EP1711521A1 - Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation - Google Patents

Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation

Info

Publication number
EP1711521A1
EP1711521A1 EP05717534A EP05717534A EP1711521A1 EP 1711521 A1 EP1711521 A1 EP 1711521A1 EP 05717534 A EP05717534 A EP 05717534A EP 05717534 A EP05717534 A EP 05717534A EP 1711521 A1 EP1711521 A1 EP 1711521A1
Authority
EP
European Patent Office
Prior art keywords
tal
fragment
domain
protein
hlh
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP05717534A
Other languages
German (de)
French (fr)
Inventor
Danièle MATHIEU
Jamal Temsamani
Michel Kaczorek
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Synt EM SA
Original Assignee
Synt EM SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from FR0400964A external-priority patent/FR2865735B1/en
Application filed by Synt EM SA filed Critical Synt EM SA
Publication of EP1711521A1 publication Critical patent/EP1711521A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4703—Inhibitors; Suppressors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif

Definitions

  • the present invention relates to the field of the treatment of diseases related to deregulation of angiogenesis such as cancers, arteriosclerosis and diabetes.
  • the present invention relates to particular angiogenesis inhibitors capable of interfering with
  • the invention also relates to a pharmaceutical composition containing such inhibitors and their
  • Angiogenesis the process of remodeling
  • angiogenesis is tightly regulated under the control of a local balance between stimulating (angiogenic) and inhibiting factors
  • angiostatic angiostatic
  • endothelium cells more than 99% are quiescent.
  • endothelial cells In response to an angiogenic signal, endothelial cells (ECs) come out of dormancy and become “activated” to initiate an angiogenesis program.
  • This complex process includes the movement of the CEs to exit the capillaries and their migration to the angiogenic site, their proliferation and their differentiation to form new capillaries. Deregulation of angiogenesis is observed in
  • cytokines such as VEGF or bFGF, known to initiate or
  • Angiogenesis required for tumor growth, is also a major factor in the spread of malignant cells in the body (metastases). Despite undeniable progress in the fight against
  • Tumor angiogenesis suggests that treatment based on anti-angiogenesis would offer a new modality for controlling tumor growth in cancer patients.
  • anti-angiogenic strategies have been developed.
  • VEGF activating factor
  • bFGF neutralizing antibodies directed against the cytokine or against its receptor.
  • Other anti-angiogenic molecules have been derived from physiological inhibitors present in the
  • plasminogen angiostatin
  • collagen endostatin
  • fibrinogen alphastatin
  • Hélix specifically modulates the angiogenic response endothelial cells: it controls their migration properties and stimulates their differentiation into capillaries [Lazrak et al., J Cell Sci in press (2004)]. Homologous recombination experiments in mice have demonstrated that the tal-1 gene is required for certain stages of hematopoietic and vascular development. Tal-1 - / - embryos (not expressing tal-1) exhibit defective angiogenesis in the yolk sac which appears to reflect an intrinsic defect in endothelial cells
  • TAL-1 therefore constitutes a marker for angiogenic CEs. Therefore, we have targeted TAL-1 for
  • the Applicant has developed new molecules capable of specifically blocking the activity of TAL-1 in endothelial cells.
  • the HLH motif of TAL-1 is
  • amino acids are represented by their one-letter code, but they can also be represented by their three-letter code according to the nomenclature below.
  • the present invention therefore relates to a peptide inhibitor (also called a peptide molecule) capable of interfering with the HLH domain of TAL-1, consisting of or comprising at least 10 successive amino acids and, preferably, at least 15 successive amino acids of the HLH domain of sequence TAL-1: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA corresponding to SEQ ID No. 1 in the sequence listing in the appendix or an equivalent sequence.
  • a peptide inhibitor also called a peptide molecule
  • equivalent sequence is meant the sequence of a known variant of the HLH domain of TAL-1 but also a sequence having one or more substitutions, deletions and / or additions of amino acids with respect to the sequence SEQ ID No. 1, said substitutions, deletions and / or additions of amino acids which do not modify the activities of factor TAL-1 thus obtained, such as its attachment to DNA or its interaction with other nuclear factors, in particular E47 or LMO 2.
  • substitutions, deletions and / or additions of amino acids which do not modify the activities of factor TAL-1 thus obtained, such as its attachment to DNA or its interaction with other nuclear factors, in particular E47 or LMO 2.
  • the term “equivalent sequence” means peptides which exhibit a post-translational modification and / or a chemical modification, in particular glycosylation, amidation, acylation, acetylation, methylation. as well as the peptides which carry a protective group.
  • the derivatives of the peptides of the invention can also be those in which one or more amino acids are enantiomers, diastereoisomers, natural amino acids of D conformation, rare amino acids in particular hydroxyproline, hydroxylysine, allo- hydroxylysine, 6-N-methylysine, N-ethylglycine, N-methylglycine, N-ethylasparagine, allo-isoleucine, N-methylisoleucine, N-methylvaline, pyroglutamine, aminobutyric acid and synthetic amino acids including ornithine, norleucine, norvaline, cyclohexyl-alanine and omega-amino acids.
  • the derivatives also cover retropeptides and retro-
  • the inhibitor or peptide molecule which is the subject of the present invention is chosen from compound 1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 in the sequence list in the appendix), compound 2 of sequence: VRRIFTNSRER RQQNVNGAFAELRKLI
  • the inhibitor of the present invention consists of or comprises a
  • the inhibitor or peptide molecule object of the present invention is associated with a vector.
  • this vector is capable of increasing the transport of said inhibitor in the target cells and organs.
  • the vector is chosen from the group comprising: - a linear peptide derived from protectins or 10 tachyplines [French patent N ° 97/10297], a linear peptide comprising a transduction domains such as the transduction domains of the Tat protein of HIV-1 [Fawell et al., Proc. Natl. Acad. Sci 15 91; 664 (1994); Schwarze et al., Science 285; 1569 (1999)] and the transduction domains derived from the third helix of Antennapedia [Derossi et al., J. Biol. Chem 269, 10444 (1994); US Patent 5,888,762).
  • the invention envisages very particularly as 50 linear peptide derived from Proteins, a peptide which corresponds to the following formula (I): BX (X or B) BXXXXBBBXXXXXXB (I) and as a linear peptide derived from Tachyplesins, a peptide which responds to the formula (II) below: 55 (B OR X) XXXBXXXBXXXXBBXB (II), in which: the groups B, which are identical or different, represent an amino acid residue whose side chain carries a basic group, and - the groups X, which are identical or different, represent an aliphatic or aromatic amino acid residue or a fragment of these consisting of a sequence of at least 5 and preferably at least 7 successive amino acids of the peptides of formulas (I) or (II).
  • the present invention also relates to the use of a vector as defined above for vectorizing in cells, tissues and / or organs a peptide inhibitor as
  • the bond between the inhibitor or peptide molecule of Tal-1 capable of interfering with the different interactions of TAL-1 as defined above and of the vector is chosen from a covalent bond, a hydrophobic bond, an ionic bond, a cleavable bond or a non-cleavable bond in physiological media or inside cells.
  • This link can be direct or indirect via a link arm (linker) and carried out by means of a functional group naturally present or introduced either on the vector, or on the inhibitor, or on both.
  • This link arm if present, must be acceptable taking into account the chemical nature and the bulk both of the vector and of the inhibitor.
  • functional groups there may be mentioned: —OH, -SH, -COOH, or -NH 2 .
  • the inhibitor can be linked by covalent bonds at the N-terminal or C-terminal ends or else at the side chains of the vector peptide.
  • a preferred type of binding between the angiogenesis inhibitor and the vector involves at least one dissulfide bridge.
  • the inhibitor of the present invention is chosen from the following two compounds: - compound 4: SKNEILRLAMKYINFL - compound 5: PPDKKLSKNEILRLAMKYINF L A-NH,
  • the present invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising as active principle at least one peptide inhibitor (or molecule) as defined above, advantageously combined in said composition with an acceptable vehicle.
  • said pharmaceutical composition is in a form suitable for administration by the parenteral, oral, rectal, nasal, transdermal, pulmonary or central route.
  • vehicle is meant according to the present invention, any substance which is added to the inhibitor of the invention to promote its transport, avoid its substantial degradation in said composition and preserve its inhibitory properties.
  • the vehicle is chosen according to the type of application listed above of the composition.
  • the present invention also relates to a method of treatment of diseases linked to a deregulation of angiogenesis such as cancers, arteriosclerosis and diabetes, comprising administering to a subject suffering from such a disease an effective amount of a inhibitor or a composition as described above.
  • the invention also relates to the use of an inhibitor or of a composition as described above for the preparation of a medicament intended for the treatment of diseases linked to angiogenesis, and more particularly diseases linked to a deregulation of l angiogenesis, and preferably in the treatment of cancers, arteriosclerosis and diabetes.
  • the invention also relates to the use of a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 for the preparation of a medicament intended for the prevention and / or treatment of related diseases angiogenesis and, preferably, the treatment of cancer, arteriosclerosis and diabetes.
  • a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 is a competitive inhibitor of the HLH domain of TAL-1.
  • such a compound is a peptide molecule as defined above.
  • a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 is a compound capable of inhibiting the binding of TAL-1 to its partner E47.
  • a compound is an antibody recognizing either an epitope at the HLH domain of TAL-1, or an epitope at the HLH domain of E47.
  • the present invention relates to a method for identifying a biologically active compound capable of being used in the prevention and / or treatment of diseases related to angiogenesis and, preferably, the treatment of cancers, arteriosclerosis and diabetes consisting in detecting the inhibition of the interaction between the HLH domain of TAL-1 and its partner E47 in the presence of said compound.
  • biologically active compound the present invention relates more particularly to any natural or synthetic chemical compound such as, by way of example and in a non-exhaustive manner, proteins, polypeptides, peptides, aptamers, lipoproteins, polysaccharides , small molecules, non-peptide molecules, etc. After the identification of said biologically active compound, it will be easy to test its activity in the prevention and / or treatment of diseases related to angiogenesis and, preferably , the treatment of cancers, arteriosclerosis and diabetes by methods well known to those skilled in the art.
  • the method of the invention comprises the following steps: (a) bringing the TAL-1 protein (or a fragment of this protein comprising the HLH domain) into contact, the transcription factor E47 ( or a fragment of this factor comprising the domain which interacts with TAL-1) and the biologically active compound to be tested, (b) immunoprecipitate either the TAL-1 protein (or a fragment of this protein comprising the HLH domain), or the factor E47 transcript (or a fragment of this factor comprising the domain which interacts with TAL-1), (c) if, in step (b), the TAL-1 protein (or a fragment of this protein comprising the HLH domain ) is immunoprecipitated, detecting in the immunoprecipitate obtained in step (b), the presence of the transcription factor E47 (or a fragment of this factor comprising
  • the protein E47 which can be used can be the Gallus gallus protein present in Genbank under the number CAE30454 or the Mus musculus protein present in Genbank under the number AAK18618.
  • the TAL-1 protein which can be used is the Homo sapiens protein present in Genbank under the number P17542 or the Mus musculus protein present in Genbank under the number P22091. Those skilled in the art know in these sequences the areas of particular interest in the context of the present invention.
  • step (b) of the method which is the subject of the present invention the person skilled in the art will know what type of antibody used as a function of the protein to be immunoprecipitated (antibody specific for the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) or antibody specific for the TAL-1 protein (or a fragment of this protein comprising the HLH domain)).
  • antibody specific for the transcription factor E47 or a fragment of this factor comprising the domain which interacts with TAL-1
  • antibody specific for the TAL-1 protein or a fragment of this protein comprising the HLH domain
  • step (c), of the presence, in the immunoprecipitate obtained in step (b), of the transcription factor E47 (or of a fragment of this factor comprising the domain which interacts with TAL- 1) can be performed by any technique skilled in the art such as, for example, a Western Blot using an antibody specific for the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1), an assay for the activity of the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) or a method using an transcription factor E47
  • step (d) 10 protein comprising the HLH domain
  • the method comprises the following steps: (a ') bringing the TAL-1 protein (or a
  • step (C) highlights the inhibitory action of the active compound tested and therefore that this compound is an agent capable of being used in the prevention and / or treatment of related diseases to angiogenesis and, preferably, the treatment of cancers, (0 of arteriosclerosis and diabetes.
  • step (C) of the method which is the subject of the invention various techniques known to those skilled in the art can be used. As examples, we can realize
  • FIG. 1 schematically represents the representation of the HLH dimer.
  • - Figure 2 illustrates the inhibition of the interaction of TAL-1 and E47 in vitro by the various inhibitors.
  • - Figure 3 illustrates the inhibition of the interaction of TAL-1 and E47 in vitro by the inhibitor coupled to a vector peptide,
  • Figure 4 illustrates the effect of the compounds on the survival of HUVEC endothelial cells, - the FIG.
  • FIG. 5 illustrates the effect of one of the compounds of the invention on the in vitro tubulogenesis of human endothelial cells after 22 hours of culture
  • FIG. 6 shows the effect of the compounds of the invention on angiogenesis in vivo in the mouse by macroscopic analysis of the Matrigel implants complemented or not by compounds of the invention
  • FIG. 7 shows the effect of the compounds of the invention on angiogenesis in vivo in mice by assaying the hemoglobin contained in said Matrigel implants.
  • K562 hematopoietic cells were obtained commercially from ATCC. The cells are seeded at approximately 10 4 cells per well, 24 h before the addition of the products. They are then at 60-80% of
  • the cells are kept in culture at 37 ° C. in an atmosphere at 95% humidity and 5% CO 2 in an OptiMem® medium. The cells are incubated with either the compounds at increasing concentrations for 48 hours. At the end
  • the MTT (4, 5-dimethylthiazole-2-yl) - 2,5-diphenyltetrazolium bromide
  • the culture plates are then incubated for 4 hours in the oven.
  • the resulting crystalline formazan deposit is then dissolved by adding 200 ⁇ l of
  • the optical density (OD) is measured at 550 nm (reference 630 nm) using a microplate reader.
  • the graphical representation of the OD percentages of the wells treated as a function of the concentration of products makes it possible to determine the LD 50. This corresponds at the concentration of the product inhibiting 50% of growth.
  • HUVEC Human endothelial cells derived from the umbilical cord vein, HUVEC, (Clonetics) are cultured on dishes coated with gelatin in complete EBM-2 medium (Clonetics) supplemented with 10% of decomplemented fetal calf serum.
  • EBM-2 medium Complete EBM-2 medium
  • the ECV 304 cells (obtained from ATCC) are cultured in DMEM with 10% of decomplemented fetal calf serum. The cells are detached with trypsin and suspended in a serum-free medium (OptiMEM, Invitrogen).
  • the HLH domain of TAL-1 ie the helix 1-loop-helix 2; compound 2 includes the basic region and the helix 1; compound 3 contains the loop and the propeller 2 (see figure 1).
  • TAL-1 and E47 translated in vitro by antibodies we used a co-immunoprecipitation test of TAL-1 and E47 translated in vitro by antibodies
  • the Tal-HLH peptide has a higher cytotoxic effect on K562 cells (requiring the activity of TAL-1) when it is vectorized (Table 2).
  • the LD50 which corresponds to the concentration of the product inhibiting 50% of growth, is twice lower for the vectorized inhibitor (compound 4) than for the inhibitor alone (compound 1).
  • Figure 5 illustrates one of these experiments: the vectorized HLH peptide (compound 5) very strongly affects tubulogenesis between 7 and 10 ⁇ M while the cargo alone
  • Matrigel plugs Effect of peptides on angiogenesis in vivo in mice (Matrigel plugs).
  • the Matrigel plugs test consists of injecting Matrigel, an extracellular matrix derived from a murine tumor, subcutaneously into the mouse, capable of triggering neovascularization within the implant. Indeed, the endothelial cells of the host, under the influence of the pro-angiogenic factors contained in the Matrigel, migrate towards this "pseudo-tumor" and infiltrate in the Matrigel to organize a network of capillaries between 5 and 7 days.
  • two subcutaneous injections of Matrigel 500 ⁇ l
  • the mice were anesthetized by inhalation of isoflurane (Forene®).
  • Matrigel (BDBiosciences; lot 10403, 13 mg / ml) was supplemented with bFGF (500 ng / ml), heparin (60 U / ml) and the various peptides SynB3 (compound 7), SynB3- HLH ( compound 5), SynB4 (compound 6), SynB4-HLH (compound 4) are added to a final concentration of 20 ⁇ M in 5% DMSO.
  • bFGF 500 ng / ml
  • heparin 60 U / ml
  • the various peptides SynB3 (compound 7), SynB3- HLH ( compound 5), SynB4 (compound 6), SynB4-HLH (compound 4) are added to a final concentration of 20 ⁇ M in 5% DMSO.
  • mice were divided into 3 groups of six identical animals (C57BL / 6 males 6 weeks old). - each mouse in the control group (mice 1 to 6) received two injections of Matrigel containing 5% DMSO on the left side and an anti-angiogenic control peptide on the right side, - each mouse in the “SynB3” group (mice 7 to 12 ) received two injections of Matrigel containing SynB3 on the left side and SynB3-HLH on the right side, - each mouse in the "SynB4" group (mice 13 to 18) received two injections of Matrigel containing SynB4 on the left side and SynB4-HLH of the right side.
  • mice Six days after the injection, the mice were sacrificed by CO 2 inhalation and the implants were recovered to assess angiogenesis (photography and hemoglobin assay).
  • the angiogenesis was quantified by assaying the hemoglobin contained in the implants of Matrigel with a Drabkin solution according to the recommendations of the seller (Sigma Chemical Co).
  • FIGS. 6 (macroscopic analysis) and 7 (determination of hemoglobin) show that the addition of the vector peptides alone has no significant effects on angiogenesis; on the other hand, the HLH peptide conjugated with one or the other of the vectors effectively inhibits neovascularization in the implants (11 of 12). This inhibition was much greater than that obtained by an inhibitor (Tum) known to inhibit angiogenesis.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Diabetes (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Vascular Medicine (AREA)
  • Emergency Medicine (AREA)
  • Endocrinology (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

The invention concerns a peptide molecule capable of interfering with the HLH domain of TAL-1, consisting of or comprising at least 10 successive amino acids and preferably at least 15 successive amino acids of the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA corresponding to SEQ ID No. 1 whereof the listing of sequences is annexed or an equivalent sequence, said molecule being advantageously associated with a vector. The invention also concerns a pharmaceutical composition containing said peptide molecule and the use of a compound capable of interacting with the HLH domain of TAL-1 for preparing a medicine designed for the prevention and/or treatment of diseases related to angiogenensis, preferably the treatment of cancers, arteriosclerosis and diabetes. The invention further concerns a method for identifying a biologically active compound capable of being used in the prevention and/or treatment of diseases related to angiogenensis, preferably the treatment of cancers treatment of cancers, arteriosclerosis and diabetes which consists in detecting inhibition of the interaction between the HLH domain of TAL-1 and its partner E47 in the presence of said compound.

Description

INHIBITEURS DE 1 'ANGIOGENESE, COMPOSITIONS LES CONTENANT ET LEUR UTILISATION POUR LE TRAITEMENT DES MALADIES LIEES A UNE DEREGULATION DE L'ANGIOGENESE. INHIBITORS OF ANGIOGENESIS, COMPOSITIONS CONTAINING SAME AND THEIR USE FOR THE TREATMENT OF DISEASES RELATED TO DEREGULATION OF ANGIOGENESIS.
5 La présente invention se rapporte au domaine du traitement des maladies liées à une dérégulation de l'angiogenèse telles que les cancers, l'artériosclérose et le diabète. L'invention concerne des inhibiteurs de l'angiogenèse particuliers capables d'interférer avec lesThe present invention relates to the field of the treatment of diseases related to deregulation of angiogenesis such as cancers, arteriosclerosis and diabetes. The present invention relates to particular angiogenesis inhibitors capable of interfering with
10 différentes interactions de TAL-1 susceptibles d'être conjugués à des vecteurs tels que des peptides, des particules (liposomes, nanoparticules, etc.) et des polymères. L'invention concerne également une composition pharmaceutique contenant de tels inhibiteurs et leur10 different interactions of TAL-1 capable of being conjugated to vectors such as peptides, particles (liposomes, nanoparticles, etc.) and polymers. The invention also relates to a pharmaceutical composition containing such inhibitors and their
15 utilisation pour le traitement de maladies liées à l'angiogenèse, tout particulièrement pour le traitement des cancers, de l'artériosclérose et du diabète.15 use for the treatment of diseases related to angiogenesis, especially for the treatment of cancers, arteriosclerosis and diabetes.
L'angiogenèse, processus de remodelage desAngiogenesis, the process of remodeling
»0 capillaires préexistants, conduit à la formation de nouveaux vaisseaux [Riseau, Nature 386 ; 671 (1997)]. Dans des conditions physiologiques, l'angiogenèse est étroitement régulée sous le contrôle d'une balance locale entre facteurs stimulateurs (angiogéniques ) et inhibiteurs»0 preexisting capillaries, leads to the formation of new vessels [Riseau, Nature 386; 671 (1997)]. Under physiological conditions, angiogenesis is tightly regulated under the control of a local balance between stimulating (angiogenic) and inhibiting factors
»5 (angiostatiques) . Chez l'adulte, la plupart des cellules de l'endothélium (plus de 99 %) sont à l'état quiescent. En réponse à un signal angiogénique, les cellules endothéliales (CEs) sortent de leur dormance et deviennent "activées" pour enclencher un programme d'angiogenèse. Ce i0 processus complexe inclut le mouvement des CEs pour sortir des capillaires et leur migration vers le site angiogénique, leur prolifération et leur différenciation pour former de nouveaux capillaires. Une dérégulation de l'angiogenèse est observée dans»5 (angiostatic). In adults, most of the endothelium cells (more than 99%) are quiescent. In response to an angiogenic signal, endothelial cells (ECs) come out of dormancy and become "activated" to initiate an angiogenesis program. This complex process includes the movement of the CEs to exit the capillaries and their migration to the angiogenic site, their proliferation and their differentiation to form new capillaries. Deregulation of angiogenesis is observed in
S5 certaines pathologies comme l'artériosclérose, le diabète et les tumeurs [Carmeliet, Nat Med 6 ; 389 (2000)]. Quand les tumeurs atteignent une taille critique créant des conditions d'hypoxie, les cellules tumorales relarguent des cytokines, telles que VEGF ou bFGF, connues pour initier ouS5 certain pathologies such as arteriosclerosis, diabetes and tumors [Carmeliet, Nat Med 6; 389 (2000)]. When the tumors reach a critical size creating conditions of hypoxia, the tumor cells release cytokines, such as VEGF or bFGF, known to initiate or
5 stimuler l'angiogenèse. L'angiogenèse, requise pour la croissance des tumeurs, est également un facteur majeur de propagation des cellules malignes dans l'organisme (métastases) . En dépit de progrès indéniables dans la lutte contre5 stimulate angiogenesis. Angiogenesis, required for tumor growth, is also a major factor in the spread of malignant cells in the body (metastases). Despite undeniable progress in the fight against
10 certains cancers, force est de reconnaître que globalement les cancers progressent et qu'ils constituent une cause majeure de mortalité. La découverte de nouveaux médicaments constitue une des priorités de la recherche médicale. Les progrès récents des connaissances scientifiques sur10 certain cancers, it must be recognized that globally cancers are progressing and that they constitute a major cause of mortality. The discovery of new drugs is one of the priorities of medical research. Recent advances in scientific knowledge about
15 1 ' angiogenèse tumorale permettent de croire que le traitement fondé sur l'anti-angiogenèse offrirait une nouvelle modalité pour maîtriser la croissance tumorale chez les patients atteints de cancer. Plusieurs stratégies anti-angiogéniques ont été15 Tumor angiogenesis suggests that treatment based on anti-angiogenesis would offer a new modality for controlling tumor growth in cancer patients. Several anti-angiogenic strategies have been
>0 développées pour inhiber la fonction de facteurs activateurs (VEGF ou bFGF), notamment avec des anticorps neutralisants dirigés contre la cytokine ou contre son récepteur. D'autres molécules anti-angiogéniques ont été dérivées d'inhibiteurs physiologiques présents dans le> 0 developed to inhibit the function of activating factors (VEGF or bFGF), in particular with neutralizing antibodies directed against the cytokine or against its receptor. Other anti-angiogenic molecules have been derived from physiological inhibitors present in the
»5 système hémostatique, comme le plasminogène (angiostatine) , le collagène (endostatine) ou encore le fibrinogène (alphastatine) ; ces molécules inhibent l'adhésion des CEs à la matrice extracellulaire requise pour leur morphogenèse .»5 hemostatic system, such as plasminogen (angiostatin), collagen (endostatin) or even fibrinogen (alphastatin); these molecules inhibit the adhesion of CEs to the extracellular matrix required for their morphogenesis.
(0 Une autre stratégie très peu explorée à ce jour est de cibler directement les événements intracellulaires de la cellule endothéliale en réponse à des stimuli angiogéniques. Ainsi, la Demanderesse a montré que TAL-1, facteur de transcription de la famille basic-Helix-Loop-(0 Another strategy which has been little explored to date is to directly target intracellular events of the endothelial cell in response to angiogenic stimuli. Thus, the Applicant has shown that TAL-1, a transcription factor of the basic-Helix family Loop-
15 Hélix (bHLH), module spécifiquement la réponse angiogénique des cellules endothéliales : il contrôle leurs propriétés de migration et stimule leur différenciation en capillaires [Lazrak et al., J Cell Sci sous presse (2004)]. Les expériences de recombinaison homologue chez la souris ont 5 démontré que le gène tal-1 est requis pour certaines étapes du développement hématopoïétique et vasculaire. Les embryons tal-1-/- (n'exprimant pas tal-1 ) présentent une angiogenèse défectueuse dans le sac vitellin qui semble refléter un défaut intrinsèque des cellules endothéliales15 Hélix (bHLH), specifically modulates the angiogenic response endothelial cells: it controls their migration properties and stimulates their differentiation into capillaries [Lazrak et al., J Cell Sci in press (2004)]. Homologous recombination experiments in mice have demonstrated that the tal-1 gene is required for certain stages of hematopoietic and vascular development. Tal-1 - / - embryos (not expressing tal-1) exhibit defective angiogenesis in the yolk sac which appears to reflect an intrinsic defect in endothelial cells
10 [Visvader et al., Gènes Dev 12 ; 473 (1998)]. Chez l'adulte, en dehors de certains progéniteurs hématopoïétiques de la moelle osseuse, la protéine TAL-1 est exprimée dans les petits vaisseaux en formation, mais pas dans l'endothélium mature quiescent [Kallianpur et al.,10 [Visvader et al., Genes Dev 12; 473 (1998)]. In adults, apart from certain hematopoietic progenitors of the bone marrow, the TAL-1 protein is expressed in the small vessels forming, but not in the quiescent mature endothelium [Kallianpur et al.,
L5 Blood 83 ; 1200 (1994)]; de manière significative, un haut niveau d'expression de TAL-1 est observé dans la vasculature de tumeurs humaines [Chetty et al., J Pathol 181 ; 311 (1997)]. TAL-1 constitue donc un marqueur des CEs angiogéniques. De ce fait, nous avons ciblé TAL-1 pourL5 Blood 83; 1200 (1994)]; significantly, a high level of expression of TAL-1 is observed in the vasculature of human tumors [Chetty et al., J Pathol 181; 311 (1997)]. TAL-1 therefore constitutes a marker for angiogenic CEs. Therefore, we have targeted TAL-1 for
>0 inhiber l'angiogenèse.> 0 inhibit angiogenesis.
La Demanderesse a développé de nouvelles molécules capables de bloquer spécifiquement l'activité de TAL-1 dans les cellules endothéliales. Le motif HLH de TAL-1 estThe Applicant has developed new molecules capable of specifically blocking the activity of TAL-1 in endothelial cells. The HLH motif of TAL-1 is
>5 requis pour toutes les activités du facteur TAL-1 connues à ce jour : fixation à l'ADN ou interaction avec d'autres facteurs nucléaires notamment E47 ou LMO 2 [Hsu et al., Proc. Natl. Acad. Sci 91 ; 3181 (1994) ; Vitelli et al., Mol Cell Biol 20 ; 5330 ( 2000 )] (Figure 1 ) . La Demanderesse iθ a développé des inhibiteurs peptidiques capables d'entrer en compétition avec le domaine HLH de TAL-1. Ces inhibiteurs peptidiques ont été ensuite couplés à des vecteurs peptidiques pour permettre et/ou améliorer leur internalisation dans les cellules. Les travaux et résultats concernant ces peptides vecteurs et leur utilisation comme vecteurs pour transporter des molécules actives ont été décrits dans la demande de brevet français N° 97/10297 déposée le 08 5 décembre 1997.> 5 required for all TAL-1 factor activities known to date: attachment to DNA or interaction with other nuclear factors, in particular E47 or LMO 2 [Hsu et al., Proc. Natl. Acad. Sci 91; 3181 (1994); Vitelli et al., Mol Cell Biol 20; 5330 (2000)] (Figure 1). Applicant iθ has developed peptide inhibitors capable of entering into competition with the HLH domain of TAL-1. These peptide inhibitors were then coupled to peptide vectors to allow and / or improve their internalization in cells. The work and results concerning these vector peptides and their use as vectors for transporting active molecules have been described in French patent application No. 97/10297 filed on December 08, 1997.
Dans les séquences peptidiques rapportées ci-après, les acides aminés sont représentés par leur code à une lettre, mais ils peuvent être aussi représentés par leur 10 code à trois lettres selon la nomenclature ci-dessous. A Ala alanine C Cys cystéine D Asp acide aspartique E Glu acide glutamiqueIn the peptide sequences reported below, the amino acids are represented by their one-letter code, but they can also be represented by their three-letter code according to the nomenclature below. A Ala alanine C Cys cysteine D Asp aspartic acid E Glu glutamic acid
15 F Phe phénylalanine G Gly glycine H His histidine I Ile isoleucine K Lys lysine15 F Phe phenylalanine G Gly glycine H His histidine I Isoleucine island K Lys lysine
Z0 L Leu leucine M Met méthionine N Asn asparagine P Pro proline Q Gin glutamineZ0 L Leu leucine M Met methionine N Asn asparagine P Pro proline Q Gin glutamine
.5 R Arg arginine S Ser serine T Thr thréonine V Val valine Trp tryptophane.5 R Arg arginine S Ser serine T Thr threonine V Val valine Trp tryptophan
50 Y Tyr tyrosine La présente invention a donc pour objet un inhibiteur peptidique (également appelé molécule peptidique) capable d'interférer avec le domaine HLH de TAL-1, constitué par ou comprenant au moins 10 acides aminés successifs et, de préférence, au moins 15 acides aminés successifs du domaine HLH de TAL-1 de séquence : QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA correspondant à la SEQ ID No. 1 dans le listage de séquences en annexe ou une séquence équivalente.50 Y Tyr tyrosine The present invention therefore relates to a peptide inhibitor (also called a peptide molecule) capable of interfering with the HLH domain of TAL-1, consisting of or comprising at least 10 successive amino acids and, preferably, at least 15 successive amino acids of the HLH domain of sequence TAL-1: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA corresponding to SEQ ID No. 1 in the sequence listing in the appendix or an equivalent sequence.
Par « séquence équivalente » , on entend la séquence d'un variant connu du domaine HLH de TAL-1 mais aussi une séquence présentant un ou plusieurs substitutions, délétions et/ou additions d'acides aminés par rapport à la séquence SEQ ID No. 1, lesdites substitutions, délétions et/ou additions d'acides aminés ne modifiant pas les activités du facteur TAL-1 ainsi obtenu comme sa fixation à l'ADN ou son interaction avec d'autres facteurs nucléaires notamment E47 ou LMO 2. L'homme du métier connaît différentes techniques pour vérifier les activités du facteur de transcription TAL-1 ainsi obtenu. De plus, dans le cadre de la présente invention, on entend par « séquence équivalente » , des peptides qui présentent une modification post-traductionnelle et/ou une modification chimique en particulier une glycosylation, une amidation, une acylation, une acétylation, une méthylation ainsi que les peptides qui portent un groupement protecteur. Les dérivés des peptides de l'invention peuvent également être ceux dont un ou plusieurs acides aminés sont des énantiomères, des diastéréoisomères, des acides aminés naturels de conformation D, des acides aminés rares notamment l'hydroxyproline, l'hydroxylysine, l'allo-hydroxylysine, la 6-N-méthylysine, la N-éthylglycine, la N-méthylglycine, la N-éthylasparagine, l'allo-isoleucine, la N- méthylisoleucine, la N-méthylvaline, la pyroglutamine, l'acide aminobutyrique et les acides aminés synthétiques notamment l'ornithine, la norleucine, la norvaline, la cyclohexyl-alanine et les oméga-acides aminés. Les dérivés couvrent également les rétropeptides et les rétro-By "equivalent sequence" is meant the sequence of a known variant of the HLH domain of TAL-1 but also a sequence having one or more substitutions, deletions and / or additions of amino acids with respect to the sequence SEQ ID No. 1, said substitutions, deletions and / or additions of amino acids which do not modify the activities of factor TAL-1 thus obtained, such as its attachment to DNA or its interaction with other nuclear factors, in particular E47 or LMO 2. The Those skilled in the art know different techniques for verifying the activities of the TAL-1 transcription factor thus obtained. In addition, in the context of the present invention, the term “equivalent sequence” means peptides which exhibit a post-translational modification and / or a chemical modification, in particular glycosylation, amidation, acylation, acetylation, methylation. as well as the peptides which carry a protective group. The derivatives of the peptides of the invention can also be those in which one or more amino acids are enantiomers, diastereoisomers, natural amino acids of D conformation, rare amino acids in particular hydroxyproline, hydroxylysine, allo- hydroxylysine, 6-N-methylysine, N-ethylglycine, N-methylglycine, N-ethylasparagine, allo-isoleucine, N-methylisoleucine, N-methylvaline, pyroglutamine, aminobutyric acid and synthetic amino acids including ornithine, norleucine, norvaline, cyclohexyl-alanine and omega-amino acids. The derivatives also cover retropeptides and retro-
5 inversopeptides, de même que les peptides dont la chaîne latérale d'un ou plusieurs des acides aminés est substituée par des groupements qui ne modifient pas l'activité antimicrobienne des peptides de l'invention. Par « molécule peptidique » , on entend dans le cadre5 inversopeptides, as well as peptides in which the side chain of one or more of the amino acids is substituted by groups which do not modify the antimicrobial activity of the peptides of the invention. By "peptide molecule" is meant in the context
10 de la présente invention une molécule constituée par ou qui comprend au moins une séquence peptidique, ladite molécule pouvant comprendre en outre des entités chimiques additionnelles autres que des acides aminés.10 of the present invention a molecule constituted by or which comprises at least one peptide sequence, said molecule being able to further comprise additional chemical entities other than amino acids.
15 De préférence, l'inhibiteur ou molécule peptidique objet de la présente invention est choisi parmi le composé 1 de séquence : QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 dans la liste de séquences en annexe), le composé 2 de séquence : VRRIFTNSRER RQQNVNGAFAELRKLI (SEQPreferably, the inhibitor or peptide molecule which is the subject of the present invention is chosen from compound 1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 in the sequence list in the appendix), compound 2 of sequence: VRRIFTNSRER RQQNVNGAFAELRKLI
>0 ID No. 2 dans la liste de séquences en annexe) et le composé 3 de séquence : PTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 3 dans la liste de séquences en annexe) ou une séquence équivalente auxdites séquences. Ainsi, l'inhibiteur de la présente invention est constitué par ou comprend une> 0 ID No. 2 in the annexed sequence list) and the sequence compound 3: PTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 3 in the annexed sequence list) or a sequence equivalent to said sequences. Thus, the inhibitor of the present invention consists of or comprises a
»5 séquence choisie parmi les séquences suivantes : - QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 dans la liste de séquences en annexe), -VRRIFTNSRERWRQQNVNGAFAELRKLI (SEQ ID No. 2 dans la liste de séquences en annexe) et»5 sequence chosen from the following sequences: - QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 in the sequence list in the appendix), -VRRIFTNSRERWRQQNVNGAFAELRKLI (SEQ ID No. 2 in the list of sequences in the appendix) and
$0 - PTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 3 dans la liste de séquences en annexe) ou une séquence équivalente auxdites séquences.$ 0 - PTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 3 in the sequence list in the appendix) or a sequence equivalent to the said sequences.
Dans une forme de mise en œuvre préférée, 55 l'inhibiteur ou molécule peptidique objet de la présente invention est associé à un vecteur. De façon avantageuse, ce vecteur est capable d'augmenter le transport dudit inhibiteur dans les cellules et organes cibles. L'homme du métier connaît différents types deIn a preferred embodiment, the inhibitor or peptide molecule object of the present invention is associated with a vector. Advantageously, this vector is capable of increasing the transport of said inhibitor in the target cells and organs. Those skilled in the art know different types of
5 vecteurs peptidiques utilisables dans le cadre de la présente invention. Ainsi, à titre d'exemples et de façon non-limitative, le vecteur est choisi, parmi le groupe comprenant : - un peptide linéaire dérivé de protégrines ou de 10 tachyplésines [brevet français N° 97/10297], un peptide linéaire comprenant un domaine de transduction tels que les domaines de transduction de la protéine Tat de HIV-1 [Fawell et al., Proc. Natl. Acad. Sci 15 91 ; 664 (1994) ; Schwarze et al., Science 285 ; 1569 (1999)] et les domaines de transduction dérivés de la troisième hélice d'Antennapedia [Derossi et al., J. Biol. Chem 269, 10444 (1994) ; Brevet US 5888762).5 peptide vectors usable in the context of the present invention. Thus, by way of examples and without limitation, the vector is chosen from the group comprising: - a linear peptide derived from protectins or 10 tachyplines [French patent N ° 97/10297], a linear peptide comprising a transduction domains such as the transduction domains of the Tat protein of HIV-1 [Fawell et al., Proc. Natl. Acad. Sci 15 91; 664 (1994); Schwarze et al., Science 285; 1569 (1999)] and the transduction domains derived from the third helix of Antennapedia [Derossi et al., J. Biol. Chem 269, 10444 (1994); US Patent 5,888,762).
>0 - des particules comme les liposomes [Dass and Su. (2001) Drug Deliv. 8:191-213] ou des nanoparticules [Panya and Labhasetwar (2003) Adv Drug Deliv Rev. 55:329- 47 ; Douglas et al. (1987) Crit Rev Ther Drug Carrier Syst. 3:233-61],> 0 - particles such as liposomes [Dass and Su. (2001) Drug Deliv. 8: 191-213] or nanoparticles [Panya and Labhasetwar (2003) Adv Drug Deliv Rev. 55: 329-47; Douglas et al. (1987) Crit Rev Ther Drug Carrier Syst. 3: 233-61],
>5 - des polymères tels que le polyéthylène glycol (PEG) [Greenwald et al. (2003) Adv Drug Deliv Rev. 55:217-50].> 5 - polymers such as polyethylene glycol (PEG) [Greenwald et al. (2003) Adv Drug Deliv Rev. 55: 217-50].
L'invention envisage tout particulièrement comme 50 peptide linéaire dérivé de Protégrines, un peptide qui répond à la formule ( I ) suivante : BX(X ou B)BXXXXBBBXXXXXXB (I) et comme peptide linéaire dérivé de Tachyplésines, un peptide qui répond à la formule (II) suivante : 55 (B OU X)XXXBXXXBXXXXBBXB (II), dans lesquelles : les groupes B, identiques ou différents, représentent un résidu d'acide aminé dont la chaîne latérale porte un groupement basique, et - les groupes X, identiques ou différents, représentent un résidu d'acide aminé aliphatique ou aromatique ou un fragment de ceux-ci constitué d'une séquence d'au moins 5 et de préférence d'au moins 7 acides aminés successifs des peptides de formules (I) ou (II). La présente invention concerne également l'utilisation d'un vecteur tel que défini précédemment pour vectoriser dans les cellules, les tissus et/ou les organes un inhibiteur peptidique tel que défini précédemment.The invention envisages very particularly as 50 linear peptide derived from Proteins, a peptide which corresponds to the following formula (I): BX (X or B) BXXXXBBBXXXXXXB (I) and as a linear peptide derived from Tachyplesins, a peptide which responds to the formula (II) below: 55 (B OR X) XXXBXXXBXXXXBBXB (II), in which: the groups B, which are identical or different, represent an amino acid residue whose side chain carries a basic group, and - the groups X, which are identical or different, represent an aliphatic or aromatic amino acid residue or a fragment of these consisting of a sequence of at least 5 and preferably at least 7 successive amino acids of the peptides of formulas (I) or (II). The present invention also relates to the use of a vector as defined above for vectorizing in cells, tissues and / or organs a peptide inhibitor as defined above.
La liaison entre l'inhibiteur ou molécule peptidique de Tal-1 capable d'interférer avec les différentes interactions de TAL-1 tel que précédemment défini et du vecteur est choisie parmi une liaison covalente, une liaison hydrophobe, une liaison ionique, une liaison clivable ou une liaison non clivable dans les milieux physiologiques ou à l'intérieur des cellules. Cette liaison peut être directe ou indirecte par l'intermédiaire d'un bras de liaison (linker) et effectuée au moyen d'un groupe fonctionnel naturellement présent ou introduit soit sur le vecteur, soit sur l'inhibiteur, soit sur les deux. Ce bras de liaison, s'il est présent, doit être acceptable compte tenu de la nature chimique et de l'encombrement tant du vecteur que de l'inhibiteur. On peut citer, à titre d'exemple et de façon non-limitative, des linkers contenant des groupements alkyle, aryle, aralkyle ou peptidique, des esters, aldéhydes ou acides d' alkyle, aryle ou aralkyle, des groupements anhydrides, sulfhydriles, ou carboxyles tels que les dérivés de l'acide maleymil benzoïque, de l'acide maleymil propionique et des dérivés succynimidyle, des groupes dérivés du bromure ou chlorure de cyanogène, carbonyldiimidazole, des esters de succinimide ou des halogénures sulphoniques. Comme groupes fonctionnels, on peut citer : —OH, -SH, -COOH, ou -NH2. Ainsi, l'inhibiteur peut être lié par des liaisons covalentes au niveau des extrémités N-terminale ou C-terminale ou bien au niveau des chaînes latérales du peptide vecteur. Un type de liaison préféré entre l'inhibiteur de l'angiogenèse et le vecteur implique au moins un pont dissulfure.The bond between the inhibitor or peptide molecule of Tal-1 capable of interfering with the different interactions of TAL-1 as defined above and of the vector is chosen from a covalent bond, a hydrophobic bond, an ionic bond, a cleavable bond or a non-cleavable bond in physiological media or inside cells. This link can be direct or indirect via a link arm (linker) and carried out by means of a functional group naturally present or introduced either on the vector, or on the inhibitor, or on both. This link arm, if present, must be acceptable taking into account the chemical nature and the bulk both of the vector and of the inhibitor. Mention may be made, by way of example and without limitation, of linkers containing alkyl, aryl, aralkyl or peptide groups, esters, aldehydes or acids of alkyl, aryl or aralkyl, anhydride groups, sulfhydriles, or carboxyls such as derivatives of maleymil benzoic acid, maleymil propionic acid and succynimidyl derivatives, groups derived from bromide or cyanogen chloride, carbonyldiimidazole, succinimide esters or sulphonic halides. As functional groups, there may be mentioned: —OH, -SH, -COOH, or -NH 2 . Thus, the inhibitor can be linked by covalent bonds at the N-terminal or C-terminal ends or else at the side chains of the vector peptide. A preferred type of binding between the angiogenesis inhibitor and the vector involves at least one dissulfide bridge.
De façon particulièrement avantageuse, l'inhibiteur de la présente invention est choisi parmi les deux composés suivants : - composé 4 : S K N E I L R L A M K Y I N F L - composé 5 : P P D K K L S K N E I L R L A M K Y I N F L A-NH, In a particularly advantageous manner, the inhibitor of the present invention is chosen from the following two compounds: - compound 4: SKNEILRLAMKYINFL - compound 5: PPDKKLSKNEILRLAMKYINF L A-NH,
La présente invention concerne également une composition pharmaceutique comprenant comme principe actif au moins un inhibiteur (ou molécule) peptidique tel que défini précédemment, avantageusement associé dans ladite composition à un véhicule acceptable.The present invention also relates to a pharmaceutical composition comprising as active principle at least one peptide inhibitor (or molecule) as defined above, advantageously combined in said composition with an acceptable vehicle.
De préférence, ladite composition pharmaceutique se présente sous une forme appropriée pour une administration par voie parentérale, par voie orale, par voie rectale, par voie nasale, par voie transdermique, par voie pulmonaire ou par voie centrale. Par « véhicule », on entend selon la présente invention, toute substance qui est ajoutée à l'inhibiteur de l'invention pour favoriser son transport, éviter sa dégradation substantielle dans ladite composition et préserver ses propriétés inhibitrices. Le véhicule est choisi en fonction du type d'application listé ci-dessus de la composition.Preferably, said pharmaceutical composition is in a form suitable for administration by the parenteral, oral, rectal, nasal, transdermal, pulmonary or central route. By "vehicle" is meant according to the present invention, any substance which is added to the inhibitor of the invention to promote its transport, avoid its substantial degradation in said composition and preserve its inhibitory properties. The vehicle is chosen according to the type of application listed above of the composition.
La présente invention a aussi pour objet une méthode de traitement des maladies liées à une dérégulation de l'angiogenèse comme les cancers, l'artériosclérose et le diabète, consistant à administrer à un sujet soufrant d'une telle maladie une quantité efficace d'un inhibiteur ou d'une composition tels que décrits précédemment.The present invention also relates to a method of treatment of diseases linked to a deregulation of angiogenesis such as cancers, arteriosclerosis and diabetes, comprising administering to a subject suffering from such a disease an effective amount of a inhibitor or a composition as described above.
L'invention concerne encore l'utilisation d'un inhibiteur ou d'une composition tels que décrits précédemment pour la préparation d'un médicament destiné au traitement des maladies liées à l'angiogenèse, et plus particulièrement des maladies liées à une dérégulation de l'angiogenèse, et de préférence au traitement des cancers, de l'artériosclérose et du diabète.The invention also relates to the use of an inhibitor or of a composition as described above for the preparation of a medicament intended for the treatment of diseases linked to angiogenesis, and more particularly diseases linked to a deregulation of l angiogenesis, and preferably in the treatment of cancers, arteriosclerosis and diabetes.
L'invention concerne également l'utilisation d'un composé capable d'inhiber l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 pour la préparation d'un médicament destiné à la prévention et/ou au traitement des maladies liées à l'angiogenèse et, de préférence, au traitement des cancers, de l'artériosclérose et du diabète. Dans une première forme de mise en œuvre de la présente invention, un composé capable d'inhiber l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 est un inhibiteur compétitif du domaine HLH de TAL-1. De façon préférée, un tel composé est une molécule peptidique telle que précédemment définie. Dans une deuxième forme de mise en œuvre de la présente invention, un composé capable d'inhiber l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 est un composé capable d'inhiber la fixation de TAL-1 sur son partenaire E47. De façon préférée, un tel composé est un anticorps reconnaissant soit un épitope au niveau du domaine HLH de TAL-1, soit un épitope au niveau du domaine HLH de E47. Les applications et utilisations envisagées pour les inhibiteurs (inhibiteurs ou molécules peptidiques) précédemment décrites s'appliquent mutatis mutandis aux composés capables d'inhiber l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 (méthodes de traitement, compositions pharmaceutiques, etc.).The invention also relates to the use of a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 for the preparation of a medicament intended for the prevention and / or treatment of related diseases angiogenesis and, preferably, the treatment of cancer, arteriosclerosis and diabetes. In a first embodiment of the present invention, a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 is a competitive inhibitor of the HLH domain of TAL-1. Preferably, such a compound is a peptide molecule as defined above. In a second embodiment of the present invention, a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 is a compound capable of inhibiting the binding of TAL-1 to its partner E47. Preferably, such a compound is an antibody recognizing either an epitope at the HLH domain of TAL-1, or an epitope at the HLH domain of E47. The applications and uses envisaged for the inhibitors (inhibitors or peptide molecules) described above apply mutatis mutandis to the compounds capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 (treatment methods, pharmaceutical compositions, etc.).
Enfin, la présente invention concerne un procédé pour identifier un composé biologiquement actif susceptible d'être utilisé dans la prévention et/ou le traitement des maladies liées à l'angiogenèse et, de préférence, le traitement des cancers, de l'artériosclérose et du diabète consistant à détecter l'inhibition de l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 en présence dudit composé. Par "composé biologiquement actif", la présente invention concerne plus particulièrement tout composé chimique naturel ou synthétique tels que, à titre d'exemples et de façon non exhaustive, des protéines, des polypeptides, des peptides, des aptamères, des lipoprotéines, des polysaccharides, de petites molécules, des molécules non-peptidiques, etc.... Après l'identification dudit composé biologiquement actif, il sera facile tester son activité dans la prévention et/ou le traitement des maladies liées à l'angiogenèse et, de préférence, le traitement des cancers, de l'artériosclérose et du diabète par des méthodes bien connues de l'homme du métier.Finally, the present invention relates to a method for identifying a biologically active compound capable of being used in the prevention and / or treatment of diseases related to angiogenesis and, preferably, the treatment of cancers, arteriosclerosis and diabetes consisting in detecting the inhibition of the interaction between the HLH domain of TAL-1 and its partner E47 in the presence of said compound. By "biologically active compound", the present invention relates more particularly to any natural or synthetic chemical compound such as, by way of example and in a non-exhaustive manner, proteins, polypeptides, peptides, aptamers, lipoproteins, polysaccharides , small molecules, non-peptide molecules, etc. After the identification of said biologically active compound, it will be easy to test its activity in the prevention and / or treatment of diseases related to angiogenesis and, preferably , the treatment of cancers, arteriosclerosis and diabetes by methods well known to those skilled in the art.
L'homme du métier a à sa disposition différentes techniques lui permettant de vérifier si le composé biologiquement actif à tester est capable d'inhiber l'interaction entre le domaine HLH de TAL-1 et son partenaire E47. Dans une première forme de mise en œuvre, la méthode de l'invention comprend les étapes suivantes : (a) mettre en contact la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH), le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) et le composé biologiquement actif à tester, (b) immunoprécipiter soit la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH), soit le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1), (c) si, à l'étape (b), la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH) est immunoprécipitée, détecter dans le immunoprécipitat obtenu à l'étape (b), la présence du facteur de transcription E47 (ou d'un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1), (d) si, à l'étape (b), le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) est immunoprécipité, détecter dans 1' immunoprécipitat obtenu à l'étape (b), la présence de la protéine TAL-1 (ou d'un fragment de cette protéine comprenant le domaine HLH) , dans le cas où le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) n'est pas présent à l'étape (c) ou si la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH) n'est pas présente à l'étape (d), ledit composé est un agent susceptible d'être utilisé dans la prévention et/ou le traitement des maladies liées à l'angiogenèse et, de préférence, le traitement des cancers, de l'artériosclérose et du diabète.A person skilled in the art has at his disposal various techniques enabling him to check whether the biologically active compound to be tested is capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47. In a first embodiment, the method of the invention comprises the following steps: (a) bringing the TAL-1 protein (or a fragment of this protein comprising the HLH domain) into contact, the transcription factor E47 ( or a fragment of this factor comprising the domain which interacts with TAL-1) and the biologically active compound to be tested, (b) immunoprecipitate either the TAL-1 protein (or a fragment of this protein comprising the HLH domain), or the factor E47 transcript (or a fragment of this factor comprising the domain which interacts with TAL-1), (c) if, in step (b), the TAL-1 protein (or a fragment of this protein comprising the HLH domain ) is immunoprecipitated, detecting in the immunoprecipitate obtained in step (b), the presence of the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1), (d) if, step (b), the transcription factor E47 (or a fragment of this factor comprising ant the domain which interacts with TAL-1) is immunoprecipitated, detect in the immunoprecipitate obtained in step (b), the presence of the TAL-1 protein (or of a fragment of this protein comprising the HLH domain), in the case where the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) is not present in step (c) or if the protein TAL-1 (or a fragment of this protein comprising the HLH domain) is not present in step (d), said compound is an agent capable of being used in the prevention and / or treatment of diseases related to angiogenesis and, preferably, the treatment of cancers, arteriosclerosis and diabetes.
L'homme du métier a à sa disposition différentes protéines susceptibles d'être mises en œuvre dans le cadre de la méthode de l'invention. A titre d'exemples, la protéine E47 utilisable peut être la protéine de Gallus gallus présente dans Genbank sous le numéro CAE30454 ou la protéine de Mus musculus présente dans Genbank sous le numéro AAK18618. De la même façon, la protéine TAL-1 utilisable est la protéine de Homo sapiens présente dans Genbank sous le numéro P17542 ou la protéine de Mus musculus présente dans Genbank sous le numéro P22091. L'homme du métier connaît dans ces séquences les domaines particulièrement intéressants dans le cadre de la présente invention. A l'étape (b) de la méthode objet de la présente invention, l'homme du métier saura quel type d'anticorps utilisé en fonction de la protéine à immunoprécipiter (anticorps spécifique du facteur de transcription E47 (ou d'un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) ou anticorps spécifique de la protéine TAL-1 (ou d'un fragment de cette protéine comprenant le domaine HLH)). La détection, à l'étape (c), de la présence, dans 1' immunoprécipitat obtenu à l'étape (b), du facteur de transcription E47 (ou d'un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) peut être réalisée par toute technique de l'homme du métier comme, par exemple, un Western Blot utilisant un anticorps spécifique du facteur de transcription E47 (ou d'un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1), un dosage de l'activité du facteur de transcription E47 (ou d'un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) ou une méthode mettant en œuvre un facteur de transcription E47Those skilled in the art have at their disposal various proteins capable of being used in the context of the method of the invention. As examples, the protein E47 which can be used can be the Gallus gallus protein present in Genbank under the number CAE30454 or the Mus musculus protein present in Genbank under the number AAK18618. Similarly, the TAL-1 protein which can be used is the Homo sapiens protein present in Genbank under the number P17542 or the Mus musculus protein present in Genbank under the number P22091. Those skilled in the art know in these sequences the areas of particular interest in the context of the present invention. In step (b) of the method which is the subject of the present invention, the person skilled in the art will know what type of antibody used as a function of the protein to be immunoprecipitated (antibody specific for the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) or antibody specific for the TAL-1 protein (or a fragment of this protein comprising the HLH domain)). The detection, in step (c), of the presence, in the immunoprecipitate obtained in step (b), of the transcription factor E47 (or of a fragment of this factor comprising the domain which interacts with TAL- 1) can be performed by any technique skilled in the art such as, for example, a Western Blot using an antibody specific for the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1), an assay for the activity of the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) or a method using an transcription factor E47
5 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) marqué, ledit marquage pouvant être un marquage radioactif. La même mise en œuvre peut être réalisée mutatis mutandis pour la protéine TAL-1 (ou un fragment de cette5 (or a fragment of this factor comprising the domain which interacts with TAL-1) labeled, said labeling possibly being radioactive labeling. The same implementation can be carried out mutatis mutandis for the TAL-1 protein (or a fragment of this
10 protéine comprenant le domaine HLH) à l'étape (d).10 protein comprising the HLH domain) in step (d).
Dans une seconde forme de mise en œuvre, la méthode comprend les étapes suivantes : (a') mettre en contact la protéine TAL-1 (ou unIn a second form of implementation, the method comprises the following steps: (a ') bringing the TAL-1 protein (or a
15 fragment de cette protéine comprenant le domaine HLH), le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) et le composé biologiquement actif à tester, (b') faire migrer sur un gel de polyacrylamide non >0 dénaturant le mélange obtenu à l'étape (a'), (c') visualiser l'absence ou la présence du complexe TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH) et E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1). >5 L'absence de ce complexe à l'étape (C) met en évidence l'action inhibitrice du composé actif testé et donc que ce composé est un agent susceptible d'être utilisé dans la prévention et/ou le traitement des maladies liées à l'angiogenèse et, de préférence, le traitement des cancers, (0 de l'artériosclérose et du diabète.15 fragment of this protein comprising the HLH domain), the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) and the biologically active compound to be tested, (b ') migrate onto a gel polyacrylamide not> 0 denaturing the mixture obtained in step (a '), (c') visualize the absence or presence of the TAL-1 complex (or a fragment of this protein comprising the HLH domain) and E47 (or a fragment of this factor comprising the domain which interacts with TAL-1). > 5 The absence of this complex in step (C) highlights the inhibitory action of the active compound tested and therefore that this compound is an agent capable of being used in the prevention and / or treatment of related diseases to angiogenesis and, preferably, the treatment of cancers, (0 of arteriosclerosis and diabetes.
A l'étape (C) de la méthode objet de l'invention, différentes techniques connues de l'homme du métier peuvent être mises en œuvre. A titre d'exemples, on peut réaliserIn step (C) of the method which is the subject of the invention, various techniques known to those skilled in the art can be used. As examples, we can realize
15 un Western blot utilisant des anticorps spécifiques de l'une ou l'autre des protéines TAL-1 ou E47 ou de leurs fragments .15 Western blot using antibodies specific for either of the TAL-1 or E47 proteins or their fragments.
D'autres avantages et caractéristiques de l'invention apparaîtront à la lecture des exemples qui suivent concernant la préparation d'un composé constitué d'un inhibiteur de TAL-1 et d'un peptide vecteur ainsi que sur leurs effets in vitro et in vivo. Il sera fait référence aux dessins en annexe dans lesquels : - la figure 1 représente schématiquement la représentation du dimère HLH. - la figure 2 illustre l'inhibition de l'interaction de TAL-1 et E47 in vitro par les différents inhibiteurs. - la figure 3 illustre l'inhibition de l'interaction de TAL-1 et E47 in vitro par l'inhibiteur couplé à un peptide vecteur, - la figure 4 illustre l'effet des composés sur la survie des cellules endothéliales HUVEC, - la figure 5 illustre l'effet d'un des composés de l'invention sur la tubulogenèse in vitro des cellules endothéliales humaines après 22 heures de culture, la figure 6 présente l'effet des composés de l'invention sur l'angiogenèse in vivo chez la souris par analyse macroscopique des implants de Matrigel complémentés ou non par des composés de l'invention, la figure 7 présente l'effet des composés de l'invention sur l'angiogenèse in vivo chez la souris par dosage de l'hémoglobine contenue dans lesdits implants de Matrigel.Other advantages and characteristics of the invention will appear on reading the examples which follow concerning the preparation of a compound consisting of a TAL-1 inhibitor and a vector peptide as well as their effects in vitro and in vivo . Reference will be made to the appended drawings in which: FIG. 1 schematically represents the representation of the HLH dimer. - Figure 2 illustrates the inhibition of the interaction of TAL-1 and E47 in vitro by the various inhibitors. - Figure 3 illustrates the inhibition of the interaction of TAL-1 and E47 in vitro by the inhibitor coupled to a vector peptide, - Figure 4 illustrates the effect of the compounds on the survival of HUVEC endothelial cells, - the FIG. 5 illustrates the effect of one of the compounds of the invention on the in vitro tubulogenesis of human endothelial cells after 22 hours of culture, FIG. 6 shows the effect of the compounds of the invention on angiogenesis in vivo in the mouse by macroscopic analysis of the Matrigel implants complemented or not by compounds of the invention, FIG. 7 shows the effect of the compounds of the invention on angiogenesis in vivo in mice by assaying the hemoglobin contained in said Matrigel implants.
I - Synthèse Chimique. 1) Synthèse des inhibiteurs de TAL-1 libres et vectorisés. Les peptides ont été assemblés sur phase solide selon une stratégie Foc/tu, clivés et déprotégés par l'acide trifluoroacétique, puis purifiés par chromatographie haute pression préparative en phase inverse et lyophilisés, leur pureté (>95%) et leur identité ont été confirmées par HPLC analytique et par spectrométrie de masse. Séquence des peptides : SynB3 (H-RRLSYSRRRF-NH2 ; 1394.8 Da, SEQ ID No. 7 dans la liste de séquences en annexe), SynB4 (H- AWSFRVSYRGISYRRSR-NH2 ; 2145,1 Da, SEQ ID No. 6 dans la liste de séquences en annexe), Tal-HLH (H- QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA-NH2, SEQ ID No. 1 dans la liste de séquences en annexe)I - Chemical Synthesis. 1) Synthesis of free and vectorized TAL-1 inhibitors. The peptides were assembled on solid phase according to a Foc / tu strategy, cleaved and deprotected by acid trifluoroacetic, then purified by preparative high pressure chromatography in reverse phase and lyophilized, their purity (> 95%) and their identity were confirmed by analytical HPLC and by mass spectrometry. Peptide sequence: SynB3 (H-RRLSYSRRRF-NH2; 1394.8 Da, SEQ ID No. 7 in the attached sequence list), SynB4 (H- AWSFRVSYRGISYRRSR-NH2; 2145.1 Da, SEQ ID No. 6 in the list of sequences in the appendix), Tal-HLH (H- QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA-NH2, SEQ ID No. 1 in the list of sequences in the appendix)
2 ) Couplage des inhibiteurs sur les peptides vecteurs. Activation des vecteurs : Les peptides vecteurs SynB3 et SynB4 ont été traités par SPDP (N-Succinimidyl 3- (2- Pyridylthio)propionate) dans Dimethylformamide (DMF) en présence de DIEA (Diisopropylethylamine ) . Les peptides résultants (2-Pyridylthio)propionyl-SynB3 (1591.8 Da) et (2-Pyridylthio)propionyl-SynB4 (2342.1 Da) ont été purifiés par HPLC et lyophilisés. Préparation des conjugués : Chaque peptide vecteur activé (2-Pyridylthio)propionyl-SynBx (leq) a été solubilisé avec C-TalHLH (leq) dans DMF, en présence de DIEA de façon à former un pont dissulfure entre la chaîne latérale de la Cystéine de C-TalHLH (composé Tal-HLH synthétisé avec une cystéine en plus) et le 3-Mercapto- propionate porté par le vecteur. Les conjugués résultants (Tal-HLH-SynB3 ; 6303 Da et Tal-HLH-SynB4 ; 7052.6 Da) ont été précipités par addition d'éther, puis purifiés par HPLC et lyophilisés. Le contrôle de qualité par HPLC analytique à 220 nm et par spectrométrie de masse MALDI-TOF a confirmé les masses molaires et a déterminé une pureté supérieure à 96%. II - Composés testés. Les composés testés sont présentés dans le tableau 1 ci-après. Tableau 12) Coupling of inhibitors on vector peptides. Activation of the vectors: The vector peptides SynB3 and SynB4 were treated with SPDP (N-Succinimidyl 3- (2-Pyridylthio) propionate) in Dimethylformamide (DMF) in the presence of DIEA (Diisopropylethylamine). The resulting peptides (2-Pyridylthio) propionyl-SynB3 (1591.8 Da) and (2-Pyridylthio) propionyl-SynB4 (2342.1 Da) were purified by HPLC and lyophilized. Preparation of the conjugates: Each activated vector peptide (2-Pyridylthio) propionyl-SynBx (leq) was solubilized with C-TalHLH (leq) in DMF, in the presence of DIEA so as to form a dissulfide bridge between the side chain of Cysteine of C-TalHLH (compound Tal-HLH synthesized with an additional cysteine) and the 3-Mercaptopropionate carried by the vector. The resulting conjugates (Tal-HLH-SynB3; 6303 Da and Tal-HLH-SynB4; 7052.6 Da) were precipitated by addition of ether, then purified by HPLC and lyophilized. The quality control by analytical HPLC at 220 nm and by MALDI-TOF mass spectrometry confirmed the molar masses and determined a purity greater than 96%. II - Compounds tested. The compounds tested are presented in Table 1 below. Table 1
1) Test de traduction/immunoprécipitation. Les deux protéines TAL-1 et E47 sont co-traduites in vi tro en utilisant des plasmides permettant la transcription et la traduction des séquences codantes dans le système TNT-T7-coupled Reticulocyte Lysate, selon les conditions proposées par le fournisseur (Promega). La traduction est réalisée en présence de méthionine S35, avec addition ou non de peptides dissous dans une solution d'urée 2M. Une aliquote (1 μl) de chaque traduction est contrôlée par électrophorèse et autoradiographie du gel ; l'addition de peptide jusqu'à 0.7 μg dans le lysat de réticulocyte (volume final 25 μl) n'affecte pas l'efficacité de la traduction des deux protéines. Après une incubation de 30 min à 37°C, les produits de traduction sont immunoprécipités par un mélange1) Translation / immunoprecipitation test. The two proteins TAL-1 and E47 are co-translated in vi tro using plasmids allowing transcription and translation of coding sequences in the TNT-T7-coupled Reticulocyte Lysate system, according to the conditions offered by the supplier (Promega). Translation is carried out in the presence of methionine S 35 , with or without the addition of peptides dissolved in a 2M urea solution. An aliquot (1 μl) of each translation is checked by electrophoresis and autoradiography of the gel; addition of peptide up to 0.7 μg in the lysate of reticulocyte (final volume 25 μl) does not affect the translation efficiency of the two proteins. After a 30 min incubation at 37 ° C, the translation products are immunoprecipitated by a mixture
5 d'anticorps monoclonaux anti-TAL-1 (BTL 73 + 2TL 136 ; [Pulford et al., Blood 85 ; 675 (1995)] )puis analysés par électrophorèse et autoradiographie du gel. On quantifie l'interaction TAL-1-E47 pour chaque point en calculant le ratio E47/TAL-1 obtenu d'après le scan de5 of anti-TAL-1 monoclonal antibodies (BTL 73 + 2TL 136; [Pulford et al., Blood 85; 675 (1995)]) then analyzed by gel electrophoresis and autoradiography. The TAL-1-E47 interaction is quantified for each point by calculating the E47 / TAL-1 ratio obtained from the scan of
10 1 ' autoradiographie ; l'intensité de la bande correspondant à TAL-1 sert ici de normalisation dans tous les puits. L'interaction en absence de peptide est arbitrairement établie à 100 %.Autoradiography; the intensity of the band corresponding to TAL-1 is used here for normalization in all the wells. The interaction in the absence of peptide is arbitrarily established at 100%.
15 2) Test de cytotoxicité. Les cellules hématopoïétiques K562 ont été obtenues commercialement auprès de l'ATCC. Les cellules sont ensemencées à environ 104 cellules par puits, 24 h avant l'addition des produits. Elles sont alors à 60-80% de2) Cytotoxicity test. K562 hematopoietic cells were obtained commercially from ATCC. The cells are seeded at approximately 10 4 cells per well, 24 h before the addition of the products. They are then at 60-80% of
»0 confluence le jour de l'expérience. Les cellules sont maintenues en culture à 37°C dans une atmosphère à 95% d'humidité et 5% de C02 dans un milieu OptiMem®. Les cellules sont incubées soit avec les composés à des concentrations croissantes pendant 48 heures. A la fin»0 confluence on the day of the experiment. The cells are kept in culture at 37 ° C. in an atmosphere at 95% humidity and 5% CO 2 in an OptiMem® medium. The cells are incubated with either the compounds at increasing concentrations for 48 hours. At the end
!5 du temps de culture, le MTT (3-( 4, 5-diméthylthiazole-2-yl)- 2,5-diphényltétrazolium bromure) est rajouté dans les puits et les plaques de culture sont ensuite incubées pendant 4 heures dans l'étuve. Le dépôt cristallin de formazan résultant est alors dissous par addition de 200 μl de! 5 of the culture time, the MTT (3- (4, 5-dimethylthiazole-2-yl) - 2,5-diphenyltetrazolium bromide) is added to the wells and the culture plates are then incubated for 4 hours in the oven. The resulting crystalline formazan deposit is then dissolved by adding 200 μl of
(0 DMF/SDS. La densité optique (DO) est mesurée à 550 nm (référence 630 nm) en utilisant un lecteur de microplaques. La représentation graphique des pourcentages de DO des puits traités en fonction de la concentration de produits permet de déterminer la DL50. Celle-ci correspond à la concentration du produit inhibant 50% de la croissance.(0 DMF / SDS. The optical density (OD) is measured at 550 nm (reference 630 nm) using a microplate reader. The graphical representation of the OD percentages of the wells treated as a function of the concentration of products makes it possible to determine the LD 50. This corresponds at the concentration of the product inhibiting 50% of growth.
3 ) Test de survie des cellules endothéliales.3) Endothelial cell survival test.
5 Les cellules endothéliales humaines dérivées de la veine du cordon ombilical, HUVEC, (Clonetics) sont cultivées sur boîtes coatées avec de la gélatine dans du milieu EBM-2 complet (Clonetics) supplementé de 10 % de sérum de veau fœtal décomplémenté. Les cellules sont5 Human endothelial cells derived from the umbilical cord vein, HUVEC, (Clonetics) are cultured on dishes coated with gelatin in complete EBM-2 medium (Clonetics) supplemented with 10% of decomplemented fetal calf serum. The cells are
10 utilisées entre les passages 3 et 5. Les cellules ECV 304 (obtenues auprès de l'ATCC) sont cultivées en DMEM avec 10 % de sérum de veau fœtal décomplémenté. Les cellules sont décollées à la trypsine et suspendues dans un milieu sans sérum (OptiMEM, Invitrogen).10 used between passages 3 and 5. The ECV 304 cells (obtained from ATCC) are cultured in DMEM with 10% of decomplemented fetal calf serum. The cells are detached with trypsin and suspended in a serum-free medium (OptiMEM, Invitrogen).
15 Environ 8 103 cellules dans 200 μl sont incubées pendant 20 min en présence de différentes concentrations de peptides, centrifugées, puis ensemencées en milieu EBM2 complet dans des puits (plaque 48 puits) coatés avec du collagène I. Après 24 heures dans l'étuve, la survie cellulaire est15 About 8 10 3 cells in 200 μl are incubated for 20 min in the presence of different concentrations of peptides, centrifuged, then inoculated in complete EBM2 medium in wells (48-well plate) coated with collagen I. After 24 hours in the cell survival is
!0 estimée par un test MTT, réalisé selon les recommandations du fournisseur (Sigma).! 0 estimated by an MTT test, carried out according to the supplier's recommendations (Sigma).
III — Résultats. 1 ) Effet des peptides inhibiteurs sur l'interaction »5 de TAL-1/E47 in vitro. Nous avons choisi de tester si les composés décrits dans le Tableau 1 (Composés 1, 2 et 3) pouvaient affecter la formation des hétéro dimères TAL-1-E47, médiée par le domaine HLH des deux protéines . Le composé 1 contient toutIII - Results. 1) Effect of inhibitory peptides on the interaction » of TAL-1 / E47 in vitro. We chose to test whether the compounds described in Table 1 (Compounds 1, 2 and 3) could affect the formation of the hetero dimers TAL-1-E47, mediated by the HLH domain of the two proteins. Compound 1 contains everything
10 le domaine HLH de TAL-1 soit l'hélice 1- boucle-hélice 2 ; le composé 2 comprend la région basique et l'hélice 1 ; le composé 3 contient la boucle et l'hélice 2 (voir figure 1). Nous avons utilisé un test de co-immunoprécipitation de TAL-1 et E47 traduites in vitro par des anticorpsThe HLH domain of TAL-1, ie the helix 1-loop-helix 2; compound 2 includes the basic region and the helix 1; compound 3 contains the loop and the propeller 2 (see figure 1). We used a co-immunoprecipitation test of TAL-1 and E47 translated in vitro by antibodies
15 dirigés contre l'une des protéines. Nos expériences montrent que le composé Tal-HLH entier (composé 1) inhibe efficacement l'interaction de TAL-1 avec E47 et de façon dose-dépendante (50 à 60% d'inhibition avec 0.2 μg ; 90 à 100% avec 0.5 μg) (Figure 2 A et B). Les deux autres peptides inhibiteurs (composés 2 et 3) ont un plus faible pouvoir inhibiteur ne dépassant pas 50% dans les plus fortes concentrations (Figure 2A) . Nous avons donc choisi d'utiliser le peptide inhibiteur Tal-HLH (composé 1) pour la suite des expériences.15 directed against one of the proteins. Our experiments show that the whole Tal-HLH compound (compound 1) effectively inhibits the interaction of TAL-1 with E47 and in a dose-dependent manner (50 to 60% inhibition with 0.2 μg; 90 to 100% with 0.5 μg ) (Figure 2 A and B). The other two inhibitory peptides (compounds 2 and 3) have a weakest inhibitory power not exceeding 50% in the highest concentrations (Figure 2A). We therefore chose to use the inhibitory peptide Tal-HLH (compound 1) for the rest of the experiments.
2) Effet des peptides inhibiteurs couplés avec des peptides vecteurs sur l'interaction de TAL-1/E47 in vitro. Nous avons voulu savoir si la vectorisation ou le couplage du peptide inhibiteur Tal-HLH ne modifiait pas son effet inhibiteur sur l'interaction de TAL-1 in vitro avec E47. L'inhibiteur a été couplé à deux peptides vecteurs (SynB3 et SynB4 ) via une liaison dissulfure (composés 5 et 4, respectivement). Ces deux peptides vecteurs ont la propriété d'augmenter le transport des molécules à travers les membranes cellulaires. Les résultats présentés dans la figure 3 confirment que la vectorisation du peptide inhibiteur Tal-HLH ne modifie pas son effet inhibiteur. De manière intéressante, l'inhibiteur couplé au vecteur SynB3 (composé 5) s'est révélé plus actif que l'inhibiteur Tal- HLH (composé 1).2) Effect of inhibitor peptides coupled with vector peptides on the interaction of TAL-1 / E47 in vitro. We wanted to know if the vectorization or the coupling of the inhibitory peptide Tal-HLH did not modify its inhibitory effect on the interaction of TAL-1 in vitro with E47. The inhibitor was coupled to two vector peptides (SynB3 and SynB4) via a dissulfide bond (compounds 5 and 4, respectively). These two vector peptides have the property of increasing the transport of molecules across cell membranes. The results presented in FIG. 3 confirm that the vectorization of the inhibitory peptide Tal-HLH does not modify its inhibitory effect. Interestingly, the inhibitor coupled to the vector SynB3 (compound 5) was found to be more active than the inhibitor Tal-HLH (compound 1).
3 ) Effet des peptides inhibiteurs couplés sur les cellules hématopoïétiques . Dans un premier temps, l'effet de l'inhibiteur vectorisé a été étudié sur une lignée hématopoïétique (K562) dont la survie requiert l'activité de TAL-1. La lignée hématopoïétique T (H9) a été utilisée comme contrôle car sa croissance est indépendante de TAL-1. Ces deux lignées leucémiques peuvent survivre plusieurs jours en l'absence de facteurs de croissance, ce qui permet de tester l'effet des peptides dans un milieu dépourvu de sérum. Comme attendu, aucune différence significative n'a été observée dans les cellules H9 (TAL-1 négative), selon que le peptide Tal-HLH est vectorise ou non (résultats non montrés). Par contre, le peptide Tal-HLH a un effet cytotoxique plus élevé sur les cellules K562 (nécessitant l'activité de TAL-1) lorsqu'il est vectorise (Tableau 2). En effet la DL50, qui correspond à la concentration du produit inhibant 50% de la croissance, est deux fois plus faible pour l'inhibiteur vectorise (composé 4) que pour l'inhibiteur seul (composé 1).3) Effect of coupled inhibitory peptides on hematopoietic cells. First, the effect of the vectorized inhibitor was studied on a hematopoietic line (K562) whose survival requires the activity of TAL-1. The hematopoietic line T (H9) was used as a control because its growth is independent of TAL-1. These two leukemia lines can survive for several days in the absence of growth factors, which allows test the effect of the peptides in a medium devoid of serum. As expected, no significant difference was observed in H9 cells (TAL-1 negative), depending on whether the Tal-HLH peptide is vectorized or not (results not shown). In contrast, the Tal-HLH peptide has a higher cytotoxic effect on K562 cells (requiring the activity of TAL-1) when it is vectorized (Table 2). In fact, the LD50, which corresponds to the concentration of the product inhibiting 50% of growth, is twice lower for the vectorized inhibitor (compound 4) than for the inhibitor alone (compound 1).
Tableau 2Table 2
Ces résultats constituent une première validation que le peptide Tal-HLH vectorise (Composé 4) est capable d'inhiber spécifiquement l'activité de TAL-1 dans les cellules.These results constitute a first validation that the Tal-HLH peptide vectorizes (Compound 4) is capable of specifically inhibiting the activity of TAL-1 in cells.
4 ) Effet des peptides inhibiteurs couplés sur la survie des cellules endothéliales. Nous avons également étudié les effets de l'inhibiteur libre et vectorise sur la survie des cellules endothéliales. La figure 4 montre que le composé 1 n'a aucun effet sur la survie des cellules HUVEC. Par contre, une fois couplé (composés 4 et 5 ) il affecte spécifiquement la survie des cellules HUVECs et de façon dose-dépendante. Le couplage du produit par un peptide vecteur était important pour avoir un effet sur la survie car l'addition simultanée de l'inhibiteur et du peptide vecteur non- couplés n'avait aucun effet. Dans les cellules ECV 304, utilisées comme contrôle négatif, les composés ont induit une toxicité cellulaire non spécifique qu'ils soient couplés ou non-couplés (résultats non montrés). 5 Ces expériences démontrent l'effet spécifique de l'inhibiteur de TAL-1 lorsqu'il pénètre dans les cellules endothéliales grâce au vecteur peptidique.4) Effect of coupled inhibitory peptides on the survival of endothelial cells. We also studied the effects of the free and vector inhibitor on the survival of endothelial cells. Figure 4 shows that compound 1 has no effect on the survival of HUVEC cells. On the other hand, once coupled (compounds 4 and 5) it specifically affects the survival of HUVECs cells and in a dose-dependent manner. The coupling of the product with a vector peptide was important to have an effect on survival since the simultaneous addition of the inhibitor and the non-vector peptide coupled had no effect. In ECV 304 cells, used as a negative control, the compounds induced non-specific cellular toxicity whether they are coupled or uncoupled (results not shown). These experiments demonstrate the specific effect of the TAL-1 inhibitor when it enters endothelial cells using the peptide vector.
5) Effet des peptides sur la tubulogenèse in vi tro0 des cellules endothéliales humaines (gels de collaqene en 3-D) . Les cellules endothéliales HUVEC ensemencées au sein d'un gel de collagène I concentré (lmg/ml) s'arrêtent de proliférer et, en présence de milieu d'activation (MDCB131,5) Effect of peptides on the in vitro tubulogenesis of human endothelial cells (collaqene gels in 3-D). The HUVEC endothelial cells seeded in a concentrated collagen I gel (1 mg / ml) stop proliferating and, in the presence of activation medium (MDCB131,
15 1% sérum de veau fœtal, VEGF 2 ng/ml, bFGF 20 ng/ml et PMA 80 nM) , elles s'organisent rapidement en cordons cellulaires pour constituer un réseau primitif ; dans les 24-48 hrs, les cellules alignées s'allongent, fusionnent entre elles et forment progressivement des pseudos tubules.15 1% fetal calf serum, VEGF 2 ng / ml, bFGF 20 ng / ml and PMA 80 nM), they are quickly organized into cellular cords to form a primitive network; within 24-48 hrs, the aligned cells lengthen, merge with each other and gradually form pseudo-tubules.
20 Nous avons testé les effets du peptide HLH vectorise (composé 1) dans ce système de tubulogenèse in vitro de cellules endothéliales humaines issues de cordon ombilical (HUVECs). Des concentrations croissantes de peptide vectorise (composé 5) ou de cargo seul (composé 1) ont été20 We tested the effects of the vectorized HLH peptide (compound 1) in this system of in vitro tubulogenesis of human endothelial cells from umbilical cord (HUVECs). Increasing concentrations of vectorized peptide (compound 5) or cargo alone (compound 1) have been
25 ajoutées à la fois dans la solution de collagène contenant les cellules et dans le milieu d'activation. La figure 5 illustre une de ces expériences : le peptide HLH vectorise (composé 5) affecte très fortement la tubulogenèse entre 7 et 10 μM alors que le cargo seul25 added both to the collagen solution containing the cells and to the activation medium. Figure 5 illustrates one of these experiments: the vectorized HLH peptide (compound 5) very strongly affects tubulogenesis between 7 and 10 μM while the cargo alone
$0 (composé 1) n'a aucun effet dans cette gamme de concentration par rapport aux cultures contrôles (5% DMSO).$ 0 (compound 1) has no effect in this concentration range compared to the control cultures (5% DMSO).
6) Effet des peptides sur l'angiogenèse in vivo chez la souris (Matrigel plugs). Le test de Matrigel plugs consiste à injecter en sous-cutané chez la souris du Matrigel, matrice extracellulaire dérivée d'une tumeur murine, capable de déclencher une néovascularisation au sein de l'implant. En effet, les cellules endothéliales de l'hôte, sous l'influence des facteurs pro-angiogéniques contenues dans le Matrigel, migrent vers cette « pseudo-tumeur » et s'infiltrent dans le Matrigel pour organiser un réseau de capillaires entre 5 et 7 jours. Dans les expériences décrites ci-dessous, deux injections sous-cutanées de Matrigel (500 μl) ont été effectuées de par et d'autre de la ligne médiane de l'abdomen. Juste avant l'injection, les souris ont été anesthésiées par inhalation d'isoflurane (Forène®).6) Effect of peptides on angiogenesis in vivo in mice (Matrigel plugs). The Matrigel plugs test consists of injecting Matrigel, an extracellular matrix derived from a murine tumor, subcutaneously into the mouse, capable of triggering neovascularization within the implant. Indeed, the endothelial cells of the host, under the influence of the pro-angiogenic factors contained in the Matrigel, migrate towards this "pseudo-tumor" and infiltrate in the Matrigel to organize a network of capillaries between 5 and 7 days. In the experiments described below, two subcutaneous injections of Matrigel (500 μl) were carried out on either side of the midline of the abdomen. Just before the injection, the mice were anesthetized by inhalation of isoflurane (Forene®).
Le Matrigel (BDBiosciences ; lot 10403, 13 mg/ml) a été complémenté par du bFGF (500 ng/ml), de l'héparine (60 U/ml) et les différents peptides SynB3 (composé 7), SynB3- HLH (composé 5), SynB4 (composé 6), SynB4-HLH (composé 4) sont ajoutés à une concentration finale de 20 μM en 5% DMSO.Matrigel (BDBiosciences; lot 10403, 13 mg / ml) was supplemented with bFGF (500 ng / ml), heparin (60 U / ml) and the various peptides SynB3 (compound 7), SynB3- HLH ( compound 5), SynB4 (compound 6), SynB4-HLH (compound 4) are added to a final concentration of 20 μM in 5% DMSO.
Les souris ont été divisées en 3 groupes de six animaux identiques (mâles C57BL/6 âgés de 6 semaines). - chaque souris du groupe témoin (souris 1 à 6) a reçu deux injections de Matrigel contenant 5% de DMSO du côté gauche et un peptide témoin anti-angiogénique du côté droit, - chaque souris du groupe « SynB3 » (souris 7 à 12) a reçu deux injections de Matrigel contenant SynB3 du côté gauche et SynB3-HLH du côté droit, - chaque souris du groupe « SynB4 » (souris 13 à 18) a reçu deux injections de Matrigel contenant SynB4 du côté gauche et SynB4-HLH du côté droit. Six jours après l'injection, les souris ont été sacrifiées par inhalation de C02 et les implants ont été récupérés pour évaluer l'angiogenèse (photographie et dosage de l'hémoglobine). L'angiogenèse a été quantifiée par dosage de l'hémoglobine contenue dans les implants de Matrigel avec une solution de Drabkin selon les recommandations du vendeur (Sigma Chemical Co). Les résultats présentés sur les figures 6 (analyse macroscopique) et 7 (dosage de l'hémoglobine), montrent que l'addition des peptides vecteurs seuls n'a pas d'effets significatifs sur l'angiogenèse ; par contre le peptide HLH conjugué avec l'un ou l'autre des vecteurs inhibe efficacement la néovascularisation dans les implants (11 sur 12). Cette inhibition était beaucoup plus importante que celle obtenue par un inhibiteur (Tum) connu pour inhiber l'angiogenèse. The mice were divided into 3 groups of six identical animals (C57BL / 6 males 6 weeks old). - each mouse in the control group (mice 1 to 6) received two injections of Matrigel containing 5% DMSO on the left side and an anti-angiogenic control peptide on the right side, - each mouse in the “SynB3” group (mice 7 to 12 ) received two injections of Matrigel containing SynB3 on the left side and SynB3-HLH on the right side, - each mouse in the "SynB4" group (mice 13 to 18) received two injections of Matrigel containing SynB4 on the left side and SynB4-HLH of the right side. Six days after the injection, the mice were sacrificed by CO 2 inhalation and the implants were recovered to assess angiogenesis (photography and hemoglobin assay). The angiogenesis was quantified by assaying the hemoglobin contained in the implants of Matrigel with a Drabkin solution according to the recommendations of the seller (Sigma Chemical Co). The results presented in FIGS. 6 (macroscopic analysis) and 7 (determination of hemoglobin) show that the addition of the vector peptides alone has no significant effects on angiogenesis; on the other hand, the HLH peptide conjugated with one or the other of the vectors effectively inhibits neovascularization in the implants (11 of 12). This inhibition was much greater than that obtained by an inhibitor (Tum) known to inhibit angiogenesis.

Claims

REVENDICATIONS
1) Molécule peptidique capable d'interférer avec le domaine HLH de TAL-1, constituée par ou comprenant au moins 10 acides aminés successifs et, de préférence, au moins 15 acides aminés successifs du domaine HLH de TAL-1 de séquence : QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA correspondant à la SEQ ID No. 1 dans le listage de séquences en annexe ou une séquence équivalente.1) Peptide molecule capable of interfering with the HLH domain of TAL-1, consisting of or comprising at least 10 successive amino acids and, preferably, at least 15 successive amino acids of the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA to SEQ ID No. 1 in the sequence listing in the appendix or an equivalent sequence.
2) Molécule peptidique selon la revendication 1, caractérisée en ce qu'elle est constituée par ou qu'elle comprend une séquence choisie parmi les séquences suivantes : - QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 dans la liste de séquences en annexe), -VRRIFTNSRERWRQQNVNGAFAELRKLI (SEQ ID No. 2 dans la liste de séquences en annexe) et - PTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 3 dans la liste de séquences en annexe) ou une séquence équivalente auxdites séquences.2) Peptide molecule according to claim 1, characterized in that it is constituted by or that it comprises a sequence chosen from the following sequences: - QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1 in the sequence list in the appendix), -VRRIFTNSRERWRQQNVNGAFAELK (SEQ ID No. 2 in the annexed sequence list) and - PTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 3 in the annexed sequence list) or a sequence equivalent to said sequences.
3) Molécule peptidique selon l'une quelconque des revendications 1 ou 2, caractérisée en ce qu'elle est associée à un vecteur.3) Peptide molecule according to any one of claims 1 or 2, characterized in that it is associated with a vector.
4) Molécule peptidique selon la revendication 3, caractérisée en ce que ledit vecteur est choisi, parmi le groupe comprenant : - un peptide linéaire dérivé de protégrines ou de tachyplésines , un peptide linéaire comprenant un domaine de transduction tels que les domaines de transduction de la protéine Tat de HIV-1 et les domaines de transduction dérivés de la troisième hélice d'Antennapedia,4) A peptide molecule according to claim 3, characterized in that said vector is chosen from the group comprising: - a linear peptide derived from protectins or tachyplines, a linear peptide comprising a transduction domain such as the transduction domains of HIV-1 Tat protein and transduction domains derived from the third helix from Antennapedia,
- des particules comme les liposomes, - des polymères tels que le polyéthylène glycol- particles such as liposomes, - polymers such as polyethylene glycol
(PEG) .(PEG).
5) Molécule peptidique selon l'une quelconque des revendications 3 ou 4, caractérisée en ce que ledit vecteur est un peptide linéaire dérivé de Protégrines, répondant à la formule ( I ) suivante : BX(X ou B)BXXXXBBBXXXXXXB (I) ou un peptide linéaire dérivé de Tachyplésines, répondant à la formule (II) suivante : (B ou X)XXXBXXXBXXXXBBXB (II), dans lesquelles : les groupes B, identiques ou différents, représentent un résidu d'acide aminé dont la chaîne latérale porte un groupement basique, et - les groupes X, identiques ou différents, représentent un résidu d'acide aminé aliphatique ou aromatique ou un fragment de ceux-ci constitué d'une séquence d'au moins 5 et de préférence d'au moins 7 acides aminés successifs des peptides de formules (I) ou (II).5) Peptide molecule according to any one of claims 3 or 4, characterized in that said vector is a linear peptide derived from Proteins, corresponding to the following formula (I): BX (X or B) BXXXXBBBXXXXXXB (I) or a linear peptide derived from Tachyplines, corresponding to the following formula (II): (B or X) XXXBXXXBXXXXBBXB (II), in which: the groups B, identical or different, represent an amino acid residue whose side chain carries a group basic, and - the groups X, identical or different, represent an aliphatic or aromatic amino acid residue or a fragment thereof consisting of a sequence of at least 5 and preferably at least 7 successive amino acids peptides of formulas (I) or (II).
6) Molécule peptidique selon l'une quelconque des revendications 3 à 5, caractérisée en ce que la liaison entre ladite molécule et ledit vecteur est choisie parmi une liaison covalente, une liaison hydrophobe, une liaison ionique, une liaison clivable ou une liaison non clivable dans les milieux physiologiques ou à l'intérieur des cellules . 7) Molécule peptidique selon la revendication 6, caractérisée en ce que ladite liaison peut être directe ou indirecte par l'intermédiaire d'un bras de liaison (linker) et effectuée au moyen d'un groupe fonctionnel naturellement présent ou introduit soit sur le vecteur, soit sur l'inhibiteur, soit sur les deux.6) Peptide molecule according to any one of claims 3 to 5, characterized in that the bond between said molecule and said vector is chosen from a covalent bond, a hydrophobic bond, an ionic bond, a cleavable bond or a non-cleavable bond in physiological media or inside cells. 7) peptide molecule according to claim 6, characterized in that said bond can be direct or indirect via a linker arm (linker) and carried out by means of a functional group naturally present or introduced either on the vector , either on the inhibitor, or on both.
8) Molécule peptidique selon l'une quelconque des revendications précédentes, caractérisée en ce qu'elle est choisie parmi les deux composés suivants : - composé 4 : K K L S K N E I L R L A M K Y I N F L A—NH, - composé 5 : T H P P D K K L S K N E I L R L A M K Y I N F L A-NH, 8) Peptide molecule according to any one of the preceding claims, characterized in that it is chosen from the following two compounds: - compound 4: KKLSKNEILRLAMKYINFLA-NH, - compound 5: THPPDKKLSKNEILRLAMKYI NFL A-NH,
9) Composition pharmaceutique comprenant comme principe actif au moins une molécule peptidique selon l'une quelconque des revendications précédentes, avantageusement associée dans ladite composition à un véhicule acceptable.9) Pharmaceutical composition comprising as active principle at least one peptide molecule according to any one of the preceding claims, advantageously combined in said composition with an acceptable vehicle.
10) Composition pharmaceutique selon la revendication 9, caractérisée en ce qu'elle se présente sous une forme appropriée pour une administration par voie parentérale, par voie orale, par voie rectale, par voie nasale, par voie transdermique, par voie pulmonaire ou par voie centrale.10) Pharmaceutical composition according to claim 9, characterized in that it is in a form suitable for administration by the parenteral route, by the oral route, by the rectal route, by the nasal route, by the transdermal route, by the pulmonary route or by the Central.
11) Utilisation d'un composé capable d'inhiber l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 pour la préparation d'un médicament destiné à la prévention et/ou au traitement des maladies liées à l'angiogenèse et, de préférence, au traitement des cancers, de l'artériosclérose et du diabète. 12) Utilisation selon la revendication 11, caractérisée en ce que ledit composé est un inhibiteur compétitif du domaine HLH de TAL-1. 13) Utilisation selon l'une quelconque des revendications 11 ou 12, caractérisée en ce que ledit composé est une molécule peptidique telle que définie dans l'une quelconque des revendications 1 à 8. 14) Utilisation selon la revendication 11, caractérisée en ce que ledit composé est un composé capable d'inhiber la fixation de TAL-1 sur son partenaire E47.11) Use of a compound capable of inhibiting the interaction between the HLH domain of TAL-1 and its partner E47 for the preparation of a medicament intended for the prevention and / or treatment of diseases linked to angiogenesis and , preferably, to the treatment of cancers, arteriosclerosis and diabetes. 12) Use according to claim 11, characterized in that said compound is a competitive inhibitor of the HLH domain of TAL-1. 13) Use according to any one of claims 11 or 12, characterized in that said compound is a peptide molecule as defined in any one of claims 1 to 8. 14) Use according to claim 11, characterized in that said compound is a compound capable of inhibiting the binding of TAL-1 to its partner E47.
15) Utilisation selon l'une quelconque des revendications 11 ou 14, caractérisée en ce que ledit composé est un anticorps reconnaissant soit un épitope au niveau du domaine HLH de TAL-1, soit un épitope au niveau du domaine HLH de E47. 16) Procédé pour identifier un composé biologiquement actif susceptible d'être utilisé dans la prévention et/ou le traitement des maladies liées à l'angiogenèse et, de préférence, le traitement des cancers, de l'artériosclérose et du diabète consistant à détecter l'inhibition de l'interaction entre le domaine HLH de TAL-1 et son partenaire E47 en présence dudit composé.15) Use according to any one of claims 11 or 14, characterized in that said compound is an antibody recognizing either an epitope at the HLH domain of TAL-1, or an epitope at the HLH domain of E47. 16) Method for identifying a biologically active compound capable of being used in the prevention and / or treatment of diseases related to angiogenesis and, preferably, the treatment of cancers, arteriosclerosis and diabetes, consisting in detecting the inhibition of the interaction between the HLH domain of TAL-1 and its partner E47 in the presence of said compound.
17) Procédé selon la revendication 16, caractérisé en ce que ledit procédé comprend les étapes suivantes : (a) mettre en contact la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH), le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine HLH) et le composé biologiquement actif à tester, (b) immunoprécipiter soit la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH), soit le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine HLH), (c) si, à l'étape (b), la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH) est immunoprécipitée, détecter dans l' immunoprécipitat obtenu à l'étape (b), la présence du facteur de transcription E47 (ou d'un fragment de ce facteur comprenant le domaine HLH), (d) si, à l'étape (b), le facteur de transcription17) A method according to claim 16, characterized in that said method comprises the following steps: (a) contacting the TAL-1 protein (or a fragment of this protein comprising the HLH domain), the transcription factor E47 (or a fragment of this factor comprising the HLH domain) and the biologically active compound to be tested, (b) immunoprecipitate either the TAL-1 protein (or a fragment of this protein comprising the HLH domain), or the transcription factor E47 (or a fragment of this factor comprising the HLH domain), (c) if, with step (b), the TAL-1 protein (or a fragment of this protein comprising the HLH domain) is immunoprecipitated, detecting in the immunoprecipitate obtained in step (b), the presence of the transcription factor E47 (or a fragment of this factor comprising the HLH domain), (d) if, in step (b), the transcription factor
E47 (ou un fragment de ce facteur comprenant le domaine HLH) est immunoprécipité, détecter dans l' immunoprécipitat obtenu à l'étape (b), la présence de la protéine TAL-1 (ou d'un fragment de cette protéine comprenant le domaine HLH), dans le cas où le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine HLH n'est pas présent à l'étape (c) ou si la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH) n'est pas présente à l'étape (d), ledit composé est un agent susceptible d'être utilisé dans la prévention et/ou le traitement des maladies liées à l'angiogenèse et, de préférence, le traitement des cancers, de l'artériosclérose et du diabète. 18) Procédé selon la revendication 16, caractérisé en ce que, ledit procédé comprend les étapes suivantes : (a') mettre en contact la protéine TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH), le facteur de transcription E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1) et le composé biologiquement actif à tester, (b' ) faire migrer sur un gel de polyacrylamide non dénaturant le mélange obtenu à l'étape (a'), (c') visualiser l'absence ou la présence du complexe TAL-1 (ou un fragment de cette protéine comprenant le domaine HLH) et E47 (ou un fragment de ce facteur comprenant le domaine qui interagit avec TAL-1). E47 (or a fragment of this factor comprising the HLH domain) is immunoprecipitated, detecting in the immunoprecipitate obtained in step (b), the presence of the TAL-1 protein (or of a fragment of this protein comprising the domain HLH), in the case where the transcription factor E47 (or a fragment of this factor comprising the HLH domain is not present in step (c) or if the TAL-1 protein (or a fragment of this protein comprising the HLH domain) is not present in step (d), said compound is an agent capable of being used in the prevention and / or treatment of diseases related to angiogenesis and, preferably, the treatment of 18) Method according to claim 16, characterized in that, said method comprises the following steps: (a ') bringing the TAL-1 protein (or a fragment of this protein comprising the HLH domain), the transcription factor E47 (or a fragment of this factor comprising the domain which interacts with TAL-1) and the biologically active compound to be tested, (b ') migrating on a non-denaturing polyacrylamide gel the mixture obtained in step (a'), (c ') view the absence or presence of the TAL-1 complex (or a fragment of this protein comprising the HLH domain) and E47 (or a fragment of this factor including the domain which interacts with TAL-1).
EP05717534A 2004-02-02 2005-02-02 Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation Withdrawn EP1711521A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
FR0400964A FR2865735B1 (en) 2004-02-02 2004-02-02 INHIBITORS OF ANGIOGENESIS, COMPOSITIONS CONTAINING SAME AND USE THEREOF FOR THE TREATMENT OF DISEASES ASSOCIATED WITH DEREGULATION OF ANGIOGENESIS
FR0405954A FR2865736B1 (en) 2004-02-02 2004-06-02 INHIBITORS OF ANGIOGENESIS, COMPOSITIONS CONTAINING SAME AND USE THEREOF FOR THE TREATMENT OF DISEASES ASSOCIATED WITH DEREGULATION OF ANGIOGENESIS
PCT/FR2005/000222 WO2005075509A1 (en) 2004-02-02 2005-02-02 Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation

Publications (1)

Publication Number Publication Date
EP1711521A1 true EP1711521A1 (en) 2006-10-18

Family

ID=34751806

Family Applications (1)

Application Number Title Priority Date Filing Date
EP05717534A Withdrawn EP1711521A1 (en) 2004-02-02 2005-02-02 Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation

Country Status (7)

Country Link
US (1) US20070161553A1 (en)
EP (1) EP1711521A1 (en)
JP (1) JP2008505848A (en)
AU (1) AU2005210063A1 (en)
CA (1) CA2554822A1 (en)
FR (1) FR2865736B1 (en)
WO (1) WO2005075509A1 (en)

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2700893A1 (en) 2007-10-12 2009-04-16 Arqule, Inc. Substituted tetrazole compounds and uses thereof
FR2944020B1 (en) * 2009-04-02 2011-06-10 Etat Francais Ministere De La Defense Service De Sante Des Armees PEPTIDES FUSION FOR THE TREATMENT OF TRAUMA OR DISEASES AFFECTING THE CENTRAL NERVOUS SYSTEM
CA2841404C (en) 2011-02-11 2022-04-26 Sohail TAVAZOIE Treatment of angiogenesis disorders
WO2014028461A2 (en) 2012-08-13 2014-02-20 The Rockefeller University Treatment and diagnosis of melanoma
EP3091970B1 (en) 2014-01-10 2020-10-28 Rgenix, Inc. Lxr agonists and uses thereof
WO2019104062A1 (en) 2017-11-21 2019-05-31 Rgenix, Inc. Polymorphs and uses thereof
JP2023509845A (en) 2019-12-13 2023-03-10 インスピルナ，インコーポレーテッド Metal salt and its use

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000009657A2 (en) * 1998-08-14 2000-02-24 President And Fellows Of Harvard College Methods of modulating of angiogenesis
FR2810985B1 (en) * 2000-07-03 2004-12-24 Synt Em AMPHIPATHIC LINEAR PEPTIDES AND COMPOSITIONS CONTAINING THEM
EP2529758A3 (en) * 2003-01-27 2013-01-02 Endocyte, Inc. Vitamin receptor binding drug delivery conjugates

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2005075509A1 *

Also Published As

Publication number Publication date
FR2865736B1 (en) 2006-07-14
JP2008505848A (en) 2008-02-28
AU2005210063A1 (en) 2005-08-18
CA2554822A1 (en) 2005-08-18
US20070161553A1 (en) 2007-07-12
WO2005075509A1 (en) 2005-08-18
FR2865736A1 (en) 2005-08-05

Similar Documents

Publication Publication Date Title
EP2547692B1 (en) Peptide derivatives, preparation thereof and uses thereof as vectors
WO2005075509A1 (en) Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation
JP6084207B2 (en) High affinity dimer inhibitor of PSD-95 as an efficient neuroprotective agent for the treatment of ischemic brain injury and pain
WO2010046588A1 (en) Peptide derivatives and use thereof as carriers for molecules in the form of conjugates
CA2298932A1 (en) Linear peptides derived from antibiotic peptides, preparation and use for vectoring active substances
KR102017645B1 (en) Inhibitors of Apoptosis and Uses Thereof
EP1259541A2 (en) Amino acid sequences facilitating penetration of a substance of interest into cells and/or cell nuclei
Philippe et al. Cell membrane composition drives selectivity and toxicity of designed cyclic helix–loop–helix peptides with cell penetrating and tumor suppressor properties
FR2829940A1 (en) New composition, useful for treating central nervous system diseases, comprises an antibody linked to a linear peptide and is able to cross the blood-brain barrier
EP2729495B1 (en) Peptidic antagonist of the binding between cd47 and a protein belonging to the family of thrombospondin
KR100935030B1 (en) New cell penetrating peptides and method for delivery of biologically active agents using thereof
EP1135169B1 (en) Use of a pharmaceutical composition comprising an anti-cancer agent and at least a peptide
CA2504270C (en) Peptide fragments of the harp factor inhibiting angiogenesis
EP2118137B1 (en) Peptides and polypeptides with improved stability useful in the regeneration of the nervous system
EP2448594B1 (en) Dermaseptin b2 used as an inhibitor of the growth of a tumor
FR2865735A1 (en) Angiogenesis inhibitor useful in the treatment of, e.g. cancer or arteriosclerosis, comprises peptide molecule able to interfere with HLH domain of TAL-1
FR2941230A1 (en) ADDRESSING POLYPEPTIDES SPECIFIC TO OTX2 TARGET CELLS
FR2830016A1 (en) New taxoid compound-peptide coupling products, are water-soluble and readily cross the blood-brain barrier, useful for treating cancer, especially brain cancer
US20230095144A1 (en) Amyloid inhibitory peptides
JP5940542B2 (en) Skin introduction system and whitening agent combining cell introduction peptide and skin introduction accelerator
Lin Development of Targeted Pro-angiogenic Therapies for Ischemic Diabetic Foot Ulcer Repair
WO2009153418A1 (en) Harp peptides inhibiting tumour growth
THOMAS Patent 2888653 Summary

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20060726

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU MC NL PL PT RO SE SI SK TR

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20080104

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20091210