EP1639102A2 - Phospholipase variants - Google Patents

Phospholipase variants

Info

Publication number
EP1639102A2
EP1639102A2 EP04738924A EP04738924A EP1639102A2 EP 1639102 A2 EP1639102 A2 EP 1639102A2 EP 04738924 A EP04738924 A EP 04738924A EP 04738924 A EP04738924 A EP 04738924A EP 1639102 A2 EP1639102 A2 EP 1639102A2
Authority
EP
European Patent Office
Prior art keywords
polypeptide
seq
phospholipase
amino acid
activity
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP04738924A
Other languages
German (de)
French (fr)
Inventor
Shamkant Anant Patkar
Don Higgins
Tine Muxoll Fatum
Jesper Vind
Sabry Madkor
Thomas Lykke SØRENSEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Chr Hansen AS
Novozymes AS
Novozymes North America Inc
Original Assignee
Chr Hansen AS
Novozymes AS
Novozymes North America Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Chr Hansen AS, Novozymes AS, Novozymes North America Inc filed Critical Chr Hansen AS
Publication of EP1639102A2 publication Critical patent/EP1639102A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT OF FLOUR OR DOUGH FOR BAKING, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS
    • A21D8/00Methods for preparing or baking dough
    • A21D8/02Methods for preparing dough; Treating dough prior to baking
    • A21D8/04Methods for preparing dough; Treating dough prior to baking treating dough with microorganisms or enzymes
    • A21D8/042Methods for preparing dough; Treating dough prior to baking treating dough with microorganisms or enzymes with enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18Carboxylic ester hydrolases (3.1.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18Carboxylic ester hydrolases (3.1.1)
    • C12N9/20Triglyceride splitting, e.g. by means of lipase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y301/00Hydrolases acting on ester bonds (3.1)
    • C12Y301/01Carboxylic ester hydrolases (3.1.1)
    • C12Y301/01032Phospholipase A1 (3.1.1.32)

Definitions

  • the present invention relates to a method of producing a polypeptide by modifying the amino acid sequence of a polypeptide with phospholipase activity, to a polypeptide having 5 phospholipase activity, and to use of the polypeptide in cheese-making.
  • Lipolytic enzymes are polypeptides with hydrolytic activity for carboxylic ester bonds, e.g., lipase and/or phospholipase activity.
  • the substrate specificity is important for the usefulness of the lipolytic enzyme in various industrial o applications.
  • WO 00/32758 discloses lipolytic enzyme variants having altered substrate specificity.
  • WO 98/26057 discloses a Fusarium oxysporum phospholipase.
  • WO 01/83770 describes lipase variants.
  • WO 00/54601 describes a process for producing cheese from cheese milk treated with a phospholipase.
  • the inventors have found that when a fungal phospholipase is used in a cheese- making process, too high lipase activity on triglycerides may lead to a cheese product having changed properties in terms of smell and taste, possibly due to the generation of too many free fatty acids. o To overcome this, the inventors have used protein engineering to develop variants of fungal phospholipases. Starting from a parent phospholipase, they have modified the amino acid sequence to arrive at variants which have phospholipase activity (generally, at roughly the same level as the parent enzyme) and have a lower lipase activity on triglycerides than the parent enzyme. Thus, starting from a parent fungal phospholipase (a polypeptide with 5 phospholipase activity), the inventors have found that the ratio of lipase/phospholipase activity can be decreased by substituting a particular amino acid residue.
  • the variants are useful in the production of cheese, e.g. in a process or method as described in WO 00/54601 , and they result in an increased yield and at the same time avoid the changes in taste and smell, which may result from the generation of too many free fatty o acids.
  • the invention provides a polypeptide which: a) has phospholipase activity, b) has an amino acid sequence which is at least 50 % identical to SEQ ID NO: 1 , and c) has one or more of the following amino acids at a position corresponding to SEQ ID NO: 1 : D62Q/E/F/W/V/P/L/G; V60R/S/K; S85Y/T; G91 R/E; R125K; V203T; V228A; T231R; N233R; L259R/V/P; a deletion D266*; and/or L269A.
  • the invention also provides a method of producing a polypeptide, comprising: a) selecting a first (parent) polypeptide which has phospholipase activity and has an amino acid sequence which is at least 50 % identical to SEQ NO: 1 , b) modifying the amino acid sequence by substituting one or more amino acids at a position corresponding to SEQ ID NO: 1 : D62Q/E/F/W/V/P/L/G; V60R/S/K; S85Y/T; G91R/E; V203T; V228A; T231 R; N233R; L259R/V/P; a deletion D266*; and/or L269A, and c) preparing a second (modified) polypeptide having the modified amino acid sequence.
  • the parent polypeptide may also have lipase activity, and the method may further comprise testing the lipase and phospholipase activities of the two polypeptides and selecting a modified polypeptide having a lower lipase/phospholipase ratio than the parent polypeptide.
  • the invention provides a polynucleotide encoding the polypeptide and a method for producing cheese, comprising the steps of: a) treating cheese milk or a fraction of the cheese milk with the polypeptide; and b) producing cheese from the cheese milk during or after step a).
  • Figure 1 shows an alignment of amino acid sequences of known fungal lipolytic enzymes SEQ ID NO: 1 to 14, as follows:
  • polypeptide of the invention may be derived from a parent polypeptide with phospholipase activity, particularly a phospholipase A1 , classified as EC 3.1.1.32 according to
  • Enzyme Nomenclature (available at http://www.chem.qmw.ac.uk/iubmb/enzyme). It may be a naturally occurring fungal enzyme with phospholipase activity, e.g. one of SEQ ID NO: 2-14, particularly a phospholipase from Fusarium oxysporum which is described in WO 98/26057.
  • the parent may be a fungal lipolytic enzyme variant with phospholipase activity as disclosed in WO 00/32758, e.g. a variant of SEQ ID NO: 1 as described in Example 5 of WO io 00/32758.
  • Lipase activity is measured by the SLU method described in WO 0032758, and the lipase activity of the pure protein is expressed as SLU per unit of A280 (Absorption at 280 nm).
  • Phospholipase activity is measured by incubating 0.025-0.07 mg enzyme protein (e.g. is 0.05 mg) with cream (standardized to 25 % fat by mixing with skimmed milk) at 35 C for 1.5 hr without shaking and measuring phospholipid depletion (by lipid extraction and HPLC analysis).
  • Phospholipase activity is expressed as % PL depletion.
  • the variant polypeptides of the invention typically show 15-75 % PL depletion by this method.
  • the lipase activity is typically below 1000 SLU/A280, particularly below 500, below 20 250, below 100 or below 25.
  • the PL/lipase ratio is typically above 0.05, particularly above 0.1 , above 0.2, above 0.3, above 1 , above 2 or above 3.
  • the phospholipase activity can also be determined by known methods, e.g. as described in WO 0032758, by HPLC or by phospholipid depletion in cream.
  • the parent and the modified 25 polypeptide may have a phospholipase activity of at least 0.25 nmol/min at enzyme dose 60 ⁇ g and 25°C; e.g. at least 0.40 nmol/min, at least 0.75 nmol/min, at least 1.0 nmol/min, at least 1.25 nmol/min, or at least 1.5 nmol/min.
  • the modified polypeptide has one or more of the following amino acids at a position so corresponding to the following in SEQ ID NO: 1: D62Q/E/F/W/V/P/L/G; V60R/S/K; R84G/S; S85Y/T; G91 R/E; R125K; V203T; V228A; T231R; N233R; L259R/V/P; a deletion D266*; and/or L269A.
  • Corresponding positions in SEQ ID NO: 2-14 are defined by the alignment shown in Figure 1, e.g. position I83 of SEQ ID NO: 2.
  • Corresponding positions in other sequences may be found by an alignment as described below.
  • the polypeptide of the invention may further have one or more of the following amino acids at a position corresponding to the following in SEQ ID NO: 1 :
  • N- and/or C-terminus may be extended, e.g. as described in WO 9704079.
  • the C-terminal may be extended by adding residues after position 269, e.g. addition of AGGFS or
  • N-terminal may br extended by the addition of amino acid residues such as SPIRR. Such C- or N-terminal extensions should not be considered, when calculating the amino acid identity with SEQ ID NO: 1.
  • Sequences derived from SEQ ID NO: 2 may be C-terminal processed (e.g. during expression in A. oryzae), e.g. with positions 272, 273, 274 or 286 of SEQ ID NO 2 as the C- terminal residue.
  • the parent and modified polypeptides may be tested for lipase and phospholipase activity, and a variant polypeptide may be selected which has phospholipase activity and a lipase/phospholipase ratio which is lower than the parent polypeptide.
  • Lipase activity can be determined by known methods using a triglyceride as substrate, e.g. as described in WO 20140060600A1
  • a triglyceride as substrate
  • amino acid identity and alignment may be suitably determined by means of computer programs known in the art, such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) (Needleman, S. B. and Wunsch, CD., (1970), Journal of Molecular Biology, 48, 443-45), using GAP with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
  • the variant polypeptide has an amino acid identity to SEQ ID NO: 1 which is at least 50%, particularly at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%.
  • the sequence of interest is aligned to the sequences shown in Figure 1.
  • the new sequence is aligned to the present alignment in Fig. 1 by using the GAP alignment to the most homologous sequence found by the GAP program.
  • GAP is provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) (Needleman, S.B. and Wunsch, CD., (1970), Journal of Molecular Biology, 48, 443-45).
  • the following settings are used for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
  • Example 1 Construction of variants having a increased phospholipase/lipase activity ratio compared to the parent enzyme.
  • each of the above variant polypeptides showed a phospholipase depletion of 15-75 se activity below 250 SLU/A280 and a PL/lipase activity above 0.1.
  • a number of prior-art variants described in Example 5 of WO 0032758 were measured and were found to have a PL/lipase ratio below 0.05.
  • Example 1 The following variant polypeptides from Example 1 were evaluated in a method of producing cheese with the addition of a phospholipase. The controls were without phospholipase addition.
  • the method was a bench top cheese yield evaluation test and was performed as described below.
  • curd pH ⁇ 5.25 - 5.3 drain all whey and flood curd w/ D.I. water at 57 0 C for 5 min. Stretch the curd by hand for ⁇ 1min in 59 0 C water, then place the curd in ice water for 15 min and dry blot. Record weight of curd and refrigerate until further analysis.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The inventors have used protein engineering to develop variants of fungal phospholipases. Starting from a parent phospholipase, they have modified the amino acid sequence to arrive at variants which have phospholipase activity (generally, at roughly the same level as the parent enzyme) and have a lower lipase activity on triglycerides than the parent enzyme.

Description

PHOSPHOLIPASE VARIANTS
FIELD OF INVENTION
The present invention relates to a method of producing a polypeptide by modifying the amino acid sequence of a polypeptide with phospholipase activity, to a polypeptide having 5 phospholipase activity, and to use of the polypeptide in cheese-making.
BACKGROUND OF THE INVENTION
Lipolytic enzymes are polypeptides with hydrolytic activity for carboxylic ester bonds, e.g., lipase and/or phospholipase activity. The substrate specificity (relative activity on different ester bonds) is important for the usefulness of the lipolytic enzyme in various industrial o applications.
WO 00/32758 discloses lipolytic enzyme variants having altered substrate specificity. WO 98/26057 discloses a Fusarium oxysporum phospholipase. WO 01/83770 describes lipase variants. WO 00/54601 describes a process for producing cheese from cheese milk treated with a phospholipase.
s SUMMARY OF THE INVENTION
The inventors have found that when a fungal phospholipase is used in a cheese- making process, too high lipase activity on triglycerides may lead to a cheese product having changed properties in terms of smell and taste, possibly due to the generation of too many free fatty acids. o To overcome this, the inventors have used protein engineering to develop variants of fungal phospholipases. Starting from a parent phospholipase, they have modified the amino acid sequence to arrive at variants which have phospholipase activity (generally, at roughly the same level as the parent enzyme) and have a lower lipase activity on triglycerides than the parent enzyme. Thus, starting from a parent fungal phospholipase (a polypeptide with 5 phospholipase activity), the inventors have found that the ratio of lipase/phospholipase activity can be decreased by substituting a particular amino acid residue.
The variants are useful in the production of cheese, e.g. in a process or method as described in WO 00/54601 , and they result in an increased yield and at the same time avoid the changes in taste and smell, which may result from the generation of too many free fatty o acids.
Accordingly, the invention provides a polypeptide which: a) has phospholipase activity, b) has an amino acid sequence which is at least 50 % identical to SEQ ID NO: 1 , and c) has one or more of the following amino acids at a position corresponding to SEQ ID NO: 1 : D62Q/E/F/W/V/P/L/G; V60R/S/K; S85Y/T; G91 R/E; R125K; V203T; V228A; T231R; N233R; L259R/V/P; a deletion D266*; and/or L269A.
The invention also provides a method of producing a polypeptide, comprising: a) selecting a first (parent) polypeptide which has phospholipase activity and has an amino acid sequence which is at least 50 % identical to SEQ NO: 1 , b) modifying the amino acid sequence by substituting one or more amino acids at a position corresponding to SEQ ID NO: 1 : D62Q/E/F/W/V/P/L/G; V60R/S/K; S85Y/T; G91R/E; V203T; V228A; T231 R; N233R; L259R/V/P; a deletion D266*; and/or L269A, and c) preparing a second (modified) polypeptide having the modified amino acid sequence.
The parent polypeptide may also have lipase activity, and the method may further comprise testing the lipase and phospholipase activities of the two polypeptides and selecting a modified polypeptide having a lower lipase/phospholipase ratio than the parent polypeptide. Further, the invention provides a polynucleotide encoding the polypeptide and a method for producing cheese, comprising the steps of: a) treating cheese milk or a fraction of the cheese milk with the polypeptide; and b) producing cheese from the cheese milk during or after step a).
BRIEF DESCRIPTION OF DRAWINGS Figure 1 shows an alignment of amino acid sequences of known fungal lipolytic enzymes SEQ ID NO: 1 to 14, as follows:
1 : Thermomycθs lanuginosus (SWISSPROT 059952)
2: Fusarium oxysporum (US 6,103,505 SEQ ID NO: 2, GENESEQP AAW51767) 3: Absidia reflexa (US 5,821 ,102 SEQ ID # 10, GENESEQP AAW77403) 4: Absidia corymbifera (US 5,821 ,102 SEQ ID # 6, GENESEQP AAW26689)
5: Rhizomucor miehei (SWISSPROT P19515) 6: Rhizopus oryzae (SWISSPROT P21811 ) 7: Aspergillus niger (SWISSPROT 042807) 8: Aspergillus tubingensis (SWISSPROT 042815) 9: Fusarium heterosporum (TREMBL Q02351 )
10: Aspergillus oryzae (TREMBL P78583) 11 : Penicillium camemberti (SWISSPROT P25234)
12: Aspergillus foetidus (US 5,965,422 SEQ ID # 2, GENESEQP AAW33009) 13: Aspergillus niger (WO 98/31790 SEQ ID # 2, GENESEQP AAW64449) 14: Aspergillus oryzae (JP 10-155493 SEQ ID # 2, GENESEQP AAW 58541 ) DETAILED DESCRIPTION OF THE INVENTION
Parent polypeptide
The polypeptide of the invention may be derived from a parent polypeptide with phospholipase activity, particularly a phospholipase A1 , classified as EC 3.1.1.32 according to
5 Enzyme Nomenclature (available at http://www.chem.qmw.ac.uk/iubmb/enzyme). It may be a naturally occurring fungal enzyme with phospholipase activity, e.g. one of SEQ ID NO: 2-14, particularly a phospholipase from Fusarium oxysporum which is described in WO 98/26057.
Alternatively, the parent may be a fungal lipolytic enzyme variant with phospholipase activity as disclosed in WO 00/32758, e.g. a variant of SEQ ID NO: 1 as described in Example 5 of WO io 00/32758.
Lipase and phospholipase activities
Lipase activity is measured by the SLU method described in WO 0032758, and the lipase activity of the pure protein is expressed as SLU per unit of A280 (Absorption at 280 nm).
Phospholipase activity is measured by incubating 0.025-0.07 mg enzyme protein (e.g. is 0.05 mg) with cream (standardized to 25 % fat by mixing with skimmed milk) at 35 C for 1.5 hr without shaking and measuring phospholipid depletion (by lipid extraction and HPLC analysis).
Phospholipase activity is expressed as % PL depletion.
The variant polypeptides of the invention typically show 15-75 % PL depletion by this method. The lipase activity is typically below 1000 SLU/A280, particularly below 500, below 20 250, below 100 or below 25. The PL/lipase ratio is typically above 0.05, particularly above 0.1 , above 0.2, above 0.3, above 1 , above 2 or above 3.
The phospholipase activity can also be determined by known methods, e.g. as described in WO 0032758, by HPLC or by phospholipid depletion in cream. Using the "monolayer phospholipase assay" described in WO 0032758, the parent and the modified 25 polypeptide may have a phospholipase activity of at least 0.25 nmol/min at enzyme dose 60 μg and 25°C; e.g. at least 0.40 nmol/min, at least 0.75 nmol/min, at least 1.0 nmol/min, at least 1.25 nmol/min, or at least 1.5 nmol/min.
Amino acid alteration
The modified polypeptide has one or more of the following amino acids at a position so corresponding to the following in SEQ ID NO: 1: D62Q/E/F/W/V/P/L/G; V60R/S/K; R84G/S; S85Y/T; G91 R/E; R125K; V203T; V228A; T231R; N233R; L259R/V/P; a deletion D266*; and/or L269A. Corresponding positions in SEQ ID NO: 2-14 are defined by the alignment shown in Figure 1, e.g. position I83 of SEQ ID NO: 2. Corresponding positions in other sequences may be found by an alignment as described below. Compared to SEQ ID NO: 1 , the polypeptide of the invention may further have one or more of the following amino acids at a position corresponding to the following in SEQ ID NO: 1 :
D57G, V60G/C/K/R/L/S/Q, D62H/A, S83T, R84G/S/W; G91A/V, L93K, D96W/F/G, E99K,
R125K, L259S, F262L, G263Q, L264A, I265T, G266D, T267A/E and/or L269N. Also, N- and/or C-terminus may be extended, e.g. as described in WO 9704079. Thus, the C-terminal may be extended by adding residues after position 269, e.g. addition of AGGFS or
AGGFSWRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS. The N-terminal may br extended by the addition of amino acid residues such as SPIRR. Such C- or N-terminal extensions should not be considered, when calculating the amino acid identity with SEQ ID NO: 1.
Sequences derived from SEQ ID NO: 2 may be C-terminal processed (e.g. during expression in A. oryzae), e.g. with positions 272, 273, 274 or 286 of SEQ ID NO 2 as the C- terminal residue.
The parent and modified polypeptides may be tested for lipase and phospholipase activity, and a variant polypeptide may be selected which has phospholipase activity and a lipase/phospholipase ratio which is lower than the parent polypeptide. Lipase activity can be determined by known methods using a triglyceride as substrate, e.g. as described in WO
00/32758.
Amino acid identity and alignment The amino acid identity may be suitably determined by means of computer programs known in the art, such as GAP provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) (Needleman, S. B. and Wunsch, CD., (1970), Journal of Molecular Biology, 48, 443-45), using GAP with the following settings for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
The variant polypeptide has an amino acid identity to SEQ ID NO: 1 which is at least 50%, particularly at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%.
To find the homologous positions in lipase sequences not shown in the alignment, the sequence of interest is aligned to the sequences shown in Figure 1. The new sequence is aligned to the present alignment in Fig. 1 by using the GAP alignment to the most homologous sequence found by the GAP program. GAP is provided in the GCG program package (Program Manual for the Wisconsin Package, Version 8, August 1994, Genetics Computer Group, 575 Science Drive, Madison, Wisconsin, USA 53711) (Needleman, S.B. and Wunsch, CD., (1970), Journal of Molecular Biology, 48, 443-45). The following settings are used for polypeptide sequence comparison: GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
EXAMPLES
Example 1. Construction of variants having a increased phospholipase/lipase activity ratio compared to the parent enzyme.
The following variant polypeptides were constructed as described in WO 00/32758. Each polypeptide is described by the amino acid alterations compared to SEQ ID NO: 1.
Each of the above variant polypeptides showed a phospholipase depletion of 15-75 se activity below 250 SLU/A280 and a PL/lipase activity above 0.1. For comparison, a number of prior-art variants described in Example 5 of WO 0032758 were measured and were found to have a PL/lipase ratio below 0.05.
Example 2. Evaluation of cheese yield using selected variants of the invention
The following variant polypeptides from Example 1 were evaluated in a method of producing cheese with the addition of a phospholipase. The controls were without phospholipase addition.
The method was a bench top cheese yield evaluation test and was performed as described below.
1. Standardize 0.5 kg cheese milk w/ pasteurized skim milk and cream. 2. Prepare a single starter by adding 0.1 g Rhodia LH100 and 0.3 g Rhodia TA061 starter cultures (for mozzarella) to 50 ml of the skim milk and equilibrate to 350C w/ gentle, continuous stirring.
3. Equilibrate cheese milk to 350C and add 0.07 mg enzyme protein per g fat, check initial pH and add 5 ml starter to each cheese milk with gentle agitation . 4. When pH reaches 6.45 - 6.50 add 0.5 ml of rennet (10x diluted Chymax, available from Christian Hansen); stir vigorously for three minutes then remove stirrers from milk, cover water bath and allow milk to coagulate.
5. Cut curd at the appropriate time (30-45 minutes) wit 25 mm [Vz ) knives. To determine cutting time, make a downward cut into the curd with knife or spatula. The curd is ready for cutting when the cut separates upon lifting and sharp edges are maintained on the top surface at the edge of the cut.. Allow the curd to rest for 5 minutes then gently and intermittently stir curd to prevent coalescence of curd particles.
6. Increase temperature to 41 °C and hold until curd pH reaches 5.65 - 5.70, then drain and pour curd particles into stainless steel bowls. Float bowls in 410C water bath to maintain curd temperature. Periodically drain excess whey, leaving only enough to cover curds for maintenance of heat.
7. When curd pH ~ 5.25 - 5.3, drain all whey and flood curd w/ D.I. water at 570C for 5 min. Stretch the curd by hand for ~ 1min in 590C water, then place the curd in ice water for 15 min and dry blot. Record weight of curd and refrigerate until further analysis.
Results
Variants No. 2, 4, 5, 8, 9, 10, 16, 22 and 24 of Example 1 were tested. All the tested variants resulted in improved yield compared to the control, when calculated as moisture adjusted yield.

Claims

1. A polypeptide which: a) has phospholipase activity, b) has an amino acid sequence which is at least 50 % identical to SEQ ID NO: 1 , and c) has one or more of the following amino acids at a position corresponding to SEQ ID
NO: 1 : D62Q/E/F/WΛ//P/L/G; V60R/S/K; S85Y/T; G91R/E; R125K; V203T; V228A; T231R; N233R; L259R/V/P; a deletion D266*; and/or L269A.
2. The polypeptide of claim 1 , which has one or more of the following amino acids at a position corresponding to SEQ ID NO: 1 : D57G, V60G/C/L/Q, D62H/A, S83T, R84G/S/W; G91A/V, L93K, D96W/F/G, E99K, R125K, L259S, F262L, G263Q, L264A, I265T, G266D, T267A/E and/or L269N and/or by a C-terminal extension, particularly AGGFS or AGGFSWRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS.
3. The polypeptide of claim 1 or 2 which has the sequence of SEQ ID NO: 1 with one of the following sets of alterations:
R84W +D96W +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
R84W +G91E +D96W +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
V60G +D62E +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
R84W +G91R +L93K +D96G +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
V60G +D62F +R84W +G91A +D96W +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
R84W +S85Y +G91A +D96W +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
R84W +G91A +D96W +E99K +L259V +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
V60G +D62W +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
R84W +G91R +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSWQMDKEYVKNNQARS
V6OC +D62H +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
V60G +D62V +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
V60K +D62L +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
V60R +D62L +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
V60G +D62G +R84W +G91A +D96W +V228A +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
V60L +D62A +R84W +G91A +D96W +E99K +R125K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
D62E +R84W +G91A +D96W +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
V60S +D62L +R84W +G91A +D96F +E99K +F262L +G263Q +L264A +I265T +G266D +T267A +L269N
D57G +V60Q +D62P +R84W +G91A +D96F +E99K +G263Q +L264A +I265T +G266D +T267A +L269N
R84W +G91A +D96W +E99K +L259R +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
D62Q +R84W +G91A +D96W +E99K +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
R84W +G91A +D96W +E99K +V203T +G263Q +L264A +I265T +G266D +T267A +L269N +270A +271 G +272G +273F +274S +275WRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS
R84S +S85T +G91A +D96S +T231 R +N233R +L259P +G263Q +L264S +I265T +G266* +T267E +L269A
4. A polynucleotide encoding the polypeptide of any of claims 1-3.
5. A method of producing a polypeptide, comprising: a) selecting a first polypeptide which has phospholipase activity and has an amino acid sequence which is at least 50 % identical to SEQ NO: 1 , b) altering the amino acid sequence wherein the alteration comprises one or more substitutions or deletion corresponding to the following in SEQ ID NO: 1 : D62Q/E/F/W/V/P/L/G; V60R/S/K; S85Y/T; G91R/E; V203T; V228A; T231 R; N233R; L259R/V/P; a deletion D266*; and/or L269A, and c) preparing a second polypeptide having the modified amino acid sequence.
6. The method of claim 5 wherein the selected polypeptide has lipase activity, and the method further comprises testing the lipase and phospholipase activities of the two polypeptides and selecting a second polypeptide having a lower lipase/phospholipase ratio than the first polypeptide.
7. A method for producing cheese, comprising the steps of: a) treating cheese milk or a fraction of the cheese milk with the polypeptide of any of claims 1-3 or a polypeptide produced by the method of claim 5 or 6; and b) producing cheese from the cheese milk during or after step a).
EP04738924A 2003-06-19 2004-06-18 Phospholipase variants Withdrawn EP1639102A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US47964703P 2003-06-19 2003-06-19
PCT/DK2004/000426 WO2004111216A2 (en) 2003-06-19 2004-06-18 Phospholipase variants

Publications (1)

Publication Number Publication Date
EP1639102A2 true EP1639102A2 (en) 2006-03-29

Family

ID=33551895

Family Applications (1)

Application Number Title Priority Date Filing Date
EP04738924A Withdrawn EP1639102A2 (en) 2003-06-19 2004-06-18 Phospholipase variants

Country Status (3)

Country Link
US (1) US20060251763A1 (en)
EP (1) EP1639102A2 (en)
WO (1) WO2004111216A2 (en)

Families Citing this family (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6936289B2 (en) 1995-06-07 2005-08-30 Danisco A/S Method of improving the properties of a flour dough, a flour dough improving composition and improved food products
EP1433852B1 (en) 1997-04-09 2006-06-28 Danisco A/S Use of lipase for improving doughs and baked products
DK1098988T4 (en) 1998-07-21 2007-09-03 Danisco Food
NZ528260A (en) 2001-05-18 2005-09-30 Danisco Method of improving dough and bread quality with the addition of an enzyme that hydrolyses a glycolipid and a phospholipid and incapable of hydrolysing a triglyceride or monoglyceride
US20050196766A1 (en) 2003-12-24 2005-09-08 Soe Jorn B. Proteins
MXPA05007654A (en) 2003-01-17 2005-09-30 Danisco Method.
US7955814B2 (en) 2003-01-17 2011-06-07 Danisco A/S Method
US7718408B2 (en) 2003-12-24 2010-05-18 Danisco A/S Method
US7906307B2 (en) 2003-12-24 2011-03-15 Danisco A/S Variant lipid acyltransferases and methods of making
GB0716126D0 (en) 2007-08-17 2007-09-26 Danisco Process
GB0405637D0 (en) 2004-03-12 2004-04-21 Danisco Protein
EA014985B1 (en) 2004-07-16 2011-04-29 Даниско А/С A process of enzymatic degumming edible oils by hydration and use lipid acyltransferase for carrying out the process
US20090047266A1 (en) * 2005-06-24 2009-02-19 Novozymes A/S Lipases for Pharmaceutical Use
EP1752533A1 (en) * 2005-08-12 2007-02-14 Institut National de la Recherche Agronomique Fusion proteins between plant cell-wall degrading enzymes, and their uses
US8383097B2 (en) 2006-08-11 2013-02-26 Novozymes Biologicals, Inc Bacteria cultures and compositions comprising bacteria cultures
DE102006046857A1 (en) 2006-10-02 2008-04-03 Ab Enzymes Gmbh DNA sequence coding for an Aspergillus fumigatus lysophospholipase, e.g. useful for improving the filtration of sugar syrups
DE102006046719A1 (en) 2006-10-02 2008-04-03 Ab Enzymes Gmbh DNA sequence coding for an Aspergillus fumigatus phospholipase, e.g. useful for desliming vegetable oil
US8273348B2 (en) 2006-12-21 2012-09-25 Novozymes A/S Lipase variants for pharmaceutical use
AU2007344910B2 (en) 2007-01-25 2013-03-28 Dupont Nutrition Biosciences Aps Production of a lipid acyltransferase from transformed Bacillus licheniformis cells
JP5427041B2 (en) 2007-03-23 2014-02-26 ノボザイムス バイオロジカルズ,インコーポレイティド Prevention and reduction of biofilm formation and plankton-like growth
EP2149786A1 (en) 2008-08-01 2010-02-03 Unilever PLC Improvements relating to detergent analysis
CN202181298U (en) 2008-09-12 2012-04-04 荷兰联合利华有限公司 Dispenser and preconditioner for viscous liquids
EP2202290A1 (en) 2008-12-23 2010-06-30 Unilever PLC A flowable laundry composition and packaging therefor
CN103052704A (en) 2010-07-22 2013-04-17 荷兰联合利华有限公司 Compositions of rhamnolipids and enzymes for enhanced cleansing
GB201015672D0 (en) 2010-09-20 2010-10-27 Unilever Plc Improvements relating to fabric treatment compositions comprising targeted benefit agents
KR102004375B1 (en) 2011-02-15 2019-07-29 노보자임스 바이오로지컬스 인코포레이티드 Mitigation of odor in cleaning machines and cleaning processes
DK3211074T3 (en) * 2012-02-03 2020-06-02 Novozymes As LIPASE VARIETIES AND POLYNUCLEOTIDES CODING THEM
WO2013149858A1 (en) * 2012-04-02 2013-10-10 Novozymes A/S Lipase variants and polynucleotides encoding same
AU2014280111B2 (en) 2013-06-12 2018-04-05 Earth Alive Clean Technologies Inc. Dust suppressant
CA3109082A1 (en) * 2018-08-16 2020-02-20 Isolere Bio, Inc. Genetically encoded polypeptide for affinity capture and purification of biologics
US20250311734A1 (en) 2022-05-14 2025-10-09 Novozymes A/S Compositions and Methods for Preventing, Treating, Suppressing and/or Eliminatting Phytopathogenic Infestations and Infections
CN115927249B (en) * 2022-08-17 2025-05-27 广东优酶生物制造研究院有限公司 Mutant of RML lipase and application thereof

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX9603542A (en) * 1994-02-22 1997-03-29 Novo Nordisk As A method of preparing a variant of a lipolytic enzyme.
EP1131416B1 (en) * 1998-11-27 2009-09-02 Novozymes A/S Lipolytic enzyme variants
DE60018267T3 (en) * 1999-03-16 2014-02-06 Novozymes A/S PROCESS FOR THE PRODUCTION OF CHEESE
CA2406621A1 (en) * 2000-04-28 2001-11-08 Novozymes A/S Protein variants having modified immunogenicity
CA2431972C (en) * 2001-01-10 2012-10-23 Novozymes A/S Thermostable lipolytic enzyme variant

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2004111216A3 *

Also Published As

Publication number Publication date
WO2004111216A3 (en) 2005-02-24
US20060251763A1 (en) 2006-11-09
WO2004111216A2 (en) 2004-12-23

Similar Documents

Publication Publication Date Title
WO2004111216A2 (en) Phospholipase variants
JP5189130B2 (en) Phospholipase and method for producing the same
AU2019284081B2 (en) Food compositions comprising recombinant milk proteins and methods of producing the same
AU2010214721B2 (en) Lipolytic Enzyme Uses Thereof in the Food Industry
AU2010241524B2 (en) Variant lipolytic enzymes
JP2005517418A (en) Cheese manufacturing method
AU2021227090B2 (en) Lipases, compositions, methods and uses thereof
WO2009106553A2 (en) Lipolytic enzyme variant with improved stability and polynucleotides encoding same
US10829748B2 (en) Mutant lipase and use thereof
EP2406372B1 (en) Pregastric esterase and derivatives thereof
US7972806B2 (en) Phospholipase
CA3025596C (en) Mutant lipase and use thereof
RU2376868C2 (en) Method
CN101319204A (en) Phospholipase and its production method
Zheng Purification, crystallization and cloning of tributyrin esterase from Lactococcus: a thesis presented in partial filfillment of the requirements for the degree of Master of Technology in Biotechnology in the Institute of Molecular Biosciences at Massey University, New Zealand
Sze The Biochemical Study of Lipases from Meiothermus spp.

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20060119

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR

RIN1 Information on inventor provided before grant (corrected)

Inventor name: VIND, JESPER

Inventor name: FATUM, TINE, MUXOLL

Inventor name: HIGGINS, DON

Inventor name: SORENSEN, THOMAS, LYKKE

Inventor name: MADKOR, SABRY

Inventor name: PATKAR, SHAMKANT, ANANT

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20070426

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20080806