeptide comprises P at position 33 and the HPA-I antibody is an HPA-Ib antibody.
21. A method according to claim 18 wherein the GPIIIa polypeptide comprises Q at position 62 and the HPA-I antibody is an HPA-lObw antibody.
22. A method according to claim 18 wherein the GPIIIa polypeptide comprises A at position 166 and the HPA-I antibody is an HPA-7bw antibody.
23. A method according to claim 18 wherein the GPIIIa polypeptide comprises Q at position 248 and the HPA-I antibody is an HPA-6bw antibody.
24. A method according to claim 18 wherein the GPIIIa polypeptide comprises C at position 396 and the HPA-I antibody is an HPA-8bw antibody.
25. A method according to any one of claims 16 to 24 wherein the HPA antibody is an alloantibody and the binding of the alloantibody with four different GPIIIa polypeptides is determined.
26. A method according to any one of claims 16 to 25 comprising; contacting immobilised GPIIIa polypeptide with the sample, and; determining the binding of antibodies in the sample to the immobilised GPIIIa polypeptide.
27. A method according to any one of claims 16 to 25 comprising; contacting the sample with an immobilised antibody-binding molecule to immobilise antibodies in the sample, and; determining the binding of the immobilised antibodies to the GPIIIa polypeptide.
28. A method of producing an antibody which binds GPIIIa comprising: administering an immunogen comprising a GPIIIa polypeptide according to any one of claims 1 to 10 to an animal, and; isolating from said animal an antibody which binds to said polypeptide.
29. A method of producing a hybridoma which produces an antibody which binds GPIIIa comprising; immunising a non-human mammal with an immunogen comprising a GPIIIa polypeptide according to any one of claims 1 to 10, producing one or more fusions of antibody producing cells from said mammal and immortalised cells to provide a population of hybridoma cells, and; screening said population to identify a hybridoma cell which produces an antibody which binds the GPIIIa polypeptide.
30. A method of producing an antibody which binds GPIIIa comprising; culturing a hybridoma cell produced by a method according to claim 29 in a culture medium; and, isolating from the medium an antibody as described above, for example, an antibody which binds to the GPIIIa polypeptide
31. A method of producing an antibody which binds GPIIIa comprising: contacting a polypeptide according to any one of claims 1 to 10 with a diverse population of antibody antigen-binding domains and; determining the binding of members of said population to said polypeptide.
32. A method according to claim 31 wherein the antibody antigen- binding domains are displayed on the surface of virus particles .
33. A method according to claim 31 or claim 32 wherein the antibody antigen-binding domains are comprised in antibodies or scFv, Fab, Fv, dAb, Fd or diabody molecules
34. A method according to any one of claims 31 to 33 comprising identifying an antibody antigen-binding domain in said population which binds to the polypeptide.
35. A method of removing HPA antibodies from a sample comprising: contacting a sample with a GPIIIa polypeptide according to claim 11, causing or allowing HPA antibodies in said sample bind to the polypeptide, and; separating the sample from the GPIIIa polypeptide, such that the HPA antibodies are removed from the sample.
36. A method according to claim 35 wherein the sample is a blood or plasma sample.
37. A method of identifying a compound useful in the treatment of a GPIIIa mediated condition comprising; contacting a GPIIIa polypeptide according to any one of claims 1 to 11 with a test compound, and; determining binding of the polypeptide with test compound.
38. A method according to claim 37 wherein the GPIIIa mediated condition is a viral infection or atherothrombosis .
39. A kit for detecting an HPA antibody in a sample may comprise: a GPIIIa polypeptide according to any one of claims 1 to 11, and; one or more detection reagents for determining binding of HPA antibodies in a sample to the GPIIIa polypeptide.
40. A kit according to claim 39 comprising apparatus for handling and/or storing a sample obtained from the individual .
41. A kit according to claim 39 or claim 40 comprising an antibody-binding molecule.
42. A kit according to claim 41 wherein one of the GPIIIa polypeptide and the antibody binding molecule is labelled with a detectable label and the other of the GPIIIa polypeptide and the antibody binding molecule is immobilised.
EP06808552A 2005-11-15 2006-11-15 Detection of human platelet antigen (hpa) antibodies Withdrawn EP1969006A2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
GB0523266A GB0523266D0 (en) 2005-11-15 2005-11-15 Materials and methods
GB0611806A GB0611806D0 (en) 2006-06-14 2006-06-14 Materials and methods
PCT/GB2006/004262 WO2007057665A2 (en) 2005-11-15 2006-11-15 Detection of human platelet antigen (hpa) antibodies

Publications (1)

Publication Number Publication Date
EP1969006A2 true EP1969006A2 (en) 2008-09-17

Family

ID=38024314

Family Applications (1)

Application Number Title Priority Date Filing Date
EP06808552A Withdrawn EP1969006A2 (en) 2005-11-15 2006-11-15 Detection of human platelet antigen (hpa) antibodies

Country Status (2)

Country Link
EP (1) EP1969006A2 (en)
WO (1) WO2007057665A2 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115989412A (en) * 2020-04-27 2023-04-18 西西欧艾(杭州)生物医药有限责任公司 Fast and Easy Antibody Detection Using Covalently Immobilized Self-Assembling Peptides

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1990006953A2 (en) * 1988-12-22 1990-06-28 Genentech, Inc. Method for preparing water soluble polypeptides
CA2354544A1 (en) * 1998-10-01 2000-04-13 Variagenics, Inc. Methods for treating or identifying a subject at risk for a neurological disease by determining the presence of a variant gpiiia and/or variant gpiib allele

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2007057665A3 *

Also Published As

Publication number Publication date
WO2007057665A2 (en) 2007-05-24
WO2007057665A3 (en) 2007-08-02

Similar Documents

Publication Publication Date Title
AU2021223701B2 (en) Methods and reagents for diagnosis of SARS-CoV-2 infection
Murata et al. Genetic and structural characterization of an amino acid dimorphism in glycoprotein Iba involved in platelet transfusion refractoriness
Valentin et al. Involvement of the cysteine-rich domain of glycoprotein IIIa in the expression of the human platelet alloantigen, PlA1: evidence for heterogeneity in the humoral response
US20050282154A1 (en) Angiotensin-converting enzyme-2 as a receptor for the SARS coronavirus
KR102019008B1 (en) A method for detecting mers coronavirus using mers coronavirus nucleocapsid fusion protein
AU2012350229A1 (en) Multiplex immuno screening assay
KR102100152B1 (en) Pivka-ⅱ measurement method, measurement reagent, and measurement kit
CN120535635B (en) Detection of anti-CD45 antibodies against common leukocyte antigens by flow cytometry and their applications
JP5002001B2 (en) Method for measuring insulin receptor α-subunit
WO2007090630A2 (en) Peptide aptamer for neutralizing the binding of platelet antigene specific antibodies and diagnostic and therapeutic applications containing the same
US20090317413A1 (en) Detection of human platelet antigen (hpa) antibodies
Moroi et al. A new monoclonal antibody, mAb 204-11, that influences the binding of platelet GPVI to fibrous collagen
US10634676B2 (en) Method and kit for simultaneously detecting human parvovirus B19 antigen and antibody
TW200806797A (en) Panel cell used for granulocyte antibody detection
WO2022007283A1 (en) Kit and method for diagnosing disease associated with abnormal fap expression, and computer readable storage medium
WO2007057665A2 (en) Detection of human platelet antigen (hpa) antibodies
CN112147324A (en) Detection of autoantibodies
CA2999866C (en) Composition and methods for assessing sensitivity and specificity of antibody detection reagents
CN118255881A (en) D-dimer antibody and its use
EP3207375B1 (en) Detection of igm antibodies using an immune complex (ic) elisa
CN114630579B (en) Murine model of fetal/neonatal alloimmune thrombocytopenia
US11661447B2 (en) Human β2-glycoprotein I expression
JP4838436B2 (en) Anti-human hepatic triglyceride lipase antibody
EP1130030A1 (en) Human erythroid differentiation related factor
Li et al. Expression of the Amino-Terminal Domain of Platelet Glycoprotein Ibα: Exploitation of a Calmodulin Tag for Determination of Its Functional Activity

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20080610

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR

RIN1 Information on inventor provided before grant (corrected)

Inventor name: WATKINS, NICHOLAS

Inventor name: OUWEHAND, WILLEM

Inventor name: STAFFORD, PRACHI

17Q First examination report despatched

Effective date: 20091204

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20100615