EP1692176A1 - Anti-igf-i receptor antibody - Google Patents
Anti-igf-i receptor antibodyInfo
- Publication number
- EP1692176A1 EP1692176A1 EP04811082A EP04811082A EP1692176A1 EP 1692176 A1 EP1692176 A1 EP 1692176A1 EP 04811082 A EP04811082 A EP 04811082A EP 04811082 A EP04811082 A EP 04811082A EP 1692176 A1 EP1692176 A1 EP 1692176A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- antibody
- therapeutic agent
- seq
- igf
- receptor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39541—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- Insulin-like growth factor-I receptor is a transmembrane heterotetrameric protein, which has two extracellular alpha chains -and two membrane- spanning beta chains in a disulfide-linked ⁇ - ⁇ - ⁇ - ⁇ configuration.
- the binding of the ligands, which are insulin-like growth-factor-I (IGF-I) and insulin-like growth factor-II (IGF- II) by the extracellular domain of IGF-I receptor activates its intracellular tyrosine kinase domain resulting in autophosphorylation of the receptor and substrate phosphorylation.
- IGF-I receptor and its ligands play important roles in numerous physiological processes including growth and development during embryogenesis, metabolism, cellular proliferation and cell differentiation in adults (LeRoith, D., 2000, Endocrinology, 141, 1287-1288; LeRoith, D., 1997, New England! Med, 336, 633-640).
- IGF-I and IGF-II function both as endocrine hormones in the blood, where they are predominantly present in complexes with IGF-binding proteins, and as paracrine and autocrine growth factors that are produced locally (Humbel, R. E., 1990, Eur. J. Biochem., 190, 445-462; Cohick, W. S. and Clemmons, D. R., 1993, Annu. Rev. Physiol. 55, 131-153).
- the IGF-I receptor has been implicated in promoting growth, transformation and survival of tumor cells (Baserga, R. et al., 1997, Biochem. Biophys. Ada, 1332, F105-F126; Blakesley, N. A.
- IGF-I and IGF-II have been shown to be potent mitogens for several human tumor cell lines such as lung cancer, breast cancer, colon cancer, osteosarcoma and cervical cancer (Ankrapp, D. P. and Bevan, D.
- IGF-I or IGF-II which may stimulate their growth in an autocrine or paracrine manner.
- the IGF-I receptor protects tumor cells from apoptosis caused by growth factor deprivation, anchorage independence or cytotoxic drug treatment (Navarro, M. and Baserga, R., 2001, Endocrinology, 142, 1073-1081; Baserga, R. et al., 1997, Biochem. Biophys. Acta, 1332, F105-F126).
- IGF-I receptor The domains of IGF-I receptor that are critical for its mitogenic, transforming and anti-apoptotic activities have been identified by mutational analysis.
- the tyrosine 1251 residue of IGF-I receptor has been identified as critical for anti-apoptotic and transformation activities but not for its mitogenic activity (O'Connor, R. et al, 1997, Mol. Cell. Biol, 17, 427-435; Miura, M. et al., 1995, J. Biol. Chem., 270, 22639-22644).
- the intracellular signaling pathway of ligand-activated IGF-I receptor involves phosphorylation of tyrosine residues of insulin receptor substrates (IRS-1 and IRS-2), which recruit phosphatidylinositol-3 -kinase (PI-3-kinase) to the membrane.
- IRS-1 and IRS-2 insulin receptor substrates
- PI-3-kinase phosphatidylinositol-3 -kinase
- the membrane-bound phospholipid products of PI-3 -kinase activate a serine/threonine kinase Akt, whose substrates include the pro-apoptotic protein BAD which is phosphorylated to an inactive state (Datta, S. R., Brunet, A. and Greenberg, M. E., 1999, Genes & Development, 13, 2905-2927; Kulik, G., Klippel, A.
- IGF-I receptor an attractive therapeutic target, based upon the hypothesis that tumor cells are more susceptible than normal cells to apoptosis by inhibition of IGF-I receptor (Resnicoff, M. et al., 1995, Cancer Res., 55, 2463-2469; Baserga, R., 1995, Cancer Res., 55, 249-252).
- Another strategy to inhibit the function of IGF-I receptor in tumor cells has been to use anti-IGF-I receptor antibodies which bind to the extracellular domains of IGF-I receptor and inhibit its activation.
- the TR3 antibody was developed using a partially purified placental preparation of insulin receptor to immunize mice, which yielded an antibody, IR1, that was selective for binding insulin receptor, and two antibodies, IR2 and IR3, that showed preferential immunoprecipitation of IGF-I receptor (somatomedin-C receptor) but also weak immunoprecipitation o ' f insulin receptor (Kull, F. C. et al., 1983, J. Biol. Chem., 258, 6561- 6566).
- IR3 antibody is the most commonly used inhibitory antibody for IGF-I receptor studies in vitro, it suffers from the drawback that it exhibits agonistic activity in transfected 3T3 and CHO cells expressing human IGF-I receptor (Kato, H. et al., 1993, J. Biol. Chem., 268, 2655-2661; Steele-Perkins, G. and Roth, R. A., 1990, Biochem. Biophys. Res. Commun., 171, 1244-1251).
- the most inhibitory antibodies 24-57 and 24-60 also showed agonistic activities in the transfected 3T3 cells (Soos, M. A.
- IR3 antibody is reported to inhibit the binding of IGF-I (but not IGF-II) to expressed receptors in intact cells and after solubilization, it is shown to inhibit the ability of both IGF-I and IGF-II to stimulate DNA synthesis in cells in vitro (Steele-Perkins, G. and Roth, R. A., 1990, Biochem. Biophys. Res. Commun., 171, 1244-1251).
- the binding epitope of IR3 antibody has been inferred from chimeric insulin-IGF-I receptor constructs to be the 223-274 region of IGF-I receptor (Gustafson, T. A.
- the MCF-7 human breast cancer cell line is typically used as a model cell line to demonstrate the growth response of IGF-I and IGF-II in vitro (Dufourny, B. et al., 1997, J. Biol. Chem., 272, 31163-31171).
- the ffi.3 antibody incompletely blocks the stimulatory effect of exogenously added IGF-I and IGF-II in serum-free conditions by approximately 80%.
- the IR3 antibody does not significantly inhibit (less than 25%) the growth of MCF-7 cells in 10% serum (Cullen, K. J. et al., 1990, Cancer Res., 50, 48-53).
- This weak inhibition of serum-stimulated growth of MCF-7 cells by IR3 antibody in vitro may be related to the results of an in vivo study in which IR3 antibody treatment did not significantly inhibit the growth of a MCF-7 xenograft in nude mice (Arteaga, C. L. et al., 1989, J. Clin. Invest, 84, 1418-1423).
- RSSQSrVHSNVNTYLE SEQ ID NO:4.
- FQGSHVPPT (SEQ ID NO:6).
- antibodies having a humanized or resurfaced light chain variable region having an amino acid sequence corresponding to one of SEQ ID NOS:- 9-12: DVVMTQTPLSLPVSLGDPASISCRSSQS ⁇ VHSNVNTYLEWYLQKPGQSPRLLIY KVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLG ⁇ YYCFQGSHVPPTFGGGT KLEIKR (SEQ ID NO:9); DVLMTQTPLSLPNSLGDPASISCRSSQSRVHSNVNTYLEWYLQKPGQSPKLLIY KVSNRFSGVPDRFSGSGAGTDFTLRISRVEAEDLG ⁇ YYCFQGSHVPPTFGGGT KLEIKR (SEQ ID NO:10); DVLMTQTPLSLPVSLGDPASISCRSSQS ⁇ V ⁇ SNVNTYLEWYLQKPGQSPRLLIY KVSNRFSGVPDRFSGSGAGTDFTLRISR (SEQ ID NO:10); DV
- antibodies having a humanized or resurfaced heavy chain variable region having an amino acid sequence corresponding to SEQ ID NO: 13: QVQLVQSGAEVVKPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGEI NPSNGRTNYNQKFQGKATLTNDKSSSTAYMQLSSLTSEDSAVYYFARGRPDY YGSSKWYFDVWGQGTTVTVSS (SEQ ID NO: 13).
- antibodies or antibody fragments of the present invention are provided that have improved properties.
- antibodies or antibody fragments having improved affinity for IGF-I-receptor are prepared by affinity maturation of an antibody or fragment of the present invention.
- the present invention further provides conjugates of said antibodies, wherein a cytotoxic agent is covalently attached, directly or via a cleavable or non-cleavable linker, to an antibody or epitope-binding fragment of an antibody of the present invention, hi preferred embodiments, the cytotoxic agent is a taxol, a maytansinoid, CC-1065 or a CC-1065 analog.
- the present invention further provides for antibodies or fragments thereof that are further labeled for use in research or diagnostic applications.
- the label is a radiolabel, a fluorophore, a chromophore, an imaging agent or a metal ion.
- a method for diagnosis is also provided in which said labeled antibodies or fragments are administered to a subject suspected of having a cancer, and the distribution of the label within the body of the subject is measured or monitored.
- the invention provides methods for the treatment of a subject having a cancer by administering an antibody, antibody fragment or antibody conjugate of the present invention, either alone or in combination with other cytotoxic or therapeutic agents.
- the cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, or other cancer yet to be determined in which IGF-I receptor levels are elevated.
- the invention provides methods for the treatment of a subject having a cancer by administering an antibody, antibody fragment or antibody conjugate of the present invention, either alone or in combination with other cytotoxic or therapeutic agents.
- preferred cytotoxic and therapeutic agents include docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil, fludarabine, imatinib
- the cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma, or other cancer yet to be determined in which IGF-I receptor levels are elevated.
- the invention provides kits comprising one or more of the elements described herein, and instructions for the use of those elements.
- a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent.
- the instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
- FIGURE 1 shows fluorescence activated cell sorting (FACS) analysis of the specific binding of purified EM 164 antibody to cells overexpressing human Y 125 IF IGF-I receptor or human insulin receptor.
- FACS fluorescence activated cell sorting
- FIGURE 2 shows a binding titration curve for the binding of EM 164 antibody to biotinylated human IGF-I receptor.
- FIGURE 3 shows the inhibition of the binding of biotinylated IGF-I to human breast cancer MCF-7 cells by EM 164 antibody.
- FIGURE 4 shows the inhibition of IGF-I-stimulated autophosphorylation of IGF-I receptor in MCF-7 cells by EM 164 antibody.
- FIGURE 5 shows the inhibition of IGF-I-stimulated IRS- 1 -phosphorylation in MCF-7 cells by EM 164 antibody.
- FIGURE 6 shows the inhibition of IGF-I-stimulated signal transduction in SaOS-2 cells by EMI 64 antibody.
- FIGURE 7 shows the effect of EM164 antibody on the growth and survival of MCF-7 cells under different growth conditions, as assessed by MTT assay.
- FIGURE 8 shows the effect of EMI 64 antibody on the growth and survival of MCF-7 cells in the presence of various serum concentrations.
- FIGURE 9 shows the inhibition of IGF-I- and serum-stimulated growth and survival of NCI-H838 cells by EM164 antibody.
- FIGURE 10 shows the effect of treatment with EMI 64 antibody, taxol, or a combination of EMI 64 antibody and taxol, on the growth of a Calu-6 lung cancer xenograft in mice.
- FIGURE 12 shows the cDNA (SEQ ID NO:49) and amino acid sequences (SEQ ID NO:49).
- FIGURE 13 shows the cDNA (SEQ ID NO:51) and amino acid sequences (SEQ ID NO:52).
- CDRl is SEQ ID NO:4,
- CDR2 is SEQ ID NO:5
- CDR3 is SEQ ID NO:6
- Heavy Chain is SEQ ID NO:l
- CDR2 is SEQ ID NO:2, and CDR3 is SEQ ID NO:3.
- AbM Heavy Chain: CDRl is SEQ ID NO:2
- CDR2 is SEQ ID NO:54
- CDR3 is SEQ TD NO:55.
- FIGURE 15 shows the light chain and heavy chain amino acid sequences for anti-
- IGF-I-receptor antibody EMI 64 aligned with the germline sequences for the Crl (SEQ ID NO: 1).
- FIGURE 16 shows the plasmids used to build and express the recombinant chimeric and humanized EMI 64 antibodies.
- FIGURE 17 shows the 10 most homologous amino acid sequences of the light chains screened from the 127 antibodies in the set of structure files used to predict the surface residues of EM164.
- eml64 LC SEQ ID NO:58
- 2jel SEQ ID NO:59
- 2pcp SEQ ID NO:
- FIGURE 18 shows the 10 most homologous amino acid sequences of the heavy chains screened from the 127 antibodies in the set of structure files used to predict the surface residues of EM164.
- eml64 HC SEQ ID NO:70
- lnqb SEQ ID NO:71
- lngp SEQ ID NO:
- FIGURE 21 shows the heavy chain variable region amino acid sequences for murine
- FIGURE 23 shows the light chain variable region DNA and amino acid sequences for humanized EM164 vl.l (DNA, SEQ ID NO:93; amino acid SEQ ID NO:94), vl.2 (DNA,
- FIGURE 24 shows the inhibition of IGF-I-stimulated growth and survival of MCF-7 cells by humanized EMI 64 vl.O antibody and murine EMI 64 antibody.
- FIGURE 25 shows that EM164 suppresses IGF- 1 -stimulated cycling of MCF-7 cells.
- FIGURE 26 shows that EMI 64 suppresses the anti-apoptotic effect of IGF- 1 and serum. Treatment with EMI 64 results in apoptotic cell death as demonstrated by the increased levels of cleaved CK18 protein.
- FIGURE 27 shows the effect of treatment with EM164 antibody, gemcitabine, or a combination of EMI 64 antibody and gemcitabine, on the growth of human BxPC-3 pancreatic cancer xenografts in immunodeficient mice.
- the present inventors have discovered and improved novel antibodies that specifically bind to the human insulin-like growth factor-I receptor (IGF-IR) on the cell surface.
- the antibodies and fragments have the unique ability to inhibit the cellular functions of the receptor without the capacity to activate the receptor themselves.
- the antibodies or fragments of the present invention antagonize IGF-IR but are substantially devoid of agonist activity.
- the antibodies and antibody fragments of the present invention inhibit the growth of human tumor cells such as MCF-7 cells in the presence of serum by greater than 80%, which is a higher degree of inhibition than is obtained using previously known anti-IGF-IR antibodies.
- the present invention proceeds from a murine anti-IGF-IR antibody, herein EMI 64, that is fully characterized with respect to the amino acid sequences of both light and heavy chains, the identification of the CDRs, the identification of surface amino acids, and means for its expression in recombinant form.
- EMI 64 murine anti-IGF-IR antibody
- antibodies EM 164 light and heavy chains are disclosed herein.
- the scope of the present invention is not limited to antibodies and fragments comprising these sequences. Instead, all antibodies and fragments that specifically bind to an insulin-like growth factor-I receptor and antagonize the biological activity of the receptor, but which are substantially devoid of agonist activity, fall within the scope of the present invention.
- antibodies and antibody fragments may differ from antibody EM 164 or the humanized derivatives in the amino acid sequences of their scaffold, CDRs, light chain and heavy chain, and still fall within the scope of the present invention.
- the CDRs of antibody EMI 64 are identified by modeling and their molecular structures have been predicted. Again, while the CDRs are important for epitope recognition, they are not essential to the antibodies and fragments of the invention. Accordingly, antibodies and fragments are provided that have improved properties produced by, for example, affinity maturation of an antibody of the present invention. [67] Diverse antibodies and antibody fragments, as well as antibody mimics may be readily produced by mutation, deletion and/or insertion within the variable and constant region sequences that flank a particular set of CDRs.
- variable is used herein to describe certain portions of the variable domains that differ in sequence among antibodies and are used in the binding and specificity of each particular antibody for its antigen. However, the variability is not usually evenly distributed through the variable domains of the antibodies.
- variable domains of heavy and light chains each comprise four framework regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of the beta-sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (E. A. Kabat et al. Sequences of Proteins of Immunological Interest, fifth edition, 1991, NUT).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
- the invention also includes functional equivalents of the antibodies described in this specification.
- Functional equivalents have binding characteristics that are comparable to those of the antibodies, and include, for example, chimerized, humanized and single chain antibodies as well as fragments thereof. Methods of producing such functional equivalents are disclosed in PCT Application WO 93/21319, European Patent Application No. 239,400; PCT Application WO 89/09622; European Patent Application 338,745; and European Patent Application EP 332,424, which are incorporated in their respective entireties by reference.
- Functional equivalents include polypeptides with amino acid sequences substantially the same as the amino acid sequence of the variable or hypervariable regions of the antibodies of the invention.
- Chimerized antibodies preferably have constant regions derived substantially or exclusively from human antibody constant regions and variable regions derived substantially or exclusively from the sequence of the variable region from a mammal other than a human.
- Humanized forms of the antibodies are made by substituting the complementarity determining regions of, for example, a mouse antibody, into a human framework domain, e.g., see PCT Pub. No. W092/22653.
- Humanized antibodies preferably have constant regions and variable regions other than the complementarity determining regions (CDRs) derived substantially or exclusively from the corresponding human antibody regions and CDRs derived substantially or exclusively from a mammal other than a human.
- Functional equivalents also include single-chain antibody fragments, also known as single-chain antibodies (scFvs).
- These fragments contain at least one fragment of an antibody variable heavy-chain amino acid sequence (V H ) tethered to at least one fragment of an antibody variable light-chain sequence (V L ) with or without one or more interconnecting linkers.
- a linker may be a short, flexible peptide selected to assure that the proper three-dimensional folding of the (V L ) and (V H ) domains occurs once they are linked so as to maintain the target molecule binding-specificity of the whole antibody from which the single- chain antibody fragment is derived.
- the carboxyl terminus of the (V L ) or (V H ) sequence may be covalently linked by such a peptide linker to the amino acid terminus of a complementary (V L ) and (V H ) sequence.
- Single-chain antibody fragments may be generated by molecular cloning, antibody phage display library or similar techniques. These proteins may be produced either in eukaryotic cells or prokaryotic cells, including bacteria.
- Single-chain antibody fragments contain amino acid sequences having at least one of the variable or complementarity determining regions (CDRs) of the whole antibodies described in this specification, but are lacking some or all of the constant domains of those antibodies. These constant domains are not necessary for antigen binding, but constitute a major portion of the structure of whole antibodies. Single-chain antibody fragments may therefore overcome some of the problems associated with the use of antibodies containing a part or all of a constant domain.
- Such fragments may contain one or both Fab fragments or the F(ab') 2 fragment.
- the antibody fragments Preferably contain all six complementarity determining regions of the whole antibody, although fragments containing fewer than all of such regions, such as three, four or five CDRs, are also functional.
- the functional equivalents may be or may combine members of any one of the following immunoglobulin classes: IgG, IgM, IgA, IgD, or IgE, and the subclasses thereof.
- variants of the primary antibody have been generated by changing the sequences of the heavy and light chain genes in the CDRl, CDR2, CDR3, or framework regions, using methods such as oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, enor-prone PCR, D ⁇ A shuffling, or mutator-strains of E. coli (Vaughan, T. J. et al., 1998, Nature Biotechnology, 16, 535-539; Adey, ⁇ . B. et al., 1996, Chapter 16, pp. 277-291, in "Phage Display of Peptides and Proteins” , Eds. Kay, B. K. et al., Academic Press).
- the antibody sequences described in this invention can be used to develop anti-IGF- I receptor antibodies with improved functions.
- the conjugates of the present invention comprise the antibody, fragments, and their analogs as disclosed herein, linked to a cytotoxic agent.
- cytotoxic agents are maytansinoids, taxanes and analogs of CC-1065.
- the conjugates can be prepared by in vitro methods.
- a linking group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
- Preferred linking groups are disulfide groups and thioether groups.
- conjugates can be constructed using a disulfide exchange reaction or by forming a thioether bond between the antibody and the cytotoxic agent.
- Taxanes are also preferred cytotoxic agents. Taxanes suitable for use in the present invention are disclosed in U.S. Patent Nos. 6,372,738 and 6,340,701. [81] CC-1065 and its analogs are also preferred cytotoxic drugs for use in the present invention. CC-1065 and its analogs are disclosed in U.S. Patent Nos. 6,372,738; 6,340,701; 5,846,545 and 5,585,499.
- Cytotoxic drugs such as methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, and calicheamicin are also suitable for the preparation of conjugates of the present invention, and the drug molecules can also be linked to the antibody molecules through an intermediary carrier molecule such as serum albumin.
- the antibodies of the present invention typically will be labeled with a detectable moiety.
- the detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal.
- the detectable moiety may be a radioisotope, such as 3 H, 14 C, 32 P, 35 S, or 131 I; a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
- any method known in the art for conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter, et al, Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982).
- the antibodies of the present invention can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, Monoclonal Antibodies: A Manual of Techniques, pp.147-158 (CRC Press, Inc., 1987)).
- the antibodies of the invention also are useful for in vivo imaging, wherein an antibody labeled with a detectable moiety such as a radio-opaque agent or radioisotope is administered to a subject, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed.
- a detectable moiety such as a radio-opaque agent or radioisotope
- This imaging technique is useful in the staging and treatment of malignancies.
- the antibody may be labeled with any moiety that is detectable in a host, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
- the antibodies of the invention also are useful as affinity purification agents.
- the antibodies are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
- the antibodies of the invention also are useful as reagents in biological research, based on their inhibition of the function of IGF-I receptor in cells.
- the antibodies or conjugates of the invention are administered to a subject, in a pharmaceutically acceptable dosage form. They can be administered intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
- the antibody may also be administered by intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects.
- Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of skill in the art as the clinical situation wanants.
- suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose.
- the method of the present invention can be practiced in vitro, in vivo, or ex vivo.
- the antibodies, antibody fragments or conjugates of the invention are co-administered, or administered sequentially, with one or more additional therapeutic agents.
- Suitable therapeutic agents include, but are not limited to, cytotoxic or cytostatic agents. Taxol is a preferred therapeutic agent that is also a cytotoxic agent.
- Cancer therapeutic agents are those agents that seek to kill or limit the growth of cancer cells while doing minimal damage to the host. Thus, such agents may exploit any difference in cancer cell properties (e.g. metabolism, vascularization or cell-surface antigen presentation) from healthy host cells.
- the second therapeutic can be an antibody such as an anti-NEGF antibody that is useful in retarding the vascularization of the interior of a solid tumor, thereby slowing its growth rate.
- Other therapeutic agents include, but are not limited to, adjuncts such as granisetron HCl, androgen inhibitors such as leuprolide acetate, antibiotics such as doxorubicin, antiestrogens such as tamoxifen, antimetabolites such as interferon alpha-2a, cytotoxic agents such as taxol, enzyme inhibitors such as ras farnesyl-transferase inhibitor, immunomodulators such as aldesleukin, and nitrogen mustard derivatives such as melphalan HCl, and the like.
- the dosage of each therapeutic agent will be dependent on the identity of the agent, the preferred dosages can range from about 10 mg/square meter to about 2000 mg/square meter, more preferably from about 50 mg/square meter to about 1000 mg/square meter.
- the preferred dosage is about 10 mg/square meter to about 400 mg/square meter
- for taxanes (paclitaxel, docetaxel) the prefened dosage is about 20 mg/square meter to about 150 mg/square meter
- for gemcitabine the preferred dosage is about 100 mg/square meter to about 2000 mg/square meter
- for camptothecin the preferred dosage is about 50 mg/square meter to about 350 mg/square meter.
- the dosage of this and other therapeutic agents may depend on whether the antibody, antibody fragment or conjugate of the invention is administered concunently or sequentially with a therapeutic agent.
- an antibody, antibody fragment or conjugate of the invention, and one or more additional therapeutic agents may occur as described above for therapeutic applications.
- Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being co-administered.
- the antibody When present in an aqueous dosage form, rather than being lyophilized, the antibody typically will be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml, although wide variation outside of these ranges is permitted.
- the appropriate dosage of antibody or conjugate will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibodies are administered for preventive or therapeutic purposes, the course of previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
- the antibody is suitably administered to the patient at one time or over a series of treatments.
- kits comprising one or more of the elements described herein, and instructions for the use of those elements.
- a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent.
- the instructions for this prefened embodiment include instructions for inhibiting the growth of a cancer cell using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
- the antibody used in the kit has the same amino acid sequence as the murine antibody EM164 produced by mouse hybridoma EM164 (ATCC accession number PTA-4457), or the antibody is an epitope-binding fragment thereof, wherein both the antibody and the fragment specifically bind to insulin-like growth factor-I receptor.
- the antibody and antibody fragment used in the kit may also be a resurfaced version of the EMI 64 antibody, a humanized version of the EM 164 antibody, or an altered version of the EMI 64 antibody having least one nucleotide mutation, deletion or insertion. Antibodies and antibody fragments of each of these three versions retain the same binding specificity as the EMI 64 antibody.
- the therapeutic agent used in the kit is selected from the group consisting of docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab (Herceptin), capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab (Avastin), 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab (Rituxan), idarubicin, busulfan, chlorambucil
- kits of the present invention are in a suitable form for a kit, such as a solution or lyophilized powder.
- concentration or amount of the elements of the kits will be understood by the skilled artisan to varying depending on the identity and intended use of each element of the kit.
- the cancers and cells therefrom refened to in the instructions of the kits include breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma.
- a cell line expressing human IGF-I receptor with a Y125 IF mutation was used for immunization as it expressed a high number of IGF-I receptors ( ⁇ 10 7 per cell).
- the Y1251F- mutation in the cytoplasmic domain of IGF-I receptor resulted in loss of transformation and anti-apoptotic signaling, but did not affect IGF-I binding and IGF-I-stimulated mitogenic signaling (O'Connor, R. et al, 1997, Mol. Cell. Biol, 17, 427-435; Miura, M. et al., 1995, J Biol. Chem., 270, 22639-22644).
- a cell line expressing human IGF-I receptor with a Y125 IF mutation was generated from 3T3-like cells of a IGF-I-receptor-deficient mouse by transfection with Y1251F-mutant human IGF-I-receptor gene together with a puromycin-resistance gene, and was selected using puromycin (2.5 microgram/mL) and by FACS sorting for high IGF-I receptor expression (Miura, M. et al., 1995, J. Biol. Chem., 270, 22639-22644).
- the spleen was ground between two frosted glass slides to obtain a single cell suspension, which was washed with serum-free RPMI medium containing penicillin and streptomycin (SFM).
- the spleen cell pellet was resuspended in 10 mL of 0.83% (w/v) ammonium chloride solution in water for 10 min on ice to lyse the red blood cells, and was then washed with serum-free medium (SFM).
- Spleen cells (1.2xl0 8 ) were pooled with myeloma cells (4x10 ) from the non-secreting mouse myeloma cell line P3X63Ag8.653 (ATCC, Rockville, MD; Cat.
- Human IGF-I receptor was isolated for use in the screening of supematants from hybridoma clones for their binding to IGF-I receptor by the method below.
- Biotinylated IGF- I was prepared by modification of recombinant IGF-I using biotinylating reagents such as sulfo-NHS-LC-biotin, sulfo-NHS-SS-biotin, or NHS-PEO 4 -biotin. Biotinylated IGF-I was absorbed on streptavidin-agarose beads and incubated with lysate from cells that overexpressed human wild type or Y125 IF mutant IGFR.
- an Immulon-4HB ELISA plate (Dynatech) was coated with a purified human IGF-I receptor sample (prepared by dialysis from urea/octyl- ⁇ -glucoside elution of affinity purified sample)
- blocking buffer (10 mg/mL BSA in TBS-T buffer containing 50 mM Tris, 150 mM NaCl, pH 7.5, and 0.1% Tween-20) and incubated with supematants from hybridoma clones (100 ⁇ L; diluted in blocking buffer) for about 1 h to 12 h, washed with TBS-T buffer, and incubated with goat-anti-mouse-IgG-Fc-antibody-horseradish peroxidase (HRP) conjugate (100 ⁇ L; 0.8 ⁇ g/mL in blocking buffer; Jackson ImmunoResearch Laboratories), followed by washes and detection using ABTS H 2 O 2 substrate at 405 nm (0.5 mg/mL ABTS, 0.03% H 2 O 2 in 0.1 M citrate buffer, pH 4.2).
- blocking buffer 10 mg/mL BSA in TBS-T buffer containing 50 mM Tris, 150 mM NaCl, pH 7.5, and 0.1%
- a supernatant from a 3F1 hybridoma subclone yielded a signal of about 1.2 absorbance units within 3 min of development, in contrast to values of 0.0 obtained for supematants from some other hybridoma clones.
- General conditions for this ELISA were similar to the standard ELISA conditions for antibody binding and detection as described by E. Harlow and D. Lane ("Using Antibodies: A Laboratory Manual”; 1999, Cold Spring Harbor Laboratory Press, New York), which conditions can also be used.
- hnmulon-2HB plate coated with phytohemagglutinin 100 ⁇ L of 20 ⁇ g/mL PHA
- centrifuged 100 ⁇ L of 20 ⁇ g/mL PHA
- the plate with cells was
- a typical supernatant from a 3F1 hybridoma subclone upon incubation with cells overexpressing IGF-I receptor yielded a signal of 0.88 absorbance units within 12 min of development, in contrast to a value of 0.22 absorbance units obtained upon incubation with cells overexpressing human insulin receptor.
- the hybridoma was grown in Integra CL 350 flasks (Integra Biosciences, Maryland), according to manufacturer's specifications, to provide purified EM 164 antibody.
- a yield of about 0.5-1 mg/mL antibody was obtained in the harvested supematants from the Integra flasks, based on quantitation by ELISA and by SDS-PAGE/Coomassie blue staining using antibody standards.
- the antibody was purified by affinity chromatography on Protein A- agarose bead column under standard purification conditions of loading and washing in 100 mM Tris buffer, pH 8.9, containing 3 M NaCl, followed by elution in 100 mM acetic acid solution containing 150 mM NaCl. The eluted fractions containing antibody were neutralized
- the cells were pelleted by centrifugation and washed with cold FACS buffer by gentle flicking, followed by incubation with goat-anti-mouse-IgG-antibody-FITC conjugate (100
- Biotinylated IGF-I receptor was prepared by biotinylation of detergent-solubilized lysate from IGF-I receptor overexpressing cells using PEO-maleimide-biotin reagent (Pierce, Molecular Biosciences), which was affinity purified using an anti-IGF-I receptor beta chain antibody immobilized on NHS-agarose beads and was eluted with 2-4 M urea in buffer containing NP-40 detergent and dialyzed in PBS.
- the K d determination for the binding of EMI 64 antibody with biotinylated IGF-I receptor was carried out by coating Immulon-2HB plates with 100 ⁇ L of 1 ⁇ g/mL
- streptavidin in carbonate buffer 150 mM sodium carbonate, 350 mM sodium bicarbonate
- the streptavidin-coated wells were blocked with 200 ⁇ L of blocking buffer (10 mg/mL BSA in TBS-T buffer), washed with TBS-T buffer and incubated with biotinylated IGF-I receptor (10 to 100 ng) for 4 h at ambient temperature.
- the wells containing indirectly captured biotinylated IGF-I receptor were then washed and incubated 1 ' with EMI 64 antibody in blocking buffer at several concentrations (5.1x10 " M to 200 nM) for 2 h at ambient temperature and were then incubated overnight at 4°C.
- EMI 64 antibody can be used for immunoprecipitation of IGF-I receptor, as demonstrated by incubation of detergent-solubilized lysate of the human breast cancer MCF- 7 cells with EMI 64 antibody immobilized on protein G-agarose beads (Pierce Chemical Company).
- a Western blot of the EM164 antibody immunoprecipitate was detected using a rabbit polyclonal anti-IGF-I receptor beta chain (C-terminus) antibody (Santa Cmz Biotechnology) and a goat-anti-rabbit-IgG-antibody-horseradish peroxidase conjugate, followed by washes and enhanced chemiluminescence (ECL) detection.
- the Western blot of EMI 64 immunoprecipitate from MCF-7 cells exhibited bands conesponding to the beta chain of IGF-I receptor at about 95 kDa and the pro-IGF-I receptor at about 220 kDa. Similar immunoprecipitations were carried out for other cell types to check species specificity of the binding of EMI 64 antibody, which also bound to IGF-I receptor from cos-7 cells (African green monkey), but did not bind to IGF-I receptor of 3T3 cells (mouse), CHO cells (Chinese hamster) or goat fibroblast cells (goat).
- the EMI 64 antibody did not detect SDS-denatured human IGF-I receptor in Western blots of lysates from MCF-7 cells, which indicated that it bound to a conformational epitope of native, non-denatured human IGF-I receptor.
- the binding domain of EMI 64 antibody was further characterized using a truncated alpha chain construct, which comprised the cysteine rich domain flanked by LI and L2 domains (residues 1-468) fused with the 16-mer-C-terminus piece (residues 704-719) and which was terminated by a C-terminus epitope tag.
- IGF-I receptor alpha chain construct was prepared comprising residues 1-468 fused to the C- terminus piece that is residues 704-719 and flanked by a C-terminus myc epitope tag.
- MCF-7 cells were incubated with or without 5 ⁇ g/mL EMI 64 antibody for 2 h in serum-free medium, followed by incubation with 50 ng/n L biotinylated IGF-I for 20 min at 37°C. The cells were then washed twice with serum-free medium to remove unbound biotin-IGF-I, and were then lysed in 50 mM HEPES, pH 7.4, containing 1% NP-40 and protease inhibitors. An Immulon-2HB ELISA plate was coated with a mouse monoclonal anti-IGF-I receptor beta chain antibody and was used to capture the IGF-I receptor and bound biotin-IGF-I from the lysate.
- the binding of the coated antibody to the cytoplasmic C-terminal domain of the beta chain of IGF-I receptor did not interfere with the binding of biotin-IGF-I to the extracellular domain of IGF-I receptor.
- the wells were washed, incubated with streptavidin-horseradish peroxidase conjugate, washed again, and then detected using ABTS/H 2 O 2 substrate.
- the inhibition of IGF-I binding to MCF-7 cells by 5 ⁇ g/mL EMI 64 antibody was essentially quantitative, and was almost equivalent to that of the ELISA background obtained using a control lacking biotin-IGF-I.
- ELISA was carried out as described above to capture the IGF-I receptor from the lysate and then detect the biotinylated IGF-I bound to the receptor using streptavidin-horseradish peroxidase conjugate. This ELISA demonstrated that EMI 64 antibody was able to displace pre-bound biotinylated IGF-I from cells nearly completely (90% within 30 min and -100% within 4 h) at 37°C and by about 50%o in 2 h at 4°C.
- NCI-H838 lung cancer cells were incubated with biotin-IGF-I, then washed and incubated with EM 164 antibody at 4°C for 2 h, which resulted in a 80% decrease in the bound biotin-IGF-I. Therefore, EM164 antibody was highly effective at displacing pre-bound IGF-I from cancer cells, which would be important therapeutically for the antagonism of the IGF-I receptor by displacement of the bound endogenous physiological ligand.
- the mechanism for the potent inhibition of the binding of IGF-I to IGF-I receptor and for the displacement of the pre-bound IGF-I by EMI 64 antibody is likely to be competition for binding, either through sharing of the binding site or through steric occlusion or through allosteric effects.
- biotinylated anti-phosphotyrosine antibody PY20; 0.25 ⁇ g/mL; BD Transduction Laboratories
- IRS-1 insulin receptor substrate-1
- PI- 3-kinase phosphatidylinositol-3 -kinase
- MCF-7 cells were treated with 5 ⁇ g/mL antibody (EM164 or
- IR3 in seram-free medium for 2 h, followed by stimulation with 50 ng/mL IGF-I for 10 min at 37°C.
- Anti-IRS-1 antibody (rabbit polyclonal; Upstate Biotechnology) was indirectly captured by incubation with coated goat-anti-rabbit-IgG antibody on an ELISA plate, which was then used to capture IRS-1 from the cell lysate samples by overnight incubation at 4°C. The wells were then incubated with mouse monoclonal anti-p85-PI-3-kinase antibody (Upstate Biotechnology) for 4 h, followed by treatment with goat-anti-mouse-IgG-antibody- HRP conjugate for 30 min.
- EMI 64 antibody was more effective at inhibiting the IGF-I-stimulated IRS-1 phosphorylation than was IR3 antibody, and EM164 antibody did not show any agonistic activity on IRS-1 phosphorylation when incubated with cells in the absence of IGF-I.
- IGF-I 10 ⁇ g/mL antibody for 30 min.-3 h, followed by the addition of 25 ⁇ L of IGF-I (or IGF-II or
- the cells were stimulated first with IGF-I for 15 min before the addition of EM 164 antibody, or both IGF-I and EM 164 antibody were added together. The cells were then allowed to grow for another 2-3 days.
- EM164 antibody strongly inhibited lGF-II-stimulated growth and survival of MCF-7 cells.
- Previous reports using commercially available antibodies such as IR3 antibody showed only weak inhibition of serum-stimulated growth and survival of MCF-7 cells, as confirmed in Figure 7 for the IR3 and 1H7 antibodies (Cullen, K. J. et al., 1990, Cancer Res., 50, 48-53).
- EM164 antibody was a potent inhibitor of the seram- or IGF-stimulated growth of MCF-7 cells.
- EMI 64 antibody was equally effective in inhibiting the growth and survival of MCF-7 cells over a wide range of serum concentrations (0.04-10% serum).
- the EMI 64 antibody caused growth arrest of cells in G0/G1 phase of cell cycle and abrogated the mitogenic effect of IGF-I.
- MCF-7 cells were treated with IGF-I (20 ng/mL) in the presence or absence of EM164 (20 ⁇ g/mL) for 1 day and then analyzed by propidium iodide staining and flow cytometry.
- EM164 propidium iodide staining and flow cytometry.
- the cycling of cells in response to IGF-I stimulation in the absence of EM164 was suppressed in EM164-treated cells (with only 9% in the S phase and 77% of the cells in the G0/G1 phase).
- EM164 antibody As a single agent in inhibiting the proliferation and survival of diverse human cancer cell lines as shown in Table 1, additional efficacy studies were carried out using combinations of EM164 antibody with other anticancer therapeutic agents. In these studies on diverse cancer cell lines, the combined treatment of EM164 antibody and other anti-cancer therapeutic agents resulted in an even greater anti-cancer efficacy than with either EMI 64 or the other therapeutic agent alone. These combinations of EMI 64 with other therapeutic agents are therefore highly effective in inhibiting the proliferation and survival of cancer cells.
- the therapeutic agents that can be combined with EM164 for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference-. Cancer, Principles & Practice of Oncology, DeVita, V.
- EMI 64 is combined with one or more anti-cancer agents of diverse mechanisms of action such as alkylating agents, platinum agents, hormonal therapies, antimetabolites, topoisomerase inhibitors, antimicrotubule agents, differentiation agents, antiangiogenic or antivascularization therapies, radiation therapy, agonists and antagonists of leuteinizing hormone releasing hormone (LHRH) or gonadotropin-releasing hormone (GnRH), inhibitory antibodies or small molecule inhibitors against cell-surface receptors, and other chemotherapeutic agents (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S. A., 6th edition, Lippincott-Raven, Philadelphia, 2001).
- LHRH leuteinizing hormone releasing hormone
- GnRH gonadotropin-releasing hormone
- inhibitory antibodies or small molecule inhibitors against cell-surface receptors and other chemotherapeutic agents
- the combination of an LHRH antagonist antide (0.1 to 10 micromolar) and EM164 antibody (0.1 to 10 nanomolar) inhibited the proliferation of MCF-7 breast cancer cells significantly more than that with either EM164 or antide alone.
- the combined treatment with EM164 antibody (10 microgram/ml) and cisplatin (0.1-60 microgram/ml) resulted in a greater inhibition of the proliferation and survival of MCF-7 breast cancer cells in comparison to the inhibition by either EM164 antibody or cisplatin alone.
- EMI 64 antibody with other therapeutic agents are effective against several types of cancers including breast, lung, colon, prostate, pancreatic, cervical, ovarian, melanoma, multiple myeloma, neuroblastoma, rhabdomyosarcoma and osteosarcoma.
- the EMI 64 antibody and the therapeutic agent can be administered for cancer therapy either simultaneously or in sequence.
- Conjugates of EM164 antibody with cytotoxic drags are also valuable in targeted delivery of the cytotoxic drags to the tumors overexpressing IGF-I receptor. Conjugates of
- EM164 antibody with radiolabels or other labels can be used in the treatment and imaging of tumors that overexpress IGF-I receptor.
- mice containing established 100 mm 3 Calu-6 xenografts were treated with EM 164 antibody alone (6 injections of 0.8 mg/mouse, i. v., two per week) or with taxol alone (five injections of taxol, i.p. every two days; 15 mg/kg), or with a combination of taxol and EM164 antibody treatments, or PBS alone (200 ⁇ L/mouse, 6 injections, two per week, i.v.) using five mice per treatment group.
- the growth of tumors was significantly slowed by EM164 antibody treatment compared to a PBS control. No toxicity of EM164 antibody was observed, based on measurements of the weights of the mice.
- mice bearing established tumors of 80 mm 3 were then treated with EM164 alone (13 injections of 0.8 mg/mouse, i.v., lateral tail vein, on days 12, 16, 19, 23, 26, 29, 36, 43, 50, 54, 58, 61 and 64), with gemcitabine alone (two injections of 150 mg/kg/mouse, i.p., on days 12 and 19), with a combination of gemcitabine and EM164 following the above schedules, PBS alone, and a control antibody alone (following the same schedule as EMI 64) using five mice in each of the five treatment groups.
- EM164 13 injections of 0.8 mg/mouse, i.v., lateral tail vein, on days 12, 16, 19, 23, 26, 29, 36, 43, 50, 54, 58, 61 and 64
- gemcitabine alone two injections of 150 mg/kg/mouse, i.p., on days 12 and 19
- a combination of gemcitabine and EM164 following the above schedules, PBS alone, and a
- the murine EM164 and the humanized EM164 antibodies showed equivalent inhibition of the growth of established BxPC-3 xenografts in mice, thus demonstrating that the potency of the humanized EM164 is equivalent to that of the murine EM164 in vivo.
- both intraperitoneal and intravenous administrations of EM164 antibody showed equivalent inhibition of the growth of established BxPC-3 xenografts in mice.
- treatment with EM164 antibody showed significant growth delay of established A-673 human rhabdomyosarcoma/Ewing's sarcoma xenografts in mice.
- PCR reactions were performed using a RACE method described in Co et al. (J. Immunol., 148, 1149-1154 (1992)) and using degenerate primers as described in Wang et al., (J. Immunol. Methods, 233, 167-177 (2000)).
- the RACE PCR method required an intermediate step to add a poly G tail on the 3' ends of the first strand cDNAs.
- RT reactions were purified with Qianeasy (Qiagen) columns and eluted in 50 ⁇ l 1 X NEB buffer 4.
- SaclMK - GGGAGCTCGAYATTGTGMTSACMCARWCTMCA (SEQ ID NO: 17) for the light chain, and an equal mix of:
- EXAMPLE 2 Humanized versions of EM164 antibody
- variable region residues for a set of antibodies with solved structures were used to predict the surface residues for the murine anti-IGF-I receptor antibody (EM164) variable region.
- the amino acid solvent accessibility for a set of 127 unique antibody structure files were calculated with the MC software package (Pedersen et al., 1994, J. Mol. Biol., 235, 959-973). The ten most similar light chain and heavy chain amino acid sequences from this set of 127 stractures were determined by sequence alignment. The average solvent accessibility for each variable region residue was calculated, and positions with greater than a 30% average accessibility were considered to be surface residues.
- a molecular model of murine EM164 was generated using the Oxford Molecular software package AbM.
- the antibody framework was built from structure files for the antibodies with the most similar amino acid sequences, which were 2jel for the light chain and lnqb for the heavy chain.
- the non-canonical CDRs were built by searching a C- ⁇ structure database containing non-redundant solved structures. Residues that lie within 5 of a CDR were determined.
- Residues which had average accessibilities between 25% and 35% were further analyzed by averaging a subset of antibodies that had two identical residues flanking either side of the residue in question. These borderline surface positions and their new average accessibilities are given.
- the NA's refer to residues with no identical flanking residues in the 10 most similar antibodies.
- affinities of the humanized EM164 antibody versions 1.0-1.3 were compared to those of murine EM164 antibody through binding competition assays using biotinylated full- length human IGF-I receptor or myc-epitope tagged truncated IGF-I receptor alpha chain, as described above.
- Humanized EM164 antibody samples were obtained by transient transfection of the appropriate expression vectors in human embryonic kidney 293T cells, and antibody concentrations were determined by ELISA using purified humanized antibody standards.
- the streptavidin-coated wells were blocked with 200 ⁇ L of blocking buffer (10 mg/mL BSA in TBS-T buffer) for 1 h, washed with TBS-T buffer and incubated with biotinylated IGF-I receptor (5 ng per well) overnight at 4°C.
- the wells containing indirectly captured biotinylated IGF-I receptor were then washed and incubated with mixtures of humanized EM164 antibody (15.5 ng) and murine antibody (0 ng, or 16.35 ng, or 32.7 ng, or 65.4 ng, or 163.5 ng) in 100 ⁇ L blocking buffer for 2 h at ambient temperature and were then incubated overnight at 4°C.
- the wells were then washed with TBS-T buffer and incubated with goat-anti-human-Fab ' 2 -antibody-horseradish peroxidase conjugate for 1 h
- the humanized EM164 vl.O antibody showed a similar inhibition of IGF-I -stimulated growth and survival of MCF-7 cells as did the murine EM164 antibody ( Figure 24).
- the inhibition of serum-stimulated growth and survival of MCF-7 cells by humanized EMI 64 vl.O antibody was similar to the inhibition by murine EM164 antibody.
- EM164 and its humanized variants were used to develop other antibodies that have improved properties and that are also within the scope of the present invention.
- improved properties include increased affinity for the IGF-I receptor.
- studies have surveyed the effects of introducing one or more amino acid changes at various positions in the sequence of an antibody, based on the knowledge of the primary antibody sequence, on its properties such as binding and level of expression (Yang, W. P. et al., 1995, /. Mol. Biol., 254, 392-403;
- variants of the primary antibody have been generated by changing the sequences of the heavy and light chain genes in the CDRl, CDR2, CDR3, or framework regions, using methods such as oligonucleotide-mediated site-directed mutagenesis, cassette mutagenesis, error-prone PCR, DNA shuffling, or mutator-strains of E. coli (Vaughan, T. J. et al., 1998, Nature Biotechnology, 16, 535-539; Adey, N. B. et al., 1996, Chapter 16, pp.
- the antibody sequences described in this invention can be used to develop anti-IGF-
- I receptor antibodies with improved functions such as antibodies having suitable groups such as free amino groups or thiols at convenient attachment points for covalent modification for use, for example, in the attachment of therapeutic agents.
- the murine anti IGF-I receptor antibody was also expressed from mammalian expression plasmids similar to those used to express the humanized antibody (above).
- Expression plasmids are known that have murine constant regions including the light chain kappa and heavy chain gamma-1 sequences (McLean et al., 2000, Mol Immunol., 37, 837-
- plasmids were designed to accept any antibody variable region, such as for example the murine anti-IGF-I receptor antibody, by a simple restriction digest and cloning. Additional PCR of the anti-IGF-1 receptor antibody was usually required to create the restriction compatible with those in the expression plasmid.
- An alternative approach for expressing the fully murine anti-IGF-I receptor antibody was to replace the human constant regions in the chimeric anti-IGF-I receptor antibody expression plasmid.
- the chimeric expression plasmid ( Figure 16) was constructed using cassettes for the variable regions and for both the light and heavy chain constant regions.
Abstract
Description
Claims
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/729,441 US8034904B2 (en) | 2002-06-14 | 2003-12-08 | Anti-IGF-I receptor antibody |
PCT/US2004/038230 WO2005061541A1 (en) | 2002-06-14 | 2004-12-07 | Anti-igf-i receptor antibody |
Publications (2)
Publication Number | Publication Date |
---|---|
EP1692176A1 true EP1692176A1 (en) | 2006-08-23 |
EP1692176A4 EP1692176A4 (en) | 2008-11-12 |
Family
ID=36616549
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP04811082A Ceased EP1692176A4 (en) | 2003-12-08 | 2004-12-07 | Anti-igf-i receptor antibody |
Country Status (13)
Country | Link |
---|---|
EP (1) | EP1692176A4 (en) |
JP (1) | JP2008502589A (en) |
KR (1) | KR20070001883A (en) |
CN (1) | CN1886424A (en) |
AU (1) | AU2004303792A1 (en) |
BR (1) | BRPI0417406A (en) |
CA (1) | CA2548065A1 (en) |
CR (1) | CR8426A (en) |
EA (1) | EA009807B1 (en) |
EC (1) | ECSP066595A (en) |
IL (1) | IL174770A0 (en) |
MX (1) | MXPA06005540A (en) |
NO (1) | NO20063155L (en) |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SG181834A1 (en) | 2009-12-21 | 2012-07-30 | Genentech Inc | Antibody formulation |
NZ603972A (en) * | 2010-05-11 | 2014-11-28 | Aveo Pharmaceuticals Inc | Anti-fgfr2 antibodies |
EP2766478A4 (en) | 2011-10-10 | 2015-06-17 | Los Angeles Childrens Hospital | Novel asparaginase and methods for treating diseases associated with asparagine dependence |
CN103509117B (en) * | 2013-05-06 | 2016-03-09 | 江苏匡亚生物医药科技有限公司 | Bi-specific antibody of anti-human HER2 and people IGF-IR and its production and use |
CA3056573A1 (en) * | 2017-05-30 | 2018-12-06 | Teijin Pharma Limited | Anti-igf-i receptor antibody |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002053596A2 (en) * | 2001-01-05 | 2002-07-11 | Pfizer Inc. | Antibodies to insulin-like growth factor i receptor |
WO2003106621A2 (en) * | 2002-06-14 | 2003-12-24 | Immunogen, Inc. | Anti-igf-i receptor antibody |
WO2004071529A2 (en) * | 2003-02-13 | 2004-08-26 | Pfizer Products Inc. | Uses of anti-insulin-like growth factor i receptor antibodies |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL143514A0 (en) * | 1998-12-04 | 2002-04-21 | Novartis Ag | METHODS AND COMPOSITIONS USEFUL FOR TARGETING ACTIVATED VITRONECTIN RECEPTOR αvβ3 |
-
2004
- 2004-12-07 MX MXPA06005540A patent/MXPA06005540A/en active IP Right Grant
- 2004-12-07 CN CNA200480034889XA patent/CN1886424A/en active Pending
- 2004-12-07 EA EA200600931A patent/EA009807B1/en not_active IP Right Cessation
- 2004-12-07 JP JP2006543832A patent/JP2008502589A/en active Pending
- 2004-12-07 AU AU2004303792A patent/AU2004303792A1/en not_active Abandoned
- 2004-12-07 EP EP04811082A patent/EP1692176A4/en not_active Ceased
- 2004-12-07 KR KR1020067010010A patent/KR20070001883A/en not_active Application Discontinuation
- 2004-12-07 CA CA002548065A patent/CA2548065A1/en not_active Abandoned
- 2004-12-07 BR BRPI0417406-2A patent/BRPI0417406A/en not_active IP Right Cessation
-
2006
- 2006-04-04 IL IL174770A patent/IL174770A0/en unknown
- 2006-05-31 EC EC2006006595A patent/ECSP066595A/en unknown
- 2006-06-01 CR CR8426A patent/CR8426A/en not_active Application Discontinuation
- 2006-07-07 NO NO20063155A patent/NO20063155L/en not_active Application Discontinuation
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2002053596A2 (en) * | 2001-01-05 | 2002-07-11 | Pfizer Inc. | Antibodies to insulin-like growth factor i receptor |
WO2003106621A2 (en) * | 2002-06-14 | 2003-12-24 | Immunogen, Inc. | Anti-igf-i receptor antibody |
WO2004071529A2 (en) * | 2003-02-13 | 2004-08-26 | Pfizer Products Inc. | Uses of anti-insulin-like growth factor i receptor antibodies |
Non-Patent Citations (3)
Title |
---|
RUDIKOFF S ET AL: "Single amino acid substitution altering antigen-binding specificity", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF USA, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC; US, vol. 79, 1 March 1982 (1982-03-01), pages 1979-1983, XP007901436, ISSN: 0027-8424, DOI: 10.1073/PNAS.79.6.1979 * |
See also references of WO2005061541A1 * |
SURMACZ E: "Growth factor receptors as therapeutic targets: Strategies to inhibit the insulin-like growth factor I receptor" ONCOGENE, NATURE PUBLISHING GROUP, GB BASINGSTOKE, HANTS, vol. 22, no. 42, 29 September 2003 (2003-09-29), pages 6589-6597, XP002392351 ISSN: 0950-9232 * |
Also Published As
Publication number | Publication date |
---|---|
AU2004303792A1 (en) | 2005-07-07 |
ECSP066595A (en) | 2006-10-17 |
MXPA06005540A (en) | 2006-08-17 |
JP2008502589A (en) | 2008-01-31 |
EP1692176A4 (en) | 2008-11-12 |
CN1886424A (en) | 2006-12-27 |
EA009807B1 (en) | 2008-04-28 |
IL174770A0 (en) | 2006-08-20 |
BRPI0417406A (en) | 2007-04-03 |
CA2548065A1 (en) | 2005-07-07 |
EA200600931A1 (en) | 2006-10-27 |
NO20063155L (en) | 2006-08-11 |
KR20070001883A (en) | 2007-01-04 |
CR8426A (en) | 2007-12-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1532174B1 (en) | Anti-igf-i receptor antibody | |
US8034904B2 (en) | Anti-IGF-I receptor antibody | |
US8933202B2 (en) | AXL antibodies | |
EP1819358B1 (en) | Antibodies against vascular endothelial growth factor receptor-1 | |
EP1692176A1 (en) | Anti-igf-i receptor antibody | |
US20150152193A1 (en) | Axl antibodies | |
KR20050021001A (en) | Anti-igf-i receptor antibody | |
CN111886257A (en) | Anti-renalase antibodies for the treatment and prevention of diseases and disorders |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20060612 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU MC NL PL PT RO SE SI SK TR |
|
AX | Request for extension of the european patent |
Extension state: BA HR LV MK YU |
|
RAX | Requested extension states of the european patent have changed |
Extension state: YU Payment date: 20060612 Extension state: MK Payment date: 20060612 Extension state: LV Payment date: 20060612 Extension state: HR Payment date: 20060612 Extension state: BA Payment date: 20060612 Extension state: AL Payment date: 20060612 |
|
A4 | Supplementary search report drawn up and despatched |
Effective date: 20081010 |
|
RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61K 39/395 20060101ALI20081006BHEP Ipc: C07K 16/28 20060101ALI20081006BHEP Ipc: C12N 15/00 20060101ALI20081006BHEP Ipc: C07H 21/04 20060101ALI20081006BHEP Ipc: C07K 16/00 20060101AFI20050708BHEP |
|
RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: IMMUNOGEN, INC. |
|
17Q | First examination report despatched |
Effective date: 20100211 |
|
REG | Reference to a national code |
Ref country code: DE Ref legal event code: R003 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN REFUSED |
|
18R | Application refused |
Effective date: 20120719 |