EP1631592A2 - Molecules for targeting and releasing therapeutic compounds, and the use thereof - Google Patents
Molecules for targeting and releasing therapeutic compounds, and the use thereofInfo
- Publication number
- EP1631592A2 EP1631592A2 EP04767301A EP04767301A EP1631592A2 EP 1631592 A2 EP1631592 A2 EP 1631592A2 EP 04767301 A EP04767301 A EP 04767301A EP 04767301 A EP04767301 A EP 04767301A EP 1631592 A2 EP1631592 A2 EP 1631592A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- segment
- molecule
- targeting
- molecule according
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 230000008685 targeting Effects 0.000 title claims abstract description 82
- 150000001875 compounds Chemical class 0.000 title claims abstract description 67
- 230000001225 therapeutic effect Effects 0.000 title claims abstract description 62
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 29
- 238000011282 treatment Methods 0.000 claims abstract description 25
- 230000001640 apoptogenic effect Effects 0.000 claims abstract description 13
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 6
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 89
- 210000004027 cell Anatomy 0.000 claims description 53
- 108091005804 Peptidases Proteins 0.000 claims description 44
- 239000004365 Protease Substances 0.000 claims description 43
- 210000001519 tissue Anatomy 0.000 claims description 42
- 150000001413 amino acids Chemical class 0.000 claims description 40
- 108090000623 proteins and genes Proteins 0.000 claims description 33
- 102000004169 proteins and genes Human genes 0.000 claims description 32
- 230000000259 anti-tumor effect Effects 0.000 claims description 29
- 230000003110 anti-inflammatory effect Effects 0.000 claims description 26
- 239000003814 drug Substances 0.000 claims description 24
- 238000003776 cleavage reaction Methods 0.000 claims description 22
- 230000007017 scission Effects 0.000 claims description 22
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 21
- 239000012634 fragment Substances 0.000 claims description 20
- 239000003112 inhibitor Substances 0.000 claims description 20
- 102000004190 Enzymes Human genes 0.000 claims description 19
- 108090000790 Enzymes Proteins 0.000 claims description 19
- 229940088598 enzyme Drugs 0.000 claims description 19
- 230000006907 apoptotic process Effects 0.000 claims description 18
- 238000000034 method Methods 0.000 claims description 18
- 102000004127 Cytokines Human genes 0.000 claims description 17
- 108090000695 Cytokines Proteins 0.000 claims description 17
- 102000005962 receptors Human genes 0.000 claims description 17
- 108020003175 receptors Proteins 0.000 claims description 17
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 claims description 12
- 239000012528 membrane Substances 0.000 claims description 12
- 239000003862 glucocorticoid Substances 0.000 claims description 10
- 239000000126 substance Substances 0.000 claims description 10
- 229910052757 nitrogen Inorganic materials 0.000 claims description 9
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 claims description 8
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 claims description 8
- 150000002632 lipids Chemical class 0.000 claims description 8
- 238000004519 manufacturing process Methods 0.000 claims description 8
- 229960000485 methotrexate Drugs 0.000 claims description 8
- 229940037128 systemic glucocorticoids Drugs 0.000 claims description 8
- 102000003298 tumor necrosis factor receptor Human genes 0.000 claims description 8
- 108050008874 Annexin Proteins 0.000 claims description 7
- 102000000412 Annexin Human genes 0.000 claims description 7
- 201000011510 cancer Diseases 0.000 claims description 7
- 238000001727 in vivo Methods 0.000 claims description 7
- 101150085091 lat-2 gene Proteins 0.000 claims description 7
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 claims description 7
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 claims description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 6
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 claims description 6
- 229960004679 doxorubicin Drugs 0.000 claims description 6
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 claims description 6
- 229960001924 melphalan Drugs 0.000 claims description 6
- 229910052717 sulfur Inorganic materials 0.000 claims description 6
- 108090000663 Annexin A1 Proteins 0.000 claims description 5
- 102000004145 Annexin A1 Human genes 0.000 claims description 5
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 claims description 5
- 102000001708 Protein Isoforms Human genes 0.000 claims description 5
- 108010029485 Protein Isoforms Proteins 0.000 claims description 5
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 5
- 230000003213 activating effect Effects 0.000 claims description 5
- 125000000539 amino acid group Chemical group 0.000 claims description 5
- 230000008569 process Effects 0.000 claims description 5
- 230000000770 proinflammatory effect Effects 0.000 claims description 5
- 229940123237 Taxane Drugs 0.000 claims description 4
- 102000006240 membrane receptors Human genes 0.000 claims description 4
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 claims description 3
- 229940100198 alkylating agent Drugs 0.000 claims description 3
- 239000002168 alkylating agent Substances 0.000 claims description 3
- 229960003668 docetaxel Drugs 0.000 claims description 3
- 229910052739 hydrogen Inorganic materials 0.000 claims description 3
- 208000027866 inflammatory disease Diseases 0.000 claims description 3
- 108020004084 membrane receptors Proteins 0.000 claims description 3
- 239000006187 pill Substances 0.000 claims description 3
- CQOQDQWUFQDJMK-SSTWWWIQSA-N 2-methoxy-17beta-estradiol Chemical compound C([C@@H]12)C[C@]3(C)[C@@H](O)CC[C@H]3[C@@H]1CCC1=C2C=C(OC)C(O)=C1 CQOQDQWUFQDJMK-SSTWWWIQSA-N 0.000 claims description 2
- MMBZCFJKAQZVNI-VPENINKCSA-N 4-amino-5,6-difluoro-1-[(2r,4s,5r)-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidin-2-one Chemical compound FC1=C(F)C(N)=NC(=O)N1[C@@H]1O[C@H](CO)[C@@H](O)C1 MMBZCFJKAQZVNI-VPENINKCSA-N 0.000 claims description 2
- 102000015081 Blood Coagulation Factors Human genes 0.000 claims description 2
- 108010039209 Blood Coagulation Factors Proteins 0.000 claims description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 claims description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 claims description 2
- 102000005741 Metalloproteases Human genes 0.000 claims description 2
- 108010006035 Metalloproteases Proteins 0.000 claims description 2
- 229930012538 Paclitaxel Natural products 0.000 claims description 2
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 claims description 2
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 claims description 2
- 150000001412 amines Chemical class 0.000 claims description 2
- 239000003114 blood coagulation factor Substances 0.000 claims description 2
- 210000002744 extracellular matrix Anatomy 0.000 claims description 2
- 229960001592 paclitaxel Drugs 0.000 claims description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 claims description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 2
- 101001075931 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) 50S ribosomal protein L6 Proteins 0.000 claims 1
- 229940045799 anthracyclines and related substance Drugs 0.000 claims 1
- 229940019700 blood coagulation factors Drugs 0.000 claims 1
- 229910052799 carbon Inorganic materials 0.000 claims 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 claims 1
- 229960005356 urokinase Drugs 0.000 claims 1
- 230000015572 biosynthetic process Effects 0.000 abstract description 25
- 230000001575 pathological effect Effects 0.000 abstract description 22
- 238000003786 synthesis reaction Methods 0.000 abstract description 20
- 239000000203 mixture Substances 0.000 abstract description 15
- 230000007170 pathology Effects 0.000 abstract description 14
- 206010061218 Inflammation Diseases 0.000 abstract description 8
- 230000004054 inflammatory process Effects 0.000 abstract description 8
- 238000002360 preparation method Methods 0.000 abstract description 7
- 241000124008 Mammalia Species 0.000 abstract description 3
- 239000000543 intermediate Substances 0.000 abstract description 2
- 102000035195 Peptidases Human genes 0.000 description 42
- 235000018102 proteins Nutrition 0.000 description 30
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 27
- 235000001014 amino acid Nutrition 0.000 description 27
- 230000009471 action Effects 0.000 description 20
- 229920001184 polypeptide Polymers 0.000 description 19
- 239000011347 resin Substances 0.000 description 18
- 229920005989 resin Polymers 0.000 description 18
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 17
- QTBSBXVTEAMEQO-UHFFFAOYSA-N acetic acid Substances CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 16
- 230000000694 effects Effects 0.000 description 16
- 230000006870 function Effects 0.000 description 16
- 230000002757 inflammatory effect Effects 0.000 description 16
- 239000013598 vector Substances 0.000 description 16
- 229940079593 drug Drugs 0.000 description 14
- 210000004899 c-terminal region Anatomy 0.000 description 13
- 229940002612 prodrug Drugs 0.000 description 13
- 239000000651 prodrug Substances 0.000 description 13
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 12
- 230000008901 benefit Effects 0.000 description 12
- -1 intein Chemical compound 0.000 description 11
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 210000000170 cell membrane Anatomy 0.000 description 9
- 239000000872 buffer Substances 0.000 description 8
- 230000002209 hydrophobic effect Effects 0.000 description 8
- 241000282412 Homo Species 0.000 description 7
- 230000004913 activation Effects 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 210000004881 tumor cell Anatomy 0.000 description 7
- VHYFNPMBLIVWCW-UHFFFAOYSA-N 4-Dimethylaminopyridine Chemical compound CN(C)C1=CC=NC=C1 VHYFNPMBLIVWCW-UHFFFAOYSA-N 0.000 description 6
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 6
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 6
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 238000010168 coupling process Methods 0.000 description 6
- MQUBEBJFHBANKV-UHFFFAOYSA-N di(propan-2-yl)silicon Chemical compound CC(C)[Si]C(C)C MQUBEBJFHBANKV-UHFFFAOYSA-N 0.000 description 6
- 238000011534 incubation Methods 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- DTQVDTLACAAQTR-UHFFFAOYSA-N trifluoroacetic acid Substances OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 6
- WSLDOOZREJYCGB-UHFFFAOYSA-N 1,2-Dichloroethane Chemical compound ClCCCl WSLDOOZREJYCGB-UHFFFAOYSA-N 0.000 description 5
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 5
- IUTPJBLLJJNPAJ-UHFFFAOYSA-N 3-(2,5-dioxopyrrol-1-yl)propanoic acid Chemical compound OC(=O)CCN1C(=O)C=CC1=O IUTPJBLLJJNPAJ-UHFFFAOYSA-N 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 5
- 102000003814 Interleukin-10 Human genes 0.000 description 5
- 108090000174 Interleukin-10 Proteins 0.000 description 5
- 101150039486 NTA1 gene Proteins 0.000 description 5
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 5
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 5
- 239000002253 acid Substances 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 238000010276 construction Methods 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- 238000007306 functionalization reaction Methods 0.000 description 5
- 102000057593 human F8 Human genes 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 229940076144 interleukin-10 Drugs 0.000 description 5
- 235000019419 proteases Nutrition 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 4
- 108090000371 Esterases Proteins 0.000 description 4
- 101001027836 Homo sapiens Coagulation factor V Proteins 0.000 description 4
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 4
- 102000004388 Interleukin-4 Human genes 0.000 description 4
- 108090000978 Interleukin-4 Proteins 0.000 description 4
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 4
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 4
- 102100040247 Tumor necrosis factor Human genes 0.000 description 4
- 230000001154 acute effect Effects 0.000 description 4
- 230000000903 blocking effect Effects 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 238000009826 distribution Methods 0.000 description 4
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 238000005829 trimerization reaction Methods 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- GIAFURWZWWWBQT-UHFFFAOYSA-N 2-(2-aminoethoxy)ethanol Chemical compound NCCOCCO GIAFURWZWWWBQT-UHFFFAOYSA-N 0.000 description 3
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 3
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 3
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- 229940126062 Compound A Drugs 0.000 description 3
- 208000011231 Crohn disease Diseases 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- NLDMNSXOCDLTTB-UHFFFAOYSA-N Heterophylliin A Natural products O1C2COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC2C(OC(=O)C=2C=C(O)C(O)=C(O)C=2)C(O)C1OC(=O)C1=CC(O)=C(O)C(O)=C1 NLDMNSXOCDLTTB-UHFFFAOYSA-N 0.000 description 3
- 101000627872 Homo sapiens 72 kDa type IV collagenase Proteins 0.000 description 3
- 101000990902 Homo sapiens Matrix metalloproteinase-9 Proteins 0.000 description 3
- 101000990915 Homo sapiens Stromelysin-1 Proteins 0.000 description 3
- 102000003816 Interleukin-13 Human genes 0.000 description 3
- 108090000176 Interleukin-13 Proteins 0.000 description 3
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 3
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- SJRJJKPEHAURKC-UHFFFAOYSA-N N-Methylmorpholine Chemical compound CN1CCOCC1 SJRJJKPEHAURKC-UHFFFAOYSA-N 0.000 description 3
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 3
- 102100030416 Stromelysin-1 Human genes 0.000 description 3
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 3
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 3
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 3
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 3
- 239000013543 active substance Substances 0.000 description 3
- 229940124599 anti-inflammatory drug Drugs 0.000 description 3
- 230000001588 bifunctional effect Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 238000009792 diffusion process Methods 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 230000001747 exhibiting effect Effects 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 3
- 210000001539 phagocyte Anatomy 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 238000000527 sonication Methods 0.000 description 3
- 125000006850 spacer group Chemical group 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 125000003396 thiol group Chemical group [H]S* 0.000 description 3
- 231100000331 toxic Toxicity 0.000 description 3
- 230000002588 toxic effect Effects 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 102000029791 ADAM Human genes 0.000 description 2
- 108091022885 ADAM Proteins 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 102000002110 C2 domains Human genes 0.000 description 2
- 108050009459 C2 domains Proteins 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- 102000012410 DNA Ligases Human genes 0.000 description 2
- 108010061982 DNA Ligases Proteins 0.000 description 2
- 102000000589 Interleukin-1 Human genes 0.000 description 2
- 108010002352 Interleukin-1 Proteins 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- 102000018697 Membrane Proteins Human genes 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 101100408299 Oryza sativa subsp. japonica PIL13 gene Proteins 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 2
- 206010040070 Septic Shock Diseases 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000012736 aqueous medium Substances 0.000 description 2
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 2
- 206010003246 arthritis Diseases 0.000 description 2
- 208000006673 asthma Diseases 0.000 description 2
- 239000012148 binding buffer Substances 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- 229960004630 chlorambucil Drugs 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000012043 crude product Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 210000003128 head Anatomy 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 230000017730 intein-mediated protein splicing Effects 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 210000003739 neck Anatomy 0.000 description 2
- KPSSIOMAKSHJJG-UHFFFAOYSA-N neopentyl alcohol Chemical compound CC(C)(C)CO KPSSIOMAKSHJJG-UHFFFAOYSA-N 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 108010091718 peptide L Proteins 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000036303 septic shock Effects 0.000 description 2
- 238000007086 side reaction Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000000377 silicon dioxide Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 2
- AQRLNPVMDITEJU-UHFFFAOYSA-N triethylsilane Chemical compound CC[SiH](CC)CC AQRLNPVMDITEJU-UHFFFAOYSA-N 0.000 description 2
- 239000013638 trimer Substances 0.000 description 2
- GHYOCDFICYLMRF-UTIIJYGPSA-N (2S,3R)-N-[(2S)-3-(cyclopenten-1-yl)-1-[(2R)-2-methyloxiran-2-yl]-1-oxopropan-2-yl]-3-hydroxy-3-(4-methoxyphenyl)-2-[[(2S)-2-[(2-morpholin-4-ylacetyl)amino]propanoyl]amino]propanamide Chemical compound C1(=CCCC1)C[C@@H](C(=O)[C@@]1(OC1)C)NC([C@H]([C@@H](C1=CC=C(C=C1)OC)O)NC([C@H](C)NC(CN1CCOCC1)=O)=O)=O GHYOCDFICYLMRF-UTIIJYGPSA-N 0.000 description 1
- GUHPRPJDBZHYCJ-SECBINFHSA-N (2s)-2-(5-benzoylthiophen-2-yl)propanoic acid Chemical compound S1C([C@H](C(O)=O)C)=CC=C1C(=O)C1=CC=CC=C1 GUHPRPJDBZHYCJ-SECBINFHSA-N 0.000 description 1
- CBPJQFCAFFNICX-IBGZPJMESA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-4-methylpentanoic acid Chemical compound C1=CC=C2C(COC(=O)N[C@@H](CC(C)C)C(O)=O)C3=CC=CC=C3C2=C1 CBPJQFCAFFNICX-IBGZPJMESA-N 0.000 description 1
- HXSHBEIVXXJJIJ-MHEUWTTISA-N (8R,9S,13S,14S)-15-methoxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthrene-3,17-diol Chemical compound OC1=CC=C2[C@H]3CC[C@]4(C)C(O)CC(OC)[C@H]4[C@@H]3CCC2=C1 HXSHBEIVXXJJIJ-MHEUWTTISA-N 0.000 description 1
- PIYNUZCGMLCXKJ-UHFFFAOYSA-N 1,4-dioxane-2,6-dione Chemical compound O=C1COCC(=O)O1 PIYNUZCGMLCXKJ-UHFFFAOYSA-N 0.000 description 1
- MEKOFIRRDATTAG-UHFFFAOYSA-N 2,2,5,8-tetramethyl-3,4-dihydrochromen-6-ol Chemical compound C1CC(C)(C)OC2=C1C(C)=C(O)C=C2C MEKOFIRRDATTAG-UHFFFAOYSA-N 0.000 description 1
- FGGVRPFJBBRZFG-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-(2-hydroxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCOCCOCCOCCOCCOCCOCCOCCOCCO FGGVRPFJBBRZFG-UHFFFAOYSA-N 0.000 description 1
- JUIKUQOUMZUFQT-UHFFFAOYSA-N 2-bromoacetamide Chemical compound NC(=O)CBr JUIKUQOUMZUFQT-UHFFFAOYSA-N 0.000 description 1
- 108091007505 ADAM17 Proteins 0.000 description 1
- ORILYTVJVMAKLC-UHFFFAOYSA-N Adamantane Natural products C1C(C2)CC3CC1CC2C3 ORILYTVJVMAKLC-UHFFFAOYSA-N 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000027932 Collagen disease Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 102100031111 Disintegrin and metalloproteinase domain-containing protein 17 Human genes 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 101000959738 Homo sapiens Annexin A1 Proteins 0.000 description 1
- 101001002709 Homo sapiens Interleukin-4 Proteins 0.000 description 1
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 241001625930 Luria Species 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- PRQROPMIIGLWRP-UHFFFAOYSA-N N-formyl-methionyl-leucyl-phenylalanin Chemical compound CSCCC(NC=O)C(=O)NC(CC(C)C)C(=O)NC(C(O)=O)CC1=CC=CC=C1 PRQROPMIIGLWRP-UHFFFAOYSA-N 0.000 description 1
- 101800001340 N-terminal form Proteins 0.000 description 1
- 102400000874 N-terminal form Human genes 0.000 description 1
- CMWTZPSULFXXJA-UHFFFAOYSA-N Naproxen Natural products C1=C(C(C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-UHFFFAOYSA-N 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical class OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- JZFPYUNJRRFVQU-UHFFFAOYSA-N Niflumic acid Chemical compound OC(=O)C1=CC=CN=C1NC1=CC=CC(C(F)(F)F)=C1 JZFPYUNJRRFVQU-UHFFFAOYSA-N 0.000 description 1
- 108020005497 Nuclear hormone receptor Proteins 0.000 description 1
- 102000007399 Nuclear hormone receptor Human genes 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 101150023963 PIL1 gene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 208000037273 Pathologic Processes Diseases 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 108010021757 Polynucleotide 5'-Hydroxyl-Kinase Proteins 0.000 description 1
- 102000008422 Polynucleotide 5'-hydroxyl-kinase Human genes 0.000 description 1
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 1
- 108050003267 Prostaglandin G/H synthase 2 Proteins 0.000 description 1
- 102000004005 Prostaglandin-endoperoxide synthases Human genes 0.000 description 1
- 108090000459 Prostaglandin-endoperoxide synthases Proteins 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 102000017975 Protein C Human genes 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 229940111136 antiinflammatory and antirheumatic drug fenamates Drugs 0.000 description 1
- 229940111131 antiinflammatory and antirheumatic product propionic acid derivative Drugs 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 230000005775 apoptotic pathway Effects 0.000 description 1
- 229940114079 arachidonic acid Drugs 0.000 description 1
- 235000021342 arachidonic acid Nutrition 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 230000035605 chemotaxis Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 229940114081 cinnamate Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000012230 colorless oil Substances 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 229940125797 compound 12 Drugs 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000030609 dephosphorylation Effects 0.000 description 1
- 238000006209 dephosphorylation reaction Methods 0.000 description 1
- 229960001259 diclofenac Drugs 0.000 description 1
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- VFRSADQPWYCXDG-LEUCUCNGSA-N ethyl (2s,5s)-5-methylpyrrolidine-2-carboxylate;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.CCOC(=O)[C@@H]1CC[C@H](C)N1 VFRSADQPWYCXDG-LEUCUCNGSA-N 0.000 description 1
- XFBVBWWRPKNWHW-UHFFFAOYSA-N etodolac Chemical compound C1COC(CC)(CC(O)=O)C2=N[C]3C(CC)=CC=CC3=C21 XFBVBWWRPKNWHW-UHFFFAOYSA-N 0.000 description 1
- 229960005293 etodolac Drugs 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 210000004996 female reproductive system Anatomy 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 238000003818 flash chromatography Methods 0.000 description 1
- 125000003929 folic acid group Chemical group 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 150000002337 glycosamines Chemical class 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 102000055229 human IL4 Human genes 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 229940028885 interleukin-4 Drugs 0.000 description 1
- 230000016507 interphase Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 210000003093 intracellular space Anatomy 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 210000004995 male reproductive system Anatomy 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960003464 mefenamic acid Drugs 0.000 description 1
- HYYBABOKPJLUIN-UHFFFAOYSA-N mefenamic acid Chemical compound CC1=CC=CC(NC=2C(=CC=CC=2)C(O)=O)=C1C HYYBABOKPJLUIN-UHFFFAOYSA-N 0.000 description 1
- 210000002418 meninge Anatomy 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000011278 mitosis Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 229960002009 naproxen Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-N naproxen Chemical compound C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-N 0.000 description 1
- 229960000916 niflumic acid Drugs 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 108020004017 nuclear receptors Proteins 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- QQBDLJCYGRGAKP-FOCLMDBBSA-N olsalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=C(C(O)=CC=2)C(O)=O)=C1 QQBDLJCYGRGAKP-FOCLMDBBSA-N 0.000 description 1
- 229960004110 olsalazine Drugs 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000002926 oxygen Chemical class 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 230000009054 pathological process Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000009457 physiological apoptosis Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 230000005522 programmed cell death Effects 0.000 description 1
- 150000005599 propionic acid derivatives Chemical class 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 238000007614 solvation Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 229960000894 sulindac Drugs 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 229960003676 tenidap Drugs 0.000 description 1
- LXIKEPCNDFVJKC-QXMHVHEDSA-N tenidap Chemical compound C12=CC(Cl)=CC=C2N(C(=O)N)C(=O)\C1=C(/O)C1=CC=CS1 LXIKEPCNDFVJKC-QXMHVHEDSA-N 0.000 description 1
- MFPWEWYKQYMWRO-UHFFFAOYSA-N tert-butyl carboxy carbonate Chemical compound CC(C)(C)OC(=O)OC(O)=O MFPWEWYKQYMWRO-UHFFFAOYSA-N 0.000 description 1
- 229960001312 tiaprofenic acid Drugs 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 238000009827 uniform distribution Methods 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4721—Lipocortins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to chimeric molecules for targeting and releasing therapeutic compounds in mammals, especially humans.
- the molecules of the invention mainly comprise three segments or functional domains: a targeting segment, capable of preferentially binding to the surface of the targeted cells, a therapeutic segment, comprising the biologically active compound, and a linking segment between the segment of targeting and the therapeutic segment, the binding segment being cleavable at the target site.
- the invention also relates to the preparation of these molecules, synthesis intermediates or domains thereof, pharmaceutical compositions containing them, and their uses, in particular in the pharmaceutical field.
- the molecules and compositions of the invention are very particularly suitable for targeting pathological cells engaged in an apoptotic pathway, and for the treatment of pathologies or associated tissues, in particular cancers and inflammation.
- Anti-tumor compounds are in principle highly cytotoxic compounds, which are distributed throughout the body when administered systemically. They produce extremely damaging side reactions to the individual. There is therefore a very great interest in distributing these anti-tumor compounds only in tumor tissues, that is to say in targeting these tissues by means of a specific vector. Although this problem of treatment toxicity is particularly acute for cancer, it can be generalized to a large number of treatments in which, in general, a minimum of side effect is sought for maximum therapeutic effect.
- a system called ADEPT Antibody Directed Enzyme Prodrug Therapy
- ADEPT Antibody Directed Enzyme Prodrug Therapy
- an antibody carries an enzyme to the tumor site.
- a prodrug is administered and converted into an active molecule by this enzyme (US 5,760,072; US 5,433,955).
- US 5,760,072; US 5,433,955 the enzyme allowing activation of the prodrug is targeted.
- the pro-drug is therefore distributed throughout the body, which does not entirely exclude side reactions and reduces the dose of pro-drug actually supplied to the tumor site.
- this approach is complex because it requires the use of several types of molecules.
- An analogous method based on targeting the enzyme capable of activating the pro-drug has been described in the applications (WO97 / 26918; WO 98/51787).
- the object of the present invention is to provide molecules capable of targeting tissues presenting a pathology and of specifically liberating therefrom compounds with therapeutic properties for this pathology. Thanks to the molecules of the invention, the therapeutic compounds exert their activity in a localized and more effective manner, and offer risks of side effects much lower.
- the molecules of the invention can be constructed to target different types of pathological cells or tissues, preferably in humans.
- the invention is based on the targeting of apoptotic cells, thanks to a targeting element having the property of binding to cell membranes expressing a negatively charged lipid, in particular phosphatidylserine (PS).
- PS phosphatidylserine
- Apoptosis or programmed cell death, is a normal physiological phenomenon, characteristic of multicellular organisms and present in particular in humans. Under normal conditions, the rate of apoptosis is however low and the apoptotic cells are very quickly phagocytosed either by neighboring cells, or more often by professional phagocytic cells such as macrophages or dendritic cells. In addition, apoptotic sites are often very dispersed and show no synchronization. As a result, physiological apoptosis is generally undetectable.
- Apoptosis is signaled to phagocytic cells by the presence of PS on the surface of apoptotic cells, resulting from the loss of asymmetry in their plasma membrane.
- the presence of detectable apoptosis is a sign of a physiological disorder where the phagocytic functions are overwhelmed and unable to cope with the increase in cells to be eliminated.
- Well-known examples of such disorders are, for example, apoptosis of the heart muscle after a heart attack or hepatic apoptosis following a strong viral infection or other conditions of an acute nature. Apoptotic cells are also found in other tissues or pathological mechanisms, such as inflammation and cancer.
- the pathological tissue contains little or not enough target cells capable of massively retaining the therapeutic molecules of the invention
- these can be used in combination with an agent or a treatment causing or promoting apoptosis in within the pathological tissue in order to increase the therapeutic benefit.
- an agent promoting apoptosis for example a conventional anti-tumor
- the advantage of targeting apoptotic cells in the tumor environment lies in the kinetic effect linked to the administration of the compound anti-tumor: in the first case, the action of the therapeutic compound, if administered continuously, produces an increase in the "target” and therefore in the effective concentration of said therapeutic compound in the tumor environment, while, in the second case, the size of the "target” tends to decrease as well as the effective concentration of the therapeutic compound.
- This cumulative effect resulting from the targeting of apoptotic cells is also very important for controlling the initial stages of metastasis by maintaining an optimal concentration of the therapeutic compound in the final stages of tumor regression.
- the strong decrease in the effective dose of anti-tumor compound and its strong localization in the tumor region has of course also the effect of considerably reducing the secondary toxic effects on the patient.
- the molecules of the invention therefore make it possible to target different pathological tissues and to release a therapeutic or biologically active agent therein in situ, thereby reducing their undesirable cytotoxic effects on healthy tissues.
- a first subject of the invention therefore resides in chimeric molecules comprising a targeting region, an active region and a binding region sensitive to the environment of a pathological tissue or cell.
- the targeting region is preferably a region targeting apoptotic cells.
- the active region can be any therapeutic compound, typically anti-cancer or anti-inflammatory.
- the therapeutic compound is typically less active when it is in the form of a chimeric molecule of the invention, than in a free form.
- Another subject of the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising a chimeric molecule as defined above.
- Another object of the invention relates to the use of targeting molecules as defined above for the preparation of medicaments.
- these drugs are anti-tumor or anti-inflammatory drugs.
- the invention can be used in particular for the treatment of solid or liquid or hematopoietic tumors, in particular of breast, lung, intestine, colon, prostate, brain, head and neck, liver cancers. , skin, lymphoma, melanoma, etc.
- the therapeutic compound is an anti-inflammatory
- the molecules according to the invention can be used for the preparation of medicaments intended for treatment of acute or chronic inflammatory pathologies such as asthma, ulcerative colitis, Crohn's disease, septic shock, collagen diseases and P arthritis.
- Another object of the invention relates to the use of targeting molecules as defined above for the local delivery of active principles in the vicinity of pathological tissues in subjects.
- the present invention also relates to methods of treating a pathology in a subject comprising the administration of a molecule or a composition as defined above.
- the pathology concerned is cancer or inflammation.
- the treatment method may further comprise a preliminary step consisting of a treatment making it possible to generate cells engaged in a process of apoptosis in the pathological tissue. It also relates to methods of local delivery of active principles in the vicinity of pathological tissues in subjects, comprising the administration of a molecule or of a composition as defined above.
- the molecules of the invention typically comprise three parts or functional domains linked to each other, namely a targeting region (C), a biologically active region (A) and a binding region (L) sensitive to the environment of a tissue or pathological cell.
- a targeting region C
- A biologically active region
- L binding region sensitive to the environment of a tissue or pathological cell.
- the arrangement of the different elements can vary, and in particular according to the order A-L-C or C-L-A.
- the region (or function) L can be inserted or included within one of the regions A or C.
- Targeting segment C is a molecule capable of recognizing or preferentially binding cells engaged in a pathological process, preferably apoptosis; 2)
- the binding segment L is a molecule ensuring the binding between A and C, said binding being cleavable at the target site allowing the release of the therapeutic segment A;
- Part A is a biologically active molecule with therapeutic properties.
- Targeting segment C comprises a polypeptide capable of binding to the surface of cells characteristically or specifically present in a tissue presenting a pathology, or generated in this tissue by a prior or combined treatment.
- This targeting segment C is preferably capable of binding to the membranes of cells engaged in a process of apoptosis, these exposing on their surface negatively charged lipids such as phosphatidylserine.
- part C comprises a polypeptide capable of preferentially binding to the surface of tumor cells or present in tumor tissue or generated in these tissues by treatment with an agent promoting apoptosis, for example an anti-tumor (chemotherapy, radiotherapy, etc.).
- an agent promoting apoptosis for example an anti-tumor (chemotherapy, radiotherapy, etc.).
- the targeting segment C comprises a polypeptide capable of preferentially binding to the surface of the cells present in an inflammatory tissue and in particular the neutrophil cells which accumulate in these tissues and die there by apoptosis 24 48 hours after their arrival.
- Neutrophils are "baits" for targeting molecules.
- the term "preferentially bind" indicates that the targeting element has a particular affinity for the cells or tissues considered, even if a non-specific or less important bond with other cells or tissues cannot be completely excluded in vivo.
- the preferential bond nevertheless ensures targeting of the chimeric molecules of the invention towards the pathological sites, reducing the dissemination and the potential side effects.
- the targeting segment C is preferably a peptide molecule.
- peptide molecule is meant any molecule composed or comprising amino acids, natural or not, optionally modified, such as for example any protein or fragment of protein, a polypeptide or peptide, natural or synthetic, modified or not.
- the common property of these elements is to be able to bind preferentially to cells characteristic of pathological situations and, in a more preferred mode, to cell membranes exhibiting negatively charged lipids, in particular phosphatidylserine.
- the present invention provides for the use of any protein, fragment or derivative of protein meeting this criterion.
- proteins capable of binding to membranes exposing negatively charged lipids. Mention may in particular be made of the Annexin family, the families of proteins comprising a Cl or C2 domain, such as factors V and VIII of blood coagulation; families of proteins comprising a PH domain or a FYVE domain; or proteins with an identical domain or homologous to domain 5 of ⁇ 2-Glycoproteins-I ( ⁇ GP-I). These proteins, or domains derived from or derived from their sequences can be used as a targeting element in the chimeric molecules of the invention. For reasons of immunogenicity, the human version of these proteins or protein domains is preferably chosen. In addition, whenever possible, it is necessary to select and use the smallest active domain of these proteins in order to ensure the best diffusion of the molecule through the micro-vascularization towards the targeted tissues and above all a better bio-distribution and elimination by the renal route.
- the targeting element comprises a peptide sequence derived from the proteins or protein fragments mentioned above.
- fragment is meant a sequence of at least 10 consecutive amino acids, preferably between 50 and 500 amino acids, even more preferably around 250 to 350 amino acids.
- These derivatives have at least 50% identity with the initial proteins or the fragments thereof. Preferably, they have 60%, 75%, 90% or 95% identity.
- Some of the protein domains mentioned, in particular the PH and FYVE domains can moreover be mutated so as to modify their lipid specificity to adapt them to the precise needs of targeting cells in the apoptotic phase.
- the targeting segment C can contain one or more sites for binding to the segment L.
- the presence of several sites has the advantage of being able to distribute several molecules therapeutic A in one go and increase in the same proportions the concentration of A in the environment of the tissues affected by the pathology concerned.
- the structure of the molecule according to the present invention is then:
- the targeting segment C can comprise a repetition of several polypeptides or motifs for binding to pathological or target cells (designated CO), in order to increase the efficiency of targeting.
- the general formula of such molecules is as follows:
- n 1 or 2.
- the targeting segment C comprises the sequence of an annexin, or of a fragment or a derivative thereof.
- Targeting segment C preferably comprises the sequence of the “four-domain heart” of a protein of the annexin family.
- the annexin is of type V, a fragment or a derivative thereof.
- Annexin of human origin is preferred.
- the targeting segment C comprises domain 1 of this annexin.
- the targeting segment C comprises a Cl or C2 type domain, a fragment or a derivative thereof. More particularly, the invention relates to targeting segments C comprising the sequence of a Cl domain of a coagulation factor, a fragment or a derivative thereof. Alternatively, the invention relates to targeting segments C comprising the sequence of a C2 domain of human coagulation factor VIII, a fragment or a derivative thereof.
- the targeting segment C is a polypeptide constructed on the basis of a Cl-type domain topology.
- the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 1-8, preferably SEQ ID Nos 2-4, and 6-8, or a fragment thereof.
- C1F8-S1 (SEQ ID No 6) KCQTPMGLAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WLKIDLLAPM IIHGIKTQGA RQKFSSLYIS QYIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDSSPHRMMYIR
- C1F8-S2 (SEQ ID No 7) KCQTPMGLAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WIKVDLLAPM IIHGVKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRYNS TGTLMVFFGN VDSSGIKILRMPLYLRMPLYRMNP
- C1F8-S3 (SEQ ID No 8) KCQTPLGMAS GHIRDFQITA SGQYGQWWPK LARLHYSGSI NAWSTKEPFS WLKIDLLAPM IIHGIKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDLPGIRI
- the targeting segment C is a polypeptide constructed on the basis of a C2 type domain topology.
- the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 9-16, preferably SEQ ID Nos 10-12, and 14-16, or a fragment thereof.
- C2F5-S1 (SEQ ID No 10) CSTPLGMENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQPK ANNNKQWLEV DLLKIKKITA VITQGCKSLS SEMYVKSFTI HYSEQGVEWK PFRLKSSMVD KINEGNTNTK GHVKNFPNPP RISRFIRVIP KTWNQSITLR LELFGCDIY
- the targeting segment C is a polypeptide constructed on the basis of a domain 5 topology of ⁇ 2-Glycoproteins-I ( ⁇ 2GP-I) (SEQ ID No 17).
- the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 17-22, preferably SEQ ID Nos 18-22, or a fragment thereof.
- the targeting segment C comprises a polypeptide whose general sequence is as follows: TJ 2 ASCKU 7 PU 9 KJ 11 U 12 TU 14 U 15 U 16 J 17 GERU 21 J 22 U 23 QEKU 27 J 28 NGML
- the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 19-22 or a fragment thereof:
- the targeting segment C comprises a polypeptide whose general sequence is as follows: jl. D 2d3. J 4_ J 5_ J 6. z 7_ u 8_ J 9_ J 10. u ll_ R _ J 13_ J 14_ u l 5 _ ⁇ _ G _ ⁇ 18_ G _ ⁇ _ J 21_ E _j23_ J 24_ u 25_ J 26_ J 27 . J 28_
- amino acids J are chosen independently of each other from natural amino acids, or derivatives thereof, such that at least 50% of them are polar residues chosen from R, N, D , C, Q, E, G, H, K, Orn, P, S, T and Y,
- amino acids U are chosen from A, C, G, I, L, M, F, W, Y, and V
- - amino acid X 18 is chosen independently of the other amino acids of the sequence from A, N , C, Q, G, H, I, L, M, F, S, T, W, Y and V,
- amino acid B 37 is chosen independently of the other amino acids of the sequence from R, A, C 5 G, I, L, M, F, W, Y, and V,
- amino acid Z 7 is chosen independently of the other amino acids of the sequence from D and E,
- the amino acids Z 59 and Z 65 are chosen independently from E, D, K, and R, the exponents indicating the position of the amino acids in the sequence.
- the amino acids J can be chosen independently of each other from the set of residues A, R, N, D, C, Q, E, G, H, I, L, K, M, Orn, F , P, S, T, W, Y, and V, and in such a way that at least 50% of them are polar residues chosen from R, N, D, C, Q, E, G, H, K, Om, P, S, T.
- the peptide of formula S1 can advantageously be a peptide sequence chosen from the peptide sequences SEQ ID No 23-32.
- the sequence S1 represents a type of peptide in its shortest form. It is understood that this sequence can also comprise one or more additional amino acids at one or the other of the ends, for example from 1 to 15 amino acids, in general from 1 to 10 amino acids to obtain additional functionalization. .
- a small sequence called a functionalization sequence, can be linked to the peptide allowing attachment to the L segment.
- This functionalization sequence can be located at the N-terminal end of the sequence S1. It can be around 3 amino acids preferably chosen from GSC-, GST-, GSP-, GSS-, GSG-, and GSQ-.
- These functionalization sequences are advantageous in that they allow in particular easy labeling by radio-tracers such as 99m Tc or 18 F and allow, by injection into humans at a tracer dose, to follow in vivo the fate perfectly. of the drug, its bio-distribution and to control its good localization.
- sequence S1 can be duplicated within the same peptide to produce a molecule exhibiting an even higher affinity for the apoptotic sites.
- the segment L is a binding molecule cleavable at the target site, and connecting part A and part C.
- Segment L can be any molecule or chemical bond, of covalent type, including molecules in part or totally of peptide nature , modified or not, natural or not.
- the L segment advantageously contains a recognized chemical function which can be cleaved in the environment of the tissue or pathological cells, for example by an enzyme or a set of enzymes specific to the environment of the targeted cells.
- linker segment L which can be cleaved preferentially in the environment of the targeted cells allows a local and targeted release of the active principle and gives the molecules of the invention a behavior of the targeted pro-drug type. Indeed, the molecule is not very active as long as it does not reside in the environment of the targeted cells possessing the enzymes or other cleavage factors.
- the linking segment L can be simple or branched.
- the advantage of a branching is to be able to bring and distribute several therapeutic molecules with a single targeting molecule C.
- the L (or LO) segment can be of a varied nature, such as a bond or chemical molecule, and in particular of a peptide nature.
- the L segment is a cleavable peptide link sensitive to proteases (or other enzymes), called in the following text "intervening proteases", more specifically overexpressed either on the surface of cells presenting the pathology, either released into the environment of the target cells, or even released by the cells in the apoptotic phase.
- proteases or other enzymes
- Tumor and inflammatory cells are known to excrete a variety of intervening proteases, in particular metallo-proteases of the extracellular matrix (MMP) , urokinases, specific proteases for the cleavage of the extracellular segment of membrane cytokines or their receptors (ADAM), etc.
- MMP extracellular matrix
- urokinases metallo-proteases of the extracellular matrix
- ADAM membrane cytokines or their receptors
- sequences cleaved by these proteases are given in Table 2.
- These intervening proteases play an important role in the evolution of the tumor or of the inflammatory tissue and in particular in the invasion of the surrounding tissues and the formation of metastases, or l invasion by specialized inflammatory reaction cells.
- the level of MMP in the tumor or inflammatory environment is much higher than that present in normal tissue because, in particular, the control of the expression of these MMPs depends on the action of certain cytokines. It is therefore possible to take advantage of this expression differential to amplify the principle of targeting of the anti-tumor or anti-inflammatory compound by only allowing activation of this compound at the targeting sites.
- Simple pro-drugs have already been designed but they do not solve the problem of uniform distribution of the drug throughout the body because there is no accumulation of the pro-drug within the cancer tissue or inflammatory.
- the present invention a means is proposed to accumulate the antitumor or anti-inflammatory principle only in tumor or inflammatory tissue already comprising cells in the process of apoptosis, and to make the drug active essentially in this tissue.
- the CL or LC assembly constitutes a vectorization-activation system of anti-tumor or anti-inflammatory compounds. This together therefore meets the following double imperative: reduce the average effective concentration of the drug in the body, that is to say reduce the secondary toxic effects, and restrict the action of the drug to the only tissue of interest, that is to say increase its efficiency.
- the cleavable linker segment L is therefore an at least partially peptide link comprising a sequence recognized and cleaved by an intervening protease mainly present in the targeted tissue.
- the L or LO link can therefore be represented as comprising two parts, L1-L2, designed such that the intervening proteases cleave the peptide bond of the link between L1 and L2 and that the released molecule L2-A or A-L1, depending on the molecules chosen, ie a molecule which is therapeutically active, preferably at least as much as the initial molecule A.
- the length of the parts L1 and L2 can be optimized as a function of the accessibility necessary to the active site of the intervening proteases, with the constraint limit as much as possible the final size of the final molecule for the reasons mentioned above.
- L (L1-L2) n -D (F5B) where D, Ll, L2 and n have the definition given above.
- connection between the different functional elements of the molecules of the invention can be carried out by any chemical, enzymatic or genetic coupling method known per se to those skilled in the art.
- they can be chemical, peptide, nucleic bonds, etc.
- the groups can be coupled together by maleimide, succinimide, intein, biotin, amino, amide, carboxylic, phosphate, ester, ether, etc. bonds.
- the link L is linked to the molecule C (and / or A) by a maleimide group, known for its rapid and total reaction with a thiol group carried by an accessible cysteine residue from the targeting segment C (and / or of molecule A).
- the link L is linked to the molecule C (and / or A) by reaction of the terminal carboxylic group of the peptide L with an amino group carried by the therapeutic segment A (or targeting C).
- the linking segment L is coupled to the C-terminal (in the case of an H 2 NLA molecule) or N-terminal (in the case of an AL-COOH molecule) end of the segment C by means of an intein.
- the segment L (or the cleavage function) is part of the element C or A. It can be for example an N-terminal or C-terminal extension of the segment C or A, especially when the latter is peptide in nature.
- the molecules of the invention can be assembled in one or more steps, depending on the coupling techniques used.
- a CL type molecule can be produced first, then coupled with one or more therapeutic molecules A.
- the connections between the functional segments call for different chemical reactions, simultaneous synthesis or assembly is possible .
- the purely peptide version of the L link is preferably obtained by direct synthesis, using in particular the common peptide synthesizers and conventional methods of synthesis, especially in solid phase.
- the advantage of the direct synthesis of the link is that it allows the use of non-natural amino acid residues thus allowing better adaptation of the sequence to the intervening proteases.
- This recognition sequence can also be modified with respect to the natural recognition sequence by an enzyme or a cleavage factor, for example to give it a better affinity or specificity towards the protease in question.
- the length of the link segment can be adapted by a person skilled in the art according to the needs and the nature of the segments C and A. In general, a Fairly short and essentially non-immunogenic linker. It is typically a segment of peptide nature comprising from 3 to 20 amino acid residues, preferably from 3 to 15, even more preferably from 4 to 12. In certain cases, as indicated below, it can be interesting to modify the length of the segment L, in particular to distance the peptide part from the segment C or A, or to create molecules with particular function (penetration in the cell, action on neighboring cells, etc.).
- L or LO can take one of the following two structures:
- L'1 is a non-peptide spacing group and L "l is the peptide part proper;
- L'2 is a non-peptide spacing group and L "2 the peptide part proper.
- the non-peptide spacer group can be chosen from any synthetic chemical molecule, preferably chemically stable and not very immunogenic. It may especially be a polymer, for example of the polyoxyethylene, dextran, polyethyleneimine, etc. type. A preferred example is polyoxyethylene, functionalized or not.
- L “l-L2 and L1-L” 2 can represent the same peptide. Furthermore, the number of residues of the peptide segments L “l-L2 or Ll-L” 2 can vary from four to more than twenty, the optimal value being of the order of six.
- the cleavable link segment corresponds to the following formula:
- n and c can vary from 0 to around 10 and depend on the end chosen for the connection to segment A; for the end linked to A, the value of n or c will be low and preferably equal to 0 (J 3 only present) and for the opposite end the value of n or c is not limited and the corresponding residues will be chosen according to the specificity of the targeted intervening proteases.
- the sequences J- 1 -J 0 and J 3 -J 4 which frame the cleavage site B 1 -B 2 are involved in the interactions of the link with the targeted protease and therefore on the speed of the enzymatic reaction to cut the link B 1 -B 2 .
- Jo GIy, AIa, Leu, Ile, Val, Phe and any hydrophobic non-natural amino acid residue.
- J 3 GIy, AIa, Leu, He, Val, Phe
- J 4 GIy, AIa, Leu, Ile, Val, Phe or any hydrophobic or absent non-natural residue
- the other residues, J-2 ⁇ J-n and J5 ⁇ Jc can be any natural or unnatural amino acid residue as required.
- the length and / or the properties of the linking segment can be adjusted, for example to construct a molecule allowing the therapeutic compound A to interact with or to penetrate into a cell neighboring the target cell on which the segment C leads her.
- the link segment L: - must be long enough to reach neighboring cells.
- a chemical oligomer for example of the polyoxyethylene type, is preferably chosen, comprising a sufficient number of monomers so that the length of the link is approximately 80 to 200 angstroms, typically 130 to 150 angstroms; and / or - comprises a domain allowing or facilitating the passage of A through the cell membrane and, where appropriate, a cleavage region sensitive to intracellular enzymes.
- the link advantageously has one of the following two structures:
- L or L0 A-L3-LMT-LE (F9B) where LE is an essentially extracellular part of the link, LTM a transmembrane part and L3 a function or element cleavable by proteases or intra-cellular esterases (eg, cytosolic).
- the LE part is preferably sufficiently hydrophilic to allow suitable solvation in an aqueous medium in order to obtain a sufficiently extensive structure.
- the LTM part of a length at least equal to about 40 ⁇ , preferably be sufficiently amphiphilic so that, on the one hand, its structure in the extracellular aqueous medium remains weakly compact and that, on the other hand, it can cross the hydrophobic medium of the plasma membrane.
- LMT - [O- (CH2) q -O] - (Fl 1) where q and p are whole numbers different from 0, q> p so that, for LMT, the lipid environment of the membrane is at more favorable energy plan than the aqueous environment.
- the values p 2 and 5>q> 3 are preferable.
- the targeting element can be synthesized by techniques known per se from chemistry or biology.
- the element C-L also constitutes a particular object of the invention.
- the invention can be implemented with any type of therapeutic molecule capable of being associated with the C segment. They may be chemical compounds, drugs, small molecules, etc.) of peptide, nucleic, lipid, etc. compounds. .
- therapeutic segment A is a molecule exhibiting biological activity.
- this biological activity is reduced (or nonexistent) when the therapeutic segment is linked to the L-binding and targeting C segments. Therefore, the biological activity is expressed mainly in the environment of pathological tissues, after targeting. and cleavage in vivo.
- Therapeutic compounds can have various properties, in various therapeutic fields. These may be already known drugs, or new or developing molecules. They may be compounds whose mode of action involves penetration into cells or whose action only involves interaction with the surface of the plasma membrane.
- the preferred compounds A of the invention are anti-tumor or anti-inflammatory.
- the biologically active molecule has anti-tumor properties.
- A can be any anti-tumor molecule or an active derivative of these same molecules. The only constraint is that these anti-tumor compounds can be linked chemically to the rest of the vectorization molecule.
- A can be released into the extracellular medium and passively or actively diffuse inside neighboring cells or else be brought into these cells by a link of the LE-LMT type and then released by the action of endogenous proteases or esterases.
- An example of an anti-tumor compound is constituted by the molecules of the antracycline family and their derivatives.
- antacycline molecules contain an amino sugar.
- the amino group is advantageously used for the link to the L segment (for example to the L2 or LMT part) of the link defined above.
- an anti-tumor compound is constituted by molecules of the TNF ⁇ family or derivatives thereof. These molecules act on cell surface receptors and induce apoptosis.
- the factor TRAIL or A ⁇ o2L (P_W19777) is probably the most interesting since normal cells seem to be protected from its action whereas tumor cells are sensitive to it and can be selectively eliminated by it. action of this pro-apoptotic cytokine.
- This factor can therefore be very useful in so-called “solid” cancers, which implies effective targeting to avoid as much as possible the side effects due to the presence of these molecules in the blood.
- TRAIL is initially a membrane protein associated in trimer and only the extracellular part is active.
- TRAIL-Do This extracellular part, TRAIL-Do, or a set containing TRAIL-Do, can therefore be targeted thanks to the C segment and released in the inter-cellular space thanks to the action of proteases intervening on the cleavable link L which connects C and TRAIL-Do.
- the therapeutic molecule thus constituted has the following structure:
- trimer assembly of the molecules of the TNF family necessary for binding to their receptors, is hampered by the presence of the targeting and binding segments.
- the molecule remains weakly active as long as the link is not cleaved by an intervening protease.
- the cleavable link must have a sufficiently short length while retaining suitable accessibility to the intervening proteases.
- cytokine Another example of a cytokine, which is very interesting for the treatment of certain cancers and in particular melanoma and intracranial glioma, is Interleukin-4 (IL4, 1310839).
- IL4, 1310839 Interleukin-4
- This protein cannot be used without being properly targeted.
- the binding to a targeting segment C of human IL4 or one of its isoforms or of an assembly containing one of these proteins, via a cleavable segment makes it possible to constitute a therapeutic molecule interesting in oncology:
- anti-tumor compounds are in particular:
- Methotrexate is an anti-tumor compound commonly used for the treatment of cancerous tumors. It is an analogue of folic acid which first acts as a false substrate by inhibiting dehydrofolate reductase (DHFR). It also acts by indirect inhibition of thymidilate synthetase (TS).
- DHFR dehydrofolate reductase
- TS thymidilate synthetase
- Methotrexate contains an amino acid, glutamic acid, which can be inserted into the N-terminus of a cleavable link peptide according to the formula (F6B) or (F4B).
- 2-methoxyestradiol (1,3,5 (10) -oestratriene-2,3,17 ⁇ -triol 2-methyl ether) called 2ME 2 , is a byproduct of the metabolism of estrogens having the property of blocking the growth of cells rapidly dividing endothelial cells and tumor cells.
- the molecules of this family have the effect of blocking the cell cycle in G2 and M by their action on the microtubular cytoskeleton. This results in an inhibition of the normal reorganization necessary for the progress of the interphase of mitosis.
- Taxanes and in particular docetaxel, contain functions which can be used for modifications allowing its incorporation at the end of a peptide cleavable by the proteases intervening in the tumor environment.
- R 1 tBuOCO
- R 2 H (docetaxel)
- R, C 6 H 5 CO
- R 2 Ac (paclitaxel)
- cytosine arabinoside or cytarabine or Aracytine is the main representative of this family.
- Other molecules in this family are difluoro-deoxy-cytidine (Gemcitabine).
- these agents Derived from "nitrogen mustards”, these agents have given rise to various anti-tumor compounds acting on nucleic acids and therefore in the intra-cellular space. These are in particular Melphalan and Chlorambucil, two bifunctional alkylating agents of interest for easy bonding to a cleavable peptide bond.
- Melphalan is Phenylalanine-Mustard (L-PAM) is an unnatural amino acid which can be introduced easily at the beginning or at the end of the peptide synthesis of a cleavable link by intervening proteases:
- Chlorambucil only has a carboxylic function and can only be introduced directly into a peptide at the end of synthesis of the peptide link cleavable by the intervening proteases and at the N-terminal end.
- this compound can also be introduced at the C-terminal end of the cleavable peptide link.
- the molecule released in the tumor environment is a hydrophobic amino acid derivative such as, for example, Leu-Melphalan or Chlorambucil-Leu.
- hydrophobic amino acid derivative such as, for example, Leu-Melphalan or Chlorambucil-Leu.
- the biologically active molecule has anti-inflammatory properties.
- NTAl N-terminal segment of annexin I
- the anti-inflammatory properties of this peptide probably result from its action on the receptor of the fMLP thus inhibiting the chemotaxis and the activation of phagocytic cells and in particular their degranulation and their production of toxic oxygen metabolites.
- the sequence of the N-terminal segment of human annexin I is as follows:
- the anti-inflammatory peptide derived from the N-terminal segment of annexin I will advantageously be chosen from the following sequences:
- the underlined sequence represents a so-called consensus sequence having the desired anti-inflammatory properties. Under each variable residue of this sequence is indicated a list of residues which can replace that indicated in the consensus sequence: an acid residue; h hydrophobic residue; p polar residue; o Thr or Ser preferably.
- protease capable of specifically cleaving the NTAl segment at the level of one of the two residues Lysine 25 or 28 present in its N-terminal part -Thr-Val-Lys-Ser-Ser-Lys -Gly-Gly-, These proteases are normally responsible for the in vivo release of the N-terminal segment of annexin I.
- the NTA1 peptide or a judiciously mutated version is simply integrated into the N-terminal part of the C segment for the
- segment C is taken here in its widest sense and defined above.
- the NTA1 peptide or a judiciously mutated version is linked to the C segment via a simple link cleavable by an intervening proteases according to the formula F6A or F6B or a multiple link comprising an element of branch D as defined above (F5A, F5B).
- part A can also contain a repetition of one of the sequences chosen for the NTA1 segment in order to increase the local concentration of the anti-inflammatory peptide and therefore its effectiveness.
- NTAl 1n -C (F2)
- NTAl segment it may be advantageous to link the NTAl segment to the C-terminal end of the C segment.
- a bifunctional link will be used so as to connect the C-terminal ends of C and NTAl: CL-NTAl
- Chronic inflammatory diseases are caused by a large imbalance in the production in the cellular environment of a number of signaling molecules.
- the amplification and sustainability of the inflammatory phenomenon in these diseases results from a complex balance between a large number of proteins with opposite influences, pro-inflammatory molecules and anti-inflammatory molecules.
- interleukin 10 (SwissProt, P22301), or on any of its isoforms, is the most interesting by the regulatory effect it produces on the inflammatory reaction .
- IL10 has multiple functions including functions of stimulation of the immune system. It is therefore very advantageous to target this protein at the inflammatory site proper so as to strictly localize its action.
- IL10 acts as a homodimer on its hetero tetrameric receptor.
- the three-dimensional structure of PILlO and the complex with its receptor, PILlOR offers an additional advantage.
- the structure of the IL10-IL10OR complex shows that the N and C-terminal ends of PIL10 are relatively close in structure.
- the N-terminal end is buried in the heart of the receptor and the C-terminal end is located in the dimerization region of this cytokine. Therefore, blocking by the C-L or L-C segment of one of the N or C-terminal ends of PIL10, prohibits the formation of the complex and finally blocks its action.
- PIL10 can therefore only be done by the action of proteases intervening in the inflammatory environment which have the effect of releasing this cytokine exclusively in this environment.
- P35225 another anti-inflammatory cytokine
- P35225 another anti-inflammatory cytokine
- the therapeutic molecule based on PILlO or PILl 3 has one of the following general structures, depending on the choice made for the positioning of PILlO or PIL13: CL '1 -L "1 -L2- (IL10 / IL13) (according to the formula F6A) (ILl 0 / IL13) -Ll -V '2-L'2-C (according to formula F6B)
- the cleavage site of the intervening proteases is provided between L “l and L” l or between L “2 and L'2.
- the length of the residual segment L” l-L2 or Ll-L “2 is such that it does not interfere not the formation of the IL10-1L10R or IL13-IL13R ⁇ l / 2 complex It is easy to adjust the effective sequence of PIL10 to satisfy this constraint In either case the L1 or L2 segment may be absent.
- Therapeutic segment A can be selected from non-activating inhibitors of membrane receptors for pro-inflammatory cytokines.
- IL1 interleukin 1
- PILlR soluble inhibitor of the PIL1 receptor
- sILIRa Small protein
- the efficacy of sILIRa has been tested in various diseases and in particular in rheumatoid arthritis and has been shown to be relatively active.
- the doses used in patients under subcutaneous injections are enormous, from 30mg to 150mg.
- the pharmacokinetics is also unfavorable since the half-life time in the circulation is only 21 min, which is very short for therapeutic use in the case of rheumatoid arthritis.
- the C-L- (ILlRa) or (ILlRa) -L-C group is completely inactive.
- the structure of the ILlRa-ILlR complex shows that the N and C-terminal ends of PILlRa are very close in structure and are buried at the heart of the receptor. Therefore, the activation of the inhibitor can only be done by the action of proteases intervening in the inflammatory environment which have the effect of releasing the inhibitor exclusively in this environment.
- the therapeutic molecule based on PILlRa or on any of its isoforms has one of the following general structures, depending on the choice made for the positioning of PILlRa:
- the cleavage site of the intervening proteases is provided between L “l and L” l or between L “2 and L'2.
- the length of the residual segment L" l-L2 or Ll-L “2 is such that it does not interfere not the formation of the IL1-ILlRa complex.
- PILlO it is easy to adjust the effective sequence of PILlRa to satisfy this constraint.
- the L1 or L2 segment may be absent.
- Glucocorticoids There are many non-peptide molecules with important anti-inflammatory properties such as Glucocorticoids, non-steroidal anti-inflammatory drugs (NSAIDs), Methotrexate. a) Glucocorticoids:
- Glucocorticoids are natural hormonal molecules produced by the body and are involved in many physiological processes. Their action is strictly intracellular and intervenes by their binding to nuclear receptors inducing the transcription of a certain number of genes, hence the complex role of these hormones at multiple stages of the inflammatory reaction.
- the use of Glucocorticoids and their non-natural derivatives as a medicine is therefore always very delicate, while their effectiveness can be very great. Their targeting and strict release into the inflammatory environment is therefore crucial.
- Glucocorticoids are steroid molecules, therefore quite hydrophobic, and their action takes place at the level of the cell nucleus after passive diffusion through the plasma membrane. For use as a targeted drug, Glucocorticoids can therefore simply be released into the inflammatory environment.
- All of these molecules have chemical functions, for example hydroxyl groups, allowing their grafting on peptide molecules and in particular on an L segment cleavable by intervening proteases as for anti-tumor compounds.
- the Glucocorticoids-based therapeutic molecule has one of the following general structures, depending on the choice made for positioning the molecule with respect to the targeting segment: CL '1 -L "1 -L2- (0-Glucocorticoid) (according to formula F6 A) (Glucocorticoid-0) -Ll-L '' 2-L'2-C (according to formula F6B)
- the action of the intervening proteases releases either the L “l-L2- (O-Glucocorticoid) molecule or the (Glucocorticoid-O) -Ll-L” 2 molecule, that is to say a pro-drug which must passively diffuse in the surrounding cells where they will be treated with endogenous proteases and esterases to finally release the active molecule.
- the segments L “l-L2 or Ll-L” 2 be hydrophobic and as short as possible, taking into account the cleavage capacities of the intervening proteases. It is advantageous to limit the number of residues to two or even to one the number of residues in L "l or L" 2. It may also be advantageous not to introduce the segments L1 or L2.
- Nonsteroidal anti-inflammatory drugs are mostly inhibitors of cyclooxygenases (COX-I and COX-2), important enzymes involved in the metabolism of arachidonic acid. These are drugs generally reserved for the treatment of severe inflammatory diseases and used in generally very high doses and therefore generating undesirable side effects.
- COX-I and COX-2 cyclooxygenases
- these drugs generally reserved for the treatment of severe inflammatory diseases and used in generally very high doses and therefore generating undesirable side effects.
- NSAIDs there is a class of compounds having a carboxylic function which can be used for their grafting on peptide molecules and in particular on an L segment cleavable by intervening proteases as for the anti-tumor or anti-inflammatory compounds mentioned above.
- Methotrexate also has anti-inflammatory properties and can be used in the same way as for its anti-tumor properties described above.
- PCRDX a peptide, here called PCRDX, comprising at least the CRDl domain of any TNFR X to block the trimerization of the latter in a very specific manner and therefore block its function: by binding to a membrane subunit of TNFR (monomer), the free PCRDX peptide, in the form of monomer or dimer, blocks the trimerization of this membrane subunit without activating the receptor since the latter can no longer acquire its trimeric structure.
- PCRDX peptide or a mutated version of this domain, linked to the C segment by an L1-L2 link cleavable by one of the intervening proteases generally present in the inflammatory environment so as to release the inhibitor only at the targeted inflammatory site.
- the general structure of the therapeutic molecule of the present invention is therefore: C-L1-L2-PCRDX or PCRDX-Ll -L2-C Where the cleavage takes place between Ll and L2.
- the C-L1-L2-PCRDX structure is directly active because it leaves the C-terminal end of CRDl free, allowing it to bind to CRDl of a cellular receptor.
- the PCRDX-L1-L2-C structure has the additional advantage of only making the CRDl segment active when it is released by cleavage of the L1-L2 segment, thereby limiting the risk of side effects accordingly.
- the C-terminal end of the PCRDX is congested by the presence of the L1-L2-C segment, unsuitable for any interaction with an extracellular domain of a TNFR, thus making its interaction more difficult.
- the activity is recovered by the cleavage of the link L1-L2.
- sequences can be mutated, in particular in the region of interaction with the original TNFR1 and TNFR2 receptors, in order to increase their affinity with these receptors.
- Analogous sequences from any TNF family cytokine receptor can be used to produce specific inhibitors for these receptors.
- the cleavable link L1-L2 can be advantageously chosen from the peptide sequences recognized and cleaved by specific proteases whose role is to release the extracellular part of the membrane TNFRs or of the membrane precursors of the TNFs.
- proteases belong to the family of ADAMs already mentioned.
- ADAM-17 or TACE protease specific for the release of TNF ⁇ and TNF ⁇ (LT ⁇ ) will be chosen and the sequence of the L1-L2 segment will therefore be chosen so that it contains one of the following sequences:
- L1 * L2 SPLAQA * VRSSSR (SEQ ID No 38) or fragments thereof, PLAQ A * VRSSS (SEQ ID No 39), LAQA * VRSS (SEQ ID No 40), AQA * VRS (SEQ ID No 41) , QA * VR (SEQ ID No 42), or any combination of the groups of sequences located on either side of the cleavage site marked with an asterisk, for example.
- the molecules of the invention can be constructed to target different types of pathological cells or tissues, preferably in humans. They can be used for the preparation of medicaments and / or in methods of therapeutic treatment.
- a particular object of the invention consists of a pharmaceutical composition comprising a chimeric molecule as defined above.
- Another object of the invention relates to the use of a chimeric molecule as defined above for the preparation of a medicament.
- these drugs are anti-tumor or anti-inflammatory drugs.
- the molecules according to the invention can be used for the preparation of medicaments intended for acute pathologies such as asthma, ulcerative colitis, Crohn's disease, septic shock, diseases collagen and arthritis.
- the invention can be used for the treatment of various tumors, in particular solid or liquid or hematopoietic tumors, in particular breast, lung, intestinal, colon and rectum, brain, meninges, stomach, esophagus, liver, pancreas, bladder, head and neck, male or female reproductive systems, skin, etc.
- tumors in particular solid or liquid or hematopoietic tumors, in particular breast, lung, intestinal, colon and rectum, brain, meninges, stomach, esophagus, liver, pancreas, bladder, head and neck, male or female reproductive systems, skin, etc.
- compositions of the invention can comprise any pharmaceutically acceptable excipient or vehicle, such as salt, solutes, etc. It can be saline, buffered, isotonic, water, etc.
- the compositions may further comprise other active agents, used in combination, simultaneously, separately or spaced over time.
- Another object of the invention relates to the use of targeting molecules as defined above for the local delivery of active principles in the vicinity of pathological tissues in subjects.
- the present invention also relates to methods of treating a pathology in a subject comprising the administration of a molecule or a composition as defined above.
- a pathology concerned and cancer or inflammation Preferably, the pathology concerned and cancer or inflammation.
- the treatment method may further comprise a preliminary step consisting of a treatment making it possible to generate cells engaged in a process of apoptosis in the pathological tissue. It also relates to methods of local delivery of active principles in the vicinity of pathological tissues in subjects, comprising the administration of a molecule or of a composition as defined above.
- treatment designates preventive, curative, palliative treatment, as well as the management of patients (reduction of suffering, reduction of the size of a tumor or of the progression of pathology, improved lifespan, slower disease progression, decreased inflammatory site), etc.
- the treatment can also be carried out in combination with other agents or treatments (chemotherapy, radiotherapy, gene therapy, etc.).
- the treatments and medicaments of the invention are very particularly intended for humans.
- the therapeutic compound can be used at different doses and according to different protocols.
- the administration can be carried out by any method known to those skilled in the art, preferably by injection, typically by intraperitoneal, intra-tumor, intradermal, intra-cerebral, intravenous, intra-arterial or intramuscular route.
- the doses administered can be adjusted by those skilled in the art. Typically, from about 0.01 mg to 100 mg / kg are injected. It is understood that repeated injections can be carried out.
- the invention can be used in mammals, in particular in humans.
- Example 1 Example of the production of cleavable L segments for the release of anti-tumor and anti-inflammatory compounds:
- L segment is only peptide and contains only natural residues, it will preferably be integrated into the C segment at its N or C-terminal end by the conventional methods of molecular biology. H can however be integrated if necessary into segment A if that is peptide and obtained by molecular biology.
- the L segment or the LA unit in a reactive form for a later connection to the C segment.
- An interesting example occurs in the case where a thiol group brought by a Cysteine residue is present in segment C, preferably far from the site of binding of C to negatively charged membranes. This thiol group makes it possible, by a simple, rapid and total chemical reaction, to link the L-A assembly provided with the maleimide functional group.
- the synthesis protocol is described in FIG. 1.
- the fragment L consists of a protected peptide linked to an acid-labile resin rink via the FMOC strategy well known to those skilled in the art.
- the reactive fragment has the property of forming a covalent bond with a nucleophilic group - here the SH group of a Cysteine - of protein C.
- the reactive group can be a bromoacetamide or, as here and more advantageously, a maleimide group .
- the spacer group between the maleimide and the peptide L can be an alkyl, alkoxy or poly alkoxy group terminated by a carboxylic function for coupling to L.
- FIG. 1 The fragment L consists of a protected peptide linked to an acid-labile resin rink via the FMOC strategy well known to those skilled in the art.
- the reactive fragment has the property of forming a covalent bond with a nucleophilic group - here the SH group of a Cysteine - of protein C.
- the therapeutic segment is an anti-tumor compound of the antracycline family, doxorubicin.
- AA represents any amino acid sequence which may constitute a cleavable link. The example described below corresponds to the sequence AA ⁇ Gly-Ser-Gly-Val-Leu.
- the filtered resin is washed with 40 ml (for 30 s each time) with the following solvents: 3 times methanol, 3 times DCE, 3 times DMA.
- the unreacted hydroxyl groups of the resin are blocked with acetic anhydride (13.5 mmol) in 3 ml of pyridine and 15 ml of DMA and then the resin is washed as follows (40 ml each time): 2 times isopropanol, 3 times DMA, 2 times isopropanol, 6 times DCE, 2 times isopropanol, 3 times DMA, 3 times isopropanol.
- the resin is then dried under vacuum and has an Fmoc content of approximately 0.35 mmol / g.
- DMA 2 times DMA, 1 time isopropanol, 4 times DMA.
- the resin is dispersed in DCM and treated with 20 ml of AcOH / DCM cleavage mixture (10/90 v / v) for one hour then is filtered, washed 3 times with 20 ml of cleavage mixture then 3 times 20 ml of DMA to extract the peptide from the resin. Hexane (15 times the volume) is added to the filtrate to remove acetic acid in azeotropic form. The resulting protected peptide is dried under vacuum and purified by "flash" chromatography.
- Example 2 Synthesis of a mixed peptide and non-peptide link for the release of anti-tumor compounds.
- the non-peptide part of the link is introduced using the compound (12), obtained according to the diagram in FIG. 2, replacing the N-maleoyl- ⁇ -alanine used in the previous synthesis (FIG. 1).
- the compound (12) is then used as the compound N-maleoyl- ⁇ -alanine for the synthesis of a mixed cleavable link according to the protocol described in Figure 1 for the compounds (5) and (6).
- Example 2b Synthesis of an arm comprising a spacer group and a cleavable peptide group and coupling on the one hand to a targeting molecule C and on the other hand to doxorubicin.
- the lyophylisate was taken up in a H2O / DMSO 50/50 mixture (2 ml) and was purified by HPLC (Source column 15RPC 10 ⁇ 250 mm). The fraction corresponding to the final compound C-S- (12) was collected and then lyophilized.
- the final compound C-S- (12) was subsequently subjected to the action of the various proteases (MMP2, MMP3 and MMP9) according to the following protocol:
- NTAIl Two constructions are proposed, one corresponding to the long version of NTAl named NTAIl, according to the sequence S7 (Seq ID 33) and the other to the short version, named NTAIc, according to the sequence S8 (Seq ID 35).
- the pGEX 6Pl plasmids used are commercial (Amersham biosciences) as well as the enzymes (Biolabs) used: BamH I, EcoR I, Ban II, T4 DNA Ligase, CIP, T4 kinase.
- the expression vector used is the vector pGEX 6Pl (Amersham-Biosciences). This vector allows the expression of the protein of interest fused to the GST at its Nter end. The protein of interest is recovered without fusion protein after digestion by the PreScission.
- the coding sequence of segment C (from the vector pGEX2T, constructed in the laboratory) will be inserted into this vector between the BamH I and EcoR I sites.
- the NTAII or NTAIc segment will then be inserted in the form of cassettes in the vector pGEX 6P containing the coding sequence of the C segment between the Ban II and BamH I sites.
- the vector pGEX 6P has two Ban IL sites.
- the first step therefore consists in making this site unique in order to use it as a cloning site for the NTA1 segment.
- the Ban II site located at position 3890 is removed by a silent directed mutagenesis step (Quick Change kit, Stratagene, Ban II + and Ban II - oligos) following the supplier's recommendations.
- the plasmid "pGEX-6P-mut" is then obtained.
- the coding sequence of segment C is extracted from the plasmid pGEX2T by enzymatic digestion using the restriction enzymes BamH I and EcoR I (Biolabs). Briefly, 20 ⁇ g of DNA is digested sequentially with 200 U of enzyme, at 37 ° C. overnight. After each digestion, the DNA is purified after migration on agarose gel using the “GFX PCR DNA and Gel Band Purification kit” (Amersham-Biosciences) kit. 20 ⁇ g of plasmid "pGEX-6P-mut" is also digested under the same conditions with BamH I and EcoR I in order to obtain the vector in which the coding sequences will be inserted.
- BamH I and EcoR I Biolabs
- the latter is dephosphorylated by an incubation of 2 h at 37 ° C. in the presence of 2 U of CIP (Biolabs).
- the vector “pGEX-6P-mut”, opened in BamH I / EcoR I and dephosphorylated, is then purified using the Amersham kit.
- Ligation of the coding sequence of segment C (10 moles of insert for 1 mole of vector) in the vector “pGEX-6P-mut” is then carried out by incubation for 2 h at room temperature in the presence of 400 U of T4 DNA ligase (Biolabs).
- the pGEX-6P-mut plasmids containing the C segment coding sequence are then obtained.
- NTA11 and NAlc cassettes are obtained by hybridization of 100 pmol of the complementary oligos (NTAlc + / NTAlc - and NTAIl + / NTAIl -) at 95 ° C for 5 min in a 20 mM Tris HCl buffer ⁇ H7.5; 300 mM NaCl; 1 mM EDTA.
- the 5 ′ ends of the cassettes are then phosphorylated by an incubation at 37 ° C. for 2 h in the presence of 50 U of T4 polynucleotide kinase (Biolabs). The enzyme is inactivated by incubation at 65 ° C for 20 min.
- the last step consists in digesting the plasmids pGEX-6P-mut the coding sequence of segment C by Ban II and BamH I in order to insert the cassettes.
- 20 ⁇ g of DNA is digested sequentially with 50 U of Ban II and 100 U of BamH I, at 37 ° C. overnight.
- the DNA is purified after migration on agarose gel using the Amersham kit.
- the dephosphorylation of the vectors is carried out by incubation at 37 ° C for 1 hour in the presence of 10 U of CIP, in order to avoid their recircularization during the ligation step.
- the ligation of the cassettes in the vectors is carried out as described above.
- the NTAIc-C and NTAII-C sequences cloned in the vector pGEX-6P-mut are therefore obtained.
- DNA sequences are checked with the Big Dye Terminator sequencing kit, Perkin-Elmer Applied Biosystems, on a Perkin-Elmer Abiprism 310 sequencer, according to the supplier's protocol.
- the expression is carried out in a strain of E. coli BL21 gold (Stratagene) at 30 ° C.
- the bacteria are cultured in a Luria Berthani medium (Gibco) containing 150 mg / L of ampicillin. When the turbidity of the cultures reaches an optical density at 600 nm
- binding buffer 50 mM Tris-HCl pH 7.5; 150 mM NaCl.
- the proteins are then purified by affinity chromatography on a GSTrap Fast Flow column (Amersham-Biosciences). A 5 mL column is prepared according to the manufacturer's instructions. The protein sample (30 mL) is loaded onto the column and the column is washed with 10 volumes of binding buffer.
- a HiLoad 26/60 Superdex 75 column (300 mL) (Amersham-Biosciences) is balanced using 2 volumes of buffer A (150 mM ammonium bicarbonate pH 7.9).
- the protein resulting from the purification by GSTrap is then injected, and its elution is carried out with 2 volumes of buffer A.
- the protein thus purified is aliquoted, lyophilized and stored at 20 ° C.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Toxicology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Medicinal Preparation (AREA)
Abstract
The invention relates to chimera molecules for targeting and releasing therapeutic compounds in mammals, especially humans. The inventive molecules have essentially three functional segments or domains: a targeting segment that can preferentially bind to the surface of the targeted cells, a therapeutic segment comprising the biologically active compound, and a segment which binds the targeting segment and the therapeutic segment and can be cleaved onto the target site. The invention also relates to the preparation of said molecules, to synthesis intermediates or domains thereof, to pharmaceutical compositions containing the same, and to the use thereof, especially in the pharmaceutical field. The inventive molecules and compositions are especially adapted to the targeting of pathological cells in an apoptotic phase, and to the treatment of pathologies or associated tissues, especially cancers and inflammation.
Description
Molécules de ciblage et de libération de composés thérapeutiques et leur utilisation. Molecules for targeting and releasing therapeutic compounds and their use.
DOMAINE TECHNIQUETECHNICAL AREA
La présente invention se rapporte à des molécules chimères permettant le ciblage et la libération de composés thérapeutiques chez des mammifères, notamment des humains. Les molécules de l'invention comprennent principalement trois segments ou domaines fonctionnels : un segment de ciblage, capable de se lier préférentiellement à la surface des cellules ciblées, un segment thérapeutique, comprenant le composé biologiquement actif, et un segment de liaison entre le segment de ciblage et le segment thérapeutique, le segment de liaison étant clivable sur le site cible. L'invention concerne également la préparation de ces molécules, des intermédiaires de synthèse ou domaines de celles-ci, des compositions pharmaceutiques les contenant, et leurs utilisations, en particulier dans le domaine pharmaceutique. Les molécules et compositions de l'invention sont tout particulièrement adaptées au ciblage de cellules pathologiques engagées dans une voie apoptotique, et au traitement de pathologies ou tissus associés, notamment les cancers et l' inflammation.The present invention relates to chimeric molecules for targeting and releasing therapeutic compounds in mammals, especially humans. The molecules of the invention mainly comprise three segments or functional domains: a targeting segment, capable of preferentially binding to the surface of the targeted cells, a therapeutic segment, comprising the biologically active compound, and a linking segment between the segment of targeting and the therapeutic segment, the binding segment being cleavable at the target site. The invention also relates to the preparation of these molecules, synthesis intermediates or domains thereof, pharmaceutical compositions containing them, and their uses, in particular in the pharmaceutical field. The molecules and compositions of the invention are very particularly suitable for targeting pathological cells engaged in an apoptotic pathway, and for the treatment of pathologies or associated tissues, in particular cancers and inflammation.
ETAT DE LA TECHNIQUESTATE OF THE ART
Les composés anti-tumoraux sont par principe des composés hautement cytotoxiques, qui sont distribués dans l'ensemble de l'organisme lorsqu'ils sont administrés de façon systémique. Ils produisent des réactions secondaires extrêmement préjudiciables à l'individu. Il y a donc un très grand intérêt à ne distribuer ces composés anti-tumoraux que dans les tissus tumoraux, c'est-à-dire à cibler ces tissus grâce à un vecteur spécifique. Bien que ce problème de toxicité des traitements soit particulièrement aiguë pour le cancer, il est généralisable à un grand nombre de traitements dans lesquels, de façon générale, un minimum d'effet secondaire est recherché pour un effet thérapeutique maximal.Anti-tumor compounds are in principle highly cytotoxic compounds, which are distributed throughout the body when administered systemically. They produce extremely damaging side reactions to the individual. There is therefore a very great interest in distributing these anti-tumor compounds only in tumor tissues, that is to say in targeting these tissues by means of a specific vector. Although this problem of treatment toxicity is particularly acute for cancer, it can be generalized to a large number of treatments in which, in general, a minimum of side effect is sought for maximum therapeutic effect.
Différents vecteurs ont été proposés et notamment des anticorps monoclonaux dirigés contre des marqueurs spécifiques de la surface des cellules cancéreuses. Ils produisent de
fait des effets cytotoxiques sur les cellules tumorales, mais l'amplitude de ces effets peut diminuer au cours du temps.Different vectors have been proposed, in particular monoclonal antibodies directed against specific markers on the surface of cancer cells. They produce has cytotoxic effects on tumor cells, but the magnitude of these effects may decrease over time.
Un système appelé ADEPT (Antibody Directed Enzyme Prodrug Therapy) consiste en une thérapie dans laquelle un anticorps véhicule une enzyme au site tumoral. Ensuite, une prodrogue est administrée et convertie en molécule active par cette enzyme (US 5,760,072 ; US 5,433,955). Dans cette méthode, seule l'enzyme permettant l'activation de la prodrogue fait l'objet d'un ciblage. La pro-drogue est donc distribuée dans l'ensemble de l'organisme, ce qui n'exclut pas entièrement les réactions secondaires et diminue la dose de pro-drogue effectivement fournie au site tumoral. En outre, cette approche est complexe car requiert l'utilisation de plusieurs types de molécules. Une méthode analogue basée sur le ciblage de l'enzyme capable d'activer la pro-drogue a été décrite dans les demandes (WO97/26918 ; WO 98/51787).A system called ADEPT (Antibody Directed Enzyme Prodrug Therapy) is a therapy in which an antibody carries an enzyme to the tumor site. Then, a prodrug is administered and converted into an active molecule by this enzyme (US 5,760,072; US 5,433,955). In this method, only the enzyme allowing activation of the prodrug is targeted. The pro-drug is therefore distributed throughout the body, which does not entirely exclude side reactions and reduces the dose of pro-drug actually supplied to the tumor site. In addition, this approach is complex because it requires the use of several types of molecules. An analogous method based on targeting the enzyme capable of activating the pro-drug has been described in the applications (WO97 / 26918; WO 98/51787).
D'autre part, divers systèmes de liaison pour la fabrication de pro-drogues, avec une possibilité de ciblage, ont été décrits : par exemple, on trouve des liaisons sulfonamides (WO98/00173), des liaisons clivables par la cathepsine B (WO98/56425) et des liaisons cinnamates (US20020187992).On the other hand, various binding systems for the production of pro-drugs, with a possibility of targeting, have been described: for example, there are sulfonamide bonds (WO98 / 00173), cleavable bonds with cathepsin B (WO98 / 56425) and cinnamate bonds (US20020187992).
Cependant, il existe toujours un fort besoin de molécules ou approches thérapeutiques non- toxiques permettant un ciblage ainsi qu'une activation spécifique d'une pro-drogue à un site pathologique. Ce système permettrait de réduire la dose d'agent actif, d'améliorer l'efficacité, et de diminuer les effets secondaires.However, there is still a strong need for non-toxic therapeutic molecules or approaches allowing targeting as well as specific activation of a pro-drug at a pathological site. This system would reduce the dose of active agent, improve efficacy, and reduce side effects.
EXPOSE DE L'INVENTIONSTATEMENT OF THE INVENTION
L'objet de la présente invention est de fournir des molécules capables de cibler des tissus présentant une pathologie et d'y libérer de façon spécifique des composés aux propriétés thérapeutiques pour cette pathologie. Grâce aux molécules de l'invention, les composés thérapeutiques exercent leur activité de manière localisée et plus efficace, et offrent des risques d'effets secondaires bien inférieurs.The object of the present invention is to provide molecules capable of targeting tissues presenting a pathology and of specifically liberating therefrom compounds with therapeutic properties for this pathology. Thanks to the molecules of the invention, the therapeutic compounds exert their activity in a localized and more effective manner, and offer risks of side effects much lower.
Les molécules de l'invention peuvent être construites pour cibler différents types de cellules ou de tissus pathologiques, de préférence chez l'homme. Dans un mode préféré de
mise en oeuvre, l'invention est basée sur le ciblage de cellules apoptotiques, grâce à un élément de ciblage ayant la propriété de se lier aux membranes cellulaires exprimant un lipide chargé négativement, en particulier la phosphatidylsérine (PS). L'apoptose, ou mort cellulaire programmée, est un phénomène physiologique normal, caractéristique des organismes multicellulaires et présent en particulier chez l'homme. Dans les conditions normales, le taux d'apoptose est cependant faible et les cellules apoptotiques sont très vite phagocytées soit par les cellules voisines, soit le plus souvent par les cellules phagocytaires professionnelles comme les macrophages ou les cellules dendritiques. En outre, les sites apoptotiques sont souvent très dispersés et ne présentent aucune synchronisation. De ce fait, l'apoptose physiologique est généralement indétectable.The molecules of the invention can be constructed to target different types of pathological cells or tissues, preferably in humans. In a preferred mode of implementation, the invention is based on the targeting of apoptotic cells, thanks to a targeting element having the property of binding to cell membranes expressing a negatively charged lipid, in particular phosphatidylserine (PS). Apoptosis, or programmed cell death, is a normal physiological phenomenon, characteristic of multicellular organisms and present in particular in humans. Under normal conditions, the rate of apoptosis is however low and the apoptotic cells are very quickly phagocytosed either by neighboring cells, or more often by professional phagocytic cells such as macrophages or dendritic cells. In addition, apoptotic sites are often very dispersed and show no synchronization. As a result, physiological apoptosis is generally undetectable.
L'apoptose est signalée aux cellules phagocytaires par la présence de PS à la surface des cellules apoptotiques, résultant de la perte de l'asymétrie de leur membrane plasmique. La présence d'apoptose détectable est le signe d'un désordre physiologique où les fonctions phagocytaires sont débordées et incapables de faire face à l'accroissement des cellules à éliminer. Des exemples bien connus de tels désordres sont par exemple l'apoptose du muscle cardiaque après un infarctus ou l'apoptose hépatique à la suite d'une infection virale forte ou d'autres affections à caractère aigu. Des cellules en apoptose sont également présentes dans d'autres tissus ou mécanismes pathologiques, tels que Pinflammation et le cancer.Apoptosis is signaled to phagocytic cells by the presence of PS on the surface of apoptotic cells, resulting from the loss of asymmetry in their plasma membrane. The presence of detectable apoptosis is a sign of a physiological disorder where the phagocytic functions are overwhelmed and unable to cope with the increase in cells to be eliminated. Well-known examples of such disorders are, for example, apoptosis of the heart muscle after a heart attack or hepatic apoptosis following a strong viral infection or other conditions of an acute nature. Apoptotic cells are also found in other tissues or pathological mechanisms, such as inflammation and cancer.
D'autre part, lorsque le tissu pathologique contient peu ou pas suffisamment de cellules cibles capables de retenir massivement les molécules thérapeutiques de l'invention, celles- ci peuvent être utilisées en combinaison avec un agent ou un traitement causant ou favorisant l'apoptose au sein du tissu pathologique afin d'augmenter le bénéfice thérapeutique. Par exemple, certains tissu cancéreux «jeune » (e.g., de petite taille ou non- métastasés) ne contiennent pas toujours une quantité importante de cellules en apoptose, compte tenu de leur division rapide. Dans ce cas, un agent favorisant l'apoptose (par exemple un anti-tumoral classique) peut être utilisé en combinaison avec les molécules de l'invention, du moins au début du traitement, pour augmenter l'efficacité thérapeutique.On the other hand, when the pathological tissue contains little or not enough target cells capable of massively retaining the therapeutic molecules of the invention, these can be used in combination with an agent or a treatment causing or promoting apoptosis in within the pathological tissue in order to increase the therapeutic benefit. For example, some “young” cancerous tissue (eg, small or non-metastasized) does not always contain a significant amount of cells in apoptosis, given their rapid division. In this case, an agent promoting apoptosis (for example a conventional anti-tumor) can be used in combination with the molecules of the invention, at least at the start of the treatment, to increase the therapeutic effectiveness.
L'avantage de cibler les cellules apoptotiques de l'environnement tumoral, plutôt que de cibler des marqueurs spécifiques de la surface des cellules tumorales (par exemple, grâce à des anticorps monoclonaux), réside dans l'effet cinétique lié à l'administration du composé
anti-tumoral : dans le premier cas, l'action du composé thérapeutique, s'il est administré de façon continue, produit une augmentation de la « cible » et donc de la concentration effective dudit composé thérapeutique dans l'environnement tumoral alors que, dans le second cas, la taille de la « cible » a tendance à diminuer ainsi que la concentration effective du composé thérapeutique. Cet effet cumulatif résultant du ciblage des cellules apoptotiques est également très important pour le contrôle des étapes initiales de la métastase en maintenant une concentration optimale du composé thérapeutique dans les phases finales de régression de la tumeur. La diminution forte de la dose effective de composé anti-tumoral et sa forte localisation dans la région tumorale a bien sur aussi pour effet de réduire considérablement les effets toxiques secondaires sur le patient.The advantage of targeting apoptotic cells in the tumor environment, rather than targeting specific markers on the surface of tumor cells (for example, by means of monoclonal antibodies), lies in the kinetic effect linked to the administration of the compound anti-tumor: in the first case, the action of the therapeutic compound, if administered continuously, produces an increase in the "target" and therefore in the effective concentration of said therapeutic compound in the tumor environment, while, in the second case, the size of the "target" tends to decrease as well as the effective concentration of the therapeutic compound. This cumulative effect resulting from the targeting of apoptotic cells is also very important for controlling the initial stages of metastasis by maintaining an optimal concentration of the therapeutic compound in the final stages of tumor regression. The strong decrease in the effective dose of anti-tumor compound and its strong localization in the tumor region has of course also the effect of considerably reducing the secondary toxic effects on the patient.
Les molécules de l'invention permettent donc de cibler différents tissus pathologiques et d'y libérer un agent thérapeutique ou biologiquement actif in situ, réduisant ainsi leur effets cytotoxiques indésirables sur les tissus sains.The molecules of the invention therefore make it possible to target different pathological tissues and to release a therapeutic or biologically active agent therein in situ, thereby reducing their undesirable cytotoxic effects on healthy tissues.
Un premier objet de l'invention réside donc dans des molécules chimères comprenant une région de ciblage, une région active et une région de liaison sensible à l'environnement d'un tissu ou d'une cellule pathologique. La région de ciblage est préférentiellement une région ciblant les cellules en apoptose. La région active peut être tout composé thérapeutique, typiquement anti-cancéreux ou anti-inflammatoire. Le composé thérapeutique est typiquement moins actif lorsqu'il est dans la forme d'une molécule chimère de l'invention, que sous une forme libre.A first subject of the invention therefore resides in chimeric molecules comprising a targeting region, an active region and a binding region sensitive to the environment of a pathological tissue or cell. The targeting region is preferably a region targeting apoptotic cells. The active region can be any therapeutic compound, typically anti-cancer or anti-inflammatory. The therapeutic compound is typically less active when it is in the form of a chimeric molecule of the invention, than in a free form.
Un autre objet de l'invention concerne une composition pharmaceutique comprenant une molécule chimère telle que définie ci-avant.Another subject of the invention relates to a pharmaceutical composition comprising a chimeric molecule as defined above.
Un autre objet de l'invention concerne l'utilisation des molécules de ciblage telles que définies ci-avant pour la préparation de médicaments. Dans un mode préféré de réalisation, ces médicaments sont des médicaments anti-tumoraux ou anti-inflammatoires. L'invention est utilisable notamment pour le traitement de tumeurs solides ou liquides ou hématopoiétiques, en particulier de cancers du sein, du poumon, de l'intestin, du colon, de la prostate, du cerveau, tête-et-cou, du foie, de la peau, le lymphome, le mélanome, etc. Lorsque le composé thérapeutique est un anti-inflammatoire, les molécules selon l'invention peuvent être utilisées pour la préparation de médicaments destinés au
traitement de pathologies inflammatoires aiguës ou chroniques comme l'asthme, la rectocolite hémorragique, la maladie de Crohn, le choc septique, les maladies du collagène et P arthrite.Another object of the invention relates to the use of targeting molecules as defined above for the preparation of medicaments. In a preferred embodiment, these drugs are anti-tumor or anti-inflammatory drugs. The invention can be used in particular for the treatment of solid or liquid or hematopoietic tumors, in particular of breast, lung, intestine, colon, prostate, brain, head and neck, liver cancers. , skin, lymphoma, melanoma, etc. When the therapeutic compound is an anti-inflammatory, the molecules according to the invention can be used for the preparation of medicaments intended for treatment of acute or chronic inflammatory pathologies such as asthma, ulcerative colitis, Crohn's disease, septic shock, collagen diseases and P arthritis.
Un autre objet de l'invention concerne l'utilisation des molécules de ciblage telles que définies ci-avant pour la délivrance locale de principes actifs dans le voisinage de tissus pathologiques chez des sujets.Another object of the invention relates to the use of targeting molecules as defined above for the local delivery of active principles in the vicinity of pathological tissues in subjects.
La présente invention concerne en outre des méthodes de traitement d'une pathologie chez un sujet comprenant l'administration d'une molécule ou d'une composition telles que définies ci-avant. De préférence, la pathologie concernée est un cancer ou une inflammation. La méthode de traitement peut comprendre en outre une étape préalable consistant en un traitement permettant de générer des cellules engagées dans un processus d'apoptose dans le tissu pathologique. Elle concerne également des méthodes de délivrance locale de principes actifs dans le voisinage de tissus pathologiques chez des sujets, comprenant l'administration d'une molécule ou d'une composition telles que définies ci- avant.The present invention also relates to methods of treating a pathology in a subject comprising the administration of a molecule or a composition as defined above. Preferably, the pathology concerned is cancer or inflammation. The treatment method may further comprise a preliminary step consisting of a treatment making it possible to generate cells engaged in a process of apoptosis in the pathological tissue. It also relates to methods of local delivery of active principles in the vicinity of pathological tissues in subjects, comprising the administration of a molecule or of a composition as defined above.
Ces différents aspects de l'invention seront décrits plus en détails dans la suite du texte.These different aspects of the invention will be described in more detail in the following text.
MOLECULE DE CIBLAGE ET DE LIBERATION DE COMPOSE THERAPEUTIQUETHERAPEUTIC COMPOUND TARGETING AND RELEASE MOLECULE
Comme indiqué précédemment, les molécule de l'invention comprennent typiquement trois parties ou domaines fonctionnels liés les uns aux autres, à savoir une région de ciblage (C), une région biologiquement active (A) et une région de liaison (L) sensible à l'environnement d'un tissu ou d'une cellule pathologique. L'agencement des différents éléments peut varier, et notamment selon l'ordre A-L-C ou C-L-A. D'autre part, dans certains modes de réalisation, la région (ou la fonction) L peut être insérée ou comprise au sein de l'une des régions A ou C.As indicated above, the molecules of the invention typically comprise three parts or functional domains linked to each other, namely a targeting region (C), a biologically active region (A) and a binding region (L) sensitive to the environment of a tissue or pathological cell. The arrangement of the different elements can vary, and in particular according to the order A-L-C or C-L-A. On the other hand, in certain embodiments, the region (or function) L can be inserted or included within one of the regions A or C.
De manière plus préférée :More preferably:
1) Le segment de ciblage C est une molécule capable de reconnaître ou de lier préférentiellement des cellules engagées dans un processus pathologique, de préférence d'apoptose ;
2) Le segment de liaison L est une molécule assurant la liaison entre A et C, ladite liaison étant clivable sur le site cible permettant la libération du segment thérapeutique A ;1) Targeting segment C is a molecule capable of recognizing or preferentially binding cells engaged in a pathological process, preferably apoptosis; 2) The binding segment L is a molecule ensuring the binding between A and C, said binding being cleavable at the target site allowing the release of the therapeutic segment A;
3) La partie A est une molécule biologiquement active présentant des propriétés thérapeutiques.3) Part A is a biologically active molecule with therapeutic properties.
Segment de Ciblage CTargeting segment C
Le segment de ciblage C comprend un polypeptide capable de se lier à la surface de cellules présentes de façon caractéristique ou spécifique dans un tissu présentant une pathologie, ou générées dans ce tissu par un traitement préalable ou combiné. Ce segment de ciblage C est de préférence capable de se lier aux membranes des cellules engagées dans un processus d'apoptose, celles-ci exposant à leur surface des lipides chargés négativement comme la phosphatidylsérine.Targeting segment C comprises a polypeptide capable of binding to the surface of cells characteristically or specifically present in a tissue presenting a pathology, or generated in this tissue by a prior or combined treatment. This targeting segment C is preferably capable of binding to the membranes of cells engaged in a process of apoptosis, these exposing on their surface negatively charged lipids such as phosphatidylserine.
Dans un premier mode de réalisation préféré, la partie C comprend un polypeptide capable de se lier préférentiellement à la surface des cellules tumorales ou présentes dans un tissu tumoral ou générées dans ces tissus par un traitement au moyen d'un agent favorisant l'apoptose, par exemple un anti-tumoral (chimiothérapie, radiothérapie, etc.).In a first preferred embodiment, part C comprises a polypeptide capable of preferentially binding to the surface of tumor cells or present in tumor tissue or generated in these tissues by treatment with an agent promoting apoptosis, for example an anti-tumor (chemotherapy, radiotherapy, etc.).
Dans un autre mode de réalisation préféré, le segment de ciblage C comprend un polypeptide capable de se lier préférentiellement à la surface des cellules présentes dans un tissu inflammatoire et en particulier les cellules neutrophiles qui s'accumulent dans ces tissus et y meurent par apoptose 24 à 48 heures après leur arrivée. Les neutrophiles constituent des « appâts » pour les molécules de ciblage.In another preferred embodiment, the targeting segment C comprises a polypeptide capable of preferentially binding to the surface of the cells present in an inflammatory tissue and in particular the neutrophil cells which accumulate in these tissues and die there by apoptosis 24 48 hours after their arrival. Neutrophils are "baits" for targeting molecules.
Le terme « se lier préférentiellement » indique que l'élément de ciblage possède une affinité particulière pour les cellules ou tissus considérés, même si une liaison non spécifique ou moins importante avec d'autres cellules ou tissus ne peut être totalement exclue in vivo. La liaison préférentielle assure néanmoins un ciblage des molécules chimères de l'invention vers les sites pathologiques, réduisant la dissémination et les effets secondaires potentiels.The term "preferentially bind" indicates that the targeting element has a particular affinity for the cells or tissues considered, even if a non-specific or less important bond with other cells or tissues cannot be completely excluded in vivo. The preferential bond nevertheless ensures targeting of the chimeric molecules of the invention towards the pathological sites, reducing the dissemination and the potential side effects.
Le segment de ciblage C est de préférence une molécule peptidique. On entend par molécule peptidique toute molécule composée ou comprenant des acides aminés, naturels ou non, éventuellement modifiés, comme par exemple toute protéine ou fragment de
protéine, un polypeptide ou peptide, naturels ou synthétiques, modifiés ou non. La propriété commune de ces éléments est de pouvoir se lier de manière préférentielle à des cellules caractéristiques de situations pathologiques et, dans un mode plus préféré, aux membranes cellulaires exposant des lipides chargés négativement, notamment la phosphatidylsérine. D'une façon générale, la présente invention prévoit l'utilisation de toute protéine, fragment ou dérivé de protéine répondant à ce critère.The targeting segment C is preferably a peptide molecule. By peptide molecule is meant any molecule composed or comprising amino acids, natural or not, optionally modified, such as for example any protein or fragment of protein, a polypeptide or peptide, natural or synthetic, modified or not. The common property of these elements is to be able to bind preferentially to cells characteristic of pathological situations and, in a more preferred mode, to cell membranes exhibiting negatively charged lipids, in particular phosphatidylserine. In general, the present invention provides for the use of any protein, fragment or derivative of protein meeting this criterion.
Il existe plusieurs familles de protéines capables de se lier aux membranes exposant des lipides chargés négativement. On peut citer notamment la famille des Annexines, les familles de protéines comportant un domaine Cl ou C2, telles que les facteurs V et VIII de la coagulation sanguine ; les familles de protéines comportant un domaine PH ou un domaine FYVE ; ou encore les protéines comportant un domaine identique ou homologue du domaine 5 des β2-Glycoprotéines-I (βGP-I). Ces protéines, ou des domaines issus ou dérivés de leurs séquences peuvent être utilisés comme élément de ciblage dans les molécules chimères de l'invention. Pour des raisons d'imrnunogénicité, on choisit de préférence la version humaine de ces protéines ou domaines de protéines. De plus, il convient chaque fois que cela est possible, de sélectionner et d'utiliser le plus petit domaine actif de ces protéines afin d'assurer la meilleure diffusion de la molécule au travers de la micro-vascularisation vers les tissus ciblés et surtout une meilleure bio- distribution et élimination par la voie rénale.There are several families of proteins capable of binding to membranes exposing negatively charged lipids. Mention may in particular be made of the Annexin family, the families of proteins comprising a Cl or C2 domain, such as factors V and VIII of blood coagulation; families of proteins comprising a PH domain or a FYVE domain; or proteins with an identical domain or homologous to domain 5 of β2-Glycoproteins-I (βGP-I). These proteins, or domains derived from or derived from their sequences can be used as a targeting element in the chimeric molecules of the invention. For reasons of immunogenicity, the human version of these proteins or protein domains is preferably chosen. In addition, whenever possible, it is necessary to select and use the smallest active domain of these proteins in order to ensure the best diffusion of the molecule through the micro-vascularization towards the targeted tissues and above all a better bio-distribution and elimination by the renal route.
Dans un mode de mise en œuvre particulier de la présente invention, l'élément de ciblage comprend une séquence peptidique dérivée des protéines ou fragments de protéines mentionnés plus haut. Par fragment est entendu une séquence d'au moins 10 acides aminés consécutifs, de préférence entre 50 et 500 acides aminés, de manière encore plus préférée environ 250 à 350 acides aminés. Ces dérivés présentent au moins 50 % d'identité avec les protéines initiales ou les fragments de celles-ci. De préférence, ils présentent 60 %, 75 %, 90 % ou 95 % d'identité. Certains des domaines de protéines mentionnés, notamment les domaines PH et FYVE, peuvent par ailleurs être mutés de façon à modifier leur spécificité lipidique pour les adapter aux besoins précis du ciblage de cellules en phase apoptotique.In a particular embodiment of the present invention, the targeting element comprises a peptide sequence derived from the proteins or protein fragments mentioned above. By fragment is meant a sequence of at least 10 consecutive amino acids, preferably between 50 and 500 amino acids, even more preferably around 250 to 350 amino acids. These derivatives have at least 50% identity with the initial proteins or the fragments thereof. Preferably, they have 60%, 75%, 90% or 95% identity. Some of the protein domains mentioned, in particular the PH and FYVE domains, can moreover be mutated so as to modify their lipid specificity to adapt them to the precise needs of targeting cells in the apoptotic phase.
Le segment de ciblage C peut contenir un ou plusieurs sites de liaison au segment L. La présence de plusieurs sites présente l'avantage de pouvoir distribuer plusieurs molécules
thérapeutiques A en une seule fois et d'augmenter dans les mêmes proportions la concentration de A dans l'environnement des tissus touchés par la pathologie concernée.The targeting segment C can contain one or more sites for binding to the segment L. The presence of several sites has the advantage of being able to distribute several molecules therapeutic A in one go and increase in the same proportions the concentration of A in the environment of the tissues affected by the pathology concerned.
Dans un mode de réalisation particulier, la structure de la molécule selon la présente invention est alors :In a particular embodiment, the structure of the molecule according to the present invention is then:
C-(L-A)n Ou (A-L)n-C où n ≥ l (Fl).C- (LA) n Or (AL) n -C where n ≥ l (Fl).
Dans un autre mode de réalisation, éventuellement combinable avec le précédent, le segment de ciblage C peut comprendre une répétition de plusieurs polypeptides ou motifs de liaison aux cellules pathologiques ou cibles (désignés CO), afin d'augmenter l'efficacité du ciblage. La formule générale de telles molécules est la suivante :In another embodiment, possibly combinable with the previous one, the targeting segment C can comprise a repetition of several polypeptides or motifs for binding to pathological or target cells (designated CO), in order to increase the efficiency of targeting. The general formula of such molecules is as follows:
(CO)1n-(L-A)n ou (A-L)n-(CO)1n (F2) où n et m sont, indépendamment l'un de l'autre, un nombre entier supérieur ou égal à 1.(CO) 1n - (LA) n or (AL) n - (CO) 1n (F2) where n and m are, independently of each other, an integer greater than or equal to 1.
Pour optimiser le comportement in vivo de la molécule thérapeutique, on choisit de préférence m et/ou n = 1 ou 2.To optimize the in vivo behavior of the therapeutic molecule, it is preferable to choose m and / or n = 1 or 2.
Selon une première variante spécifique de l'invention, le segment de ciblage C comprend la séquence d'une annexine, ou d'un fragment ou un dérivé de celle-ci. Le segment de ciblage C comprend de préférence la séquence du « coeur à quatre domaines » d'une protéine de la famille des annexines. De préférence, l'annexine est de type V, un fragment ou un dérivé de celle-ci. L'annexine d'origine humaine est privilégiée. De préférence, le segment de ciblage C comprend le domaine 1 de cette annexine.According to a first specific variant of the invention, the targeting segment C comprises the sequence of an annexin, or of a fragment or a derivative thereof. Targeting segment C preferably comprises the sequence of the “four-domain heart” of a protein of the annexin family. Preferably, the annexin is of type V, a fragment or a derivative thereof. Annexin of human origin is preferred. Preferably, the targeting segment C comprises domain 1 of this annexin.
Selon une première variante spécifique de l'invention, le segment de ciblage C comprend un domaine de type Cl ou C2, un fragment ou un dérivé de celui-ci. Plus particulièrement, l'invention concerne des segments de ciblage C comprenant la séquence d'un domaine Cl d'un facteur de coagulation, un fragment ou un dérivé de celui-ci. De façon alternative, l'invention concerne des segments de ciblage C comprenant la séquence d'un domaine C2 du facteur VIII humain de la coagulation , un fragment ou un dérivé de celui-ci.According to a first specific variant of the invention, the targeting segment C comprises a Cl or C2 type domain, a fragment or a derivative thereof. More particularly, the invention relates to targeting segments C comprising the sequence of a Cl domain of a coagulation factor, a fragment or a derivative thereof. Alternatively, the invention relates to targeting segments C comprising the sequence of a C2 domain of human coagulation factor VIII, a fragment or a derivative thereof.
Dans un mode préféré de réalisation, le segment de ciblage C est un polypeptide construit sur la base d'une topologie de domaine de type Cl. De préférence, le segment de ciblage C
comprend un polypeptide de séquence choisie parmi SEQ ID Nos 1-8, de préférence SEQ ID Nos 2-4, et 6-8, ou un fragment de celui-ci.In a preferred embodiment, the targeting segment C is a polypeptide constructed on the basis of a Cl-type domain topology. Preferably, the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 1-8, preferably SEQ ID Nos 2-4, and 6-8, or a fragment thereof.
Domaine de type Cl du facteur V humain de la coagulation - ClF 5 -SO (F-V) séquence sauvageCl factor domain of human coagulation factor V - ClF 5 -SO (F-V) wild-type sequence
(SEQ ID No 1)(SEQ ID No 1)
DCRMPMGLST GIISDSQIKA SEFLGYWEPR LARLNNGGSY NAWSVEKLAA EFASKPWIQV DMQKEVIITG IQTQGAKHYL KSCYTTEFYV AYSSNQINWQ IFKGNSTRNV MYFNGNSDAS TIKENQFDPP IVARYIRISP TRAYNRPTLR LELQGCDCRMPMGLST GIISDSQIKA SEFLGYWEPR LARLNNGGSY NAWSVEKLAA EFASKPWIQV DMQKEVIITG IQTQGAKHYL KSCYTTEFYV AYSSNQINWQ IFKGNSTRNV MYFNGNSDAS TIKENQFDPP IVARYIRPR
Polypeptides construits sur la base du domaine de type Cl du facteur V humain de la coagulationPolypeptides constructed on the basis of the Cl-type domain of human coagulation factor V
C1F5-S1 (SEQ ID No 2) DCRMPLGMST GIISDSQIKA SEFLGYWEPR LARLNNGGSY NAWSVEKLAAC1F5-S1 (SEQ ID No 2) DCRMPLGMST GIISDSQIKA SEFLGYWEPR LARLNNGGSY NAWSVEKLAA
EFASKPWLQI DMQKEVIITG IQTQGAKHYL KSCYTTEFYI AYSSNQINWQEFASKPWLQI DMQKEVIITG IQTQGAKHYL KSCYTTEFYI AYSSNQINWQ
IFKGNSTRNV MYFNGNSDAS TIKENQLDPP IVARYIRISP TRAYNRPTLR LELQGCIFKGNSTRNV MYFNGNSDAS TIKENQLDPP IVARYIRISP TRAYNRPTLR LELQGC
C1F5-S2 (SEQ ID No 3)C1F5-S2 (SEQ ID No 3)
DCRMPMGLST GIISDSQIKA SEFLGYWWPR LARLNNGGSY NAWSVEKLAA EFASKPWIQV DLQKEVIITG IQTQGAKHYL KSCYVTEFYV AYSSNQINWQ IFKYNSTRNV MYFNGNSDAS TIKENQFDPP LVARYIRISP TRAYNRITLR LELQGCDCRMPMGLST GIISDSQIKA SEFLGYWWPR LARLNNGGSY NAWSVEKLAA EFASKPWIQV DLQKEVIITG IQTQGAKHYL KSCYVTEFYV AYSSNQINWQ IFKYNSTRNV MYFNGNSDAS TIKENQFDPP LVARYRP
C1F5-S3 (SEQ ID No 4)C1F5-S3 (SEQ ID No 4)
DCRMPMGLST GIISDSQIKA SEFLGYWEPR LARLNNGGSY NAWSVEKLAA EFASKPWLQI DLQKEVIITG IQTQGAKHYL KSCYTTEFYI AYSSNQINWQ IFKGNSTRNV MYFNGNSDAS TIKENQLDPP IVARYIRISP TRAYNRPTLR LELQGCDCRMPMGLST GIISDSQIKA SEFLGYWEPR LARLNNGGSY NAWSVEKLAA EFASKPWLQI DLQKEVIITG IQTQGAKHYL KSCYTTEFYI AYSSNQINWQ IFKGNSTRNV MYFNGNSDAS TIKENQLDPP IVARYRP
Domaine de type Cl dufacteur VIII humain de la coagulation - C1F8-S0 (F-V) séquence sauvage (SEQ ID No 5) KCQTPLGMAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WIKVDLLAPM IIHGIKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDSSGIKHNI FNPPIIARYI RLHPTHYSIR STLRMELMGC
Polypeptides construits sur la base du domaine de type Cl du facteur VIII humain de la coagulationCl type domain of human coagulation factor VIII - C1F8-S0 (FV) wild-type sequence (SEQ ID No 5) KCQTPLGMAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WIKVDLLAPM IIHGIKTQGA RQKFSSLYGMRGMRGMRGMQRNGMQRGNQMRQKRQRGKRQGRQKRQGNRQKFQGRQKFQGNRQKFQGNRQKFQGNQRQKRQKRNKGQQRGKQQRQKRQRGKQQRQKRQRGKQQRQKRQRGKQQR Polypeptides constructed on the basis of the Cl type domain of human coagulation factor VIII
C1F8-S1 (SEQ ID No 6) KCQTPMGLAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WLKIDLLAPM IIHGIKTQGA RQKFSSLYIS QYIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDSSGIKHNI FNPPIIARYI RLHPTHYSIR STLRMELMGCC1F8-S1 (SEQ ID No 6) KCQTPMGLAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WLKIDLLAPM IIHGIKTQGA RQKFSSLYIS QYIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDSSPHRMMYIR
C1F8-S2 (SEQ ID No 7) KCQTPMGLAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WIKVDLLAPM IIHGVKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRYNS TGTLMVFFGN VDSSGIKHNI FNPPLIARYI RLHPTHYSIR STLRMELMGCC1F8-S2 (SEQ ID No 7) KCQTPMGLAS GHIRDFQITA SGQYGQWAPK LARLHYSGSI NAWSTKEPFS WIKVDLLAPM IIHGVKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRYNS TGTLMVFFGN VDSSGIKILRMPLYLRMPLYRMNP
C1F8-S3 (SEQ ID No 8) KCQTPLGMAS GHIRDFQITA SGQYGQWWPK LARLHYSGSI NAWSTKEPFS WLKIDLLAPM IIHGIKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDSSGIKHNI FNPPLLARYI RLHPTHYSIR STLRMEVMGCC1F8-S3 (SEQ ID No 8) KCQTPLGMAS GHIRDFQITA SGQYGQWWPK LARLHYSGSI NAWSTKEPFS WLKIDLLAPM IIHGIKTQGA RQKFSSLYIS QFIIMYSLDG KKWQTYRGNS TGTLMVFFGN VDLPGIRI
Dans un autre mode préféré de réalisation, le segment de ciblage C est un polypeptide construit sur la base d'une topologie de domaine de type C2. De préférence, le segment de ciblage C comprend un polypeptide de séquence choisie parmi SEQ ID Nos 9-16, de préférence SEQ ID Nos 10-12, et 14-16, ou un fragment de celui-ci.In another preferred embodiment, the targeting segment C is a polypeptide constructed on the basis of a C2 type domain topology. Preferably, the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 9-16, preferably SEQ ID Nos 10-12, and 14-16, or a fragment thereof.
Domaine de type C2 du facteur V humain de la coagulation — C2F5-S0 (F-V) séquence sauvageC2 type domain of human coagulation factor V - C2F5-S0 (F-V) wild-type sequence
(SEQ ID No 9)(SEQ ID No 9)
CSTPLGMENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQAK ANNNKQWLEI DLLKIKKITA IITQGCKSLS SEMYVKSYTI HYSEQGVEWK PYRLKSSMVD KIFEGNTNTK GHVKNFFNPP IISRFIRVIP KTWNQSITLR LELFGCDIYCSTPLGMENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQAK ANNNKQWLEI DLLKIKKITA IITQGCKSLS SEMYVKSYTI HYSEQGVEWK PYRLKSSMVD KIFEGNTNTK GHVKNFFNPP IISRFNFPK
Polypeptides construits sur la base du domaine de type C2 du facteur V humain de la coagulationPolypeptides constructed on the basis of the C2 type domain of human coagulation factor V
C2F5-S1 (SEQ ID No 10) CSTPLGMENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQPK ANNNKQWLEV DLLKIKKITA VITQGCKSLS SEMYVKSFTI HYSEQGVEWK
PFRLKSSMVD KINEGNTNTK GHVKNFPNPP RISRFIRVIP KTWNQSITLR LELFGCDIYC2F5-S1 (SEQ ID No 10) CSTPLGMENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQPK ANNNKQWLEV DLLKIKKITA VITQGCKSLS SEMYVKSFTI HYSEQGVEWK PFRLKSSMVD KINEGNTNTK GHVKNFPNPP RISRFIRVIP KTWNQSITLR LELFGCDIY
C2F5-S2 (SEQ ID No 11) CSTPLGIENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQAK ANNNKQWLEM DFLKIKKVTA VITQGCKSLS SEMYVKSFTI HYSEQGVEWK PYRLKSSMVD KIFEGNTNTK GHVKNFFNPP IISRFIRQIP KTWNQSITLR LELYGCDIYC2F5-S2 (SEQ ID No 11) CSTPLGIENG KIENKQITAS SFKKSWWGDY WEPFRARLNA QGRVNAWQAK ANNNKQWLEM DFLKIKKVTA VITQGCKSLS SEMYVKSFTI HYSEQGVEWK PYRLKSSMVD KIFEGNTNPQ KISEGNTNPQ GHVKNFRK
C2F5-S3 (SEQ ID No 12)C2F5-S3 (SEQ ID No 12)
CSTPLGIENG KIENKQITAS SFKKSWWGDY WEPFRLRLNA QGRVNAWQAK ANNNKQWAEM DLLKIKKITA I ITQGCKSLS SEMYVKSYTI HYSEQGVEWK PYRLKSSMVD KIFEGNTNTK GHVKNFFNPP I ITRFIRVIP KTWNQSITIR LELFGCDIYCSTPLGIENG KIENKQITAS SFKKSWWGDY WEPFRLRLNA QGRVNAWQAK ANNNKQWAEM DLLKIKKITA I ITQGCKSLS SEMYVKSYTI HYSEQGVEWK PYRLKSSMVD KIFEGNTNTK GHVKNFFNPP I ITRFIRVTI KTW
Domaine de type C2 du facteur VIII humain de la coagulation - C2F8-S0 (F-V) séquence sauvage (SEQ ID No 13)C2 type domain of human coagulation factor VIII - C2F8-S0 (F-V) wild sequence (SEQ ID No 13)
CSMPLGMESK AISDAQITAS SYFTNMFATW SPSKARLHLQ GRSNAWRPQV NNPKEWLQVD FQKTMKVTGV TTQGVKSLLT SMYVKEFLIS SSQDGHQWTLCSMPLGMESK AISDAQITAS SYFTNMFATW SPSKARLHLQ GRSNAWRPQV NNPKEWLQVD FQKTMKVTGV TTQGVKSLLT SMYVKEFLIS SSQDGHQWTL
FFQNGKVKVF QGNQDSFTPV VNSLDPPLLT RYLRIHPQSW VHQIALRMEVFFQNGKVKVF QGNQDSFTPV VNSLDPPLLT RYLRIHPQSW VHQIALRMEV
LGCLGC
Polypeptides construits sur la base du domaine de type C2 du facteur VIII humain de la coagulationPolypeptides constructed on the basis of the C2 type domain of human coagulation factor VIII
C2F8-S1 (SEQ ID No 14)C2F8-S1 (SEQ ID No 14)
CSMPLGMESK AISDAQITAS SYFTNMFATW SPSKARLHLQ GRSNAWRAQV NNPKEWLQID LQKTMKITGI TTQGVKSLLT SMYVKEYLIS SSQDGHQWTL FYQNGKVKVF QGNQDSFTPV VNSLDPFLLT RYLRIHPVSW VHQIALRMEV LGCCSMPLGMESK AISDAQITAS SYFTNMFATW SPSKARLHLQ GRSNAWRAQV NNPKEWLQID LQKTMKITGI TTQGVKSLLT SMYVKEYLIS SSQDGHQWTL FYQNGKVKVF QGNQDSFTPV VNSLDPRIWRY
C2F8-S2 (SEQ ID No 15)C2F8-S2 (SEQ ID No 15)
CSMPLGMESK AISDAQITAS SYKTNMFATW SPSKARLHLQ GRSNAWRAQV NNPKQWLQVD FQKTMKVTGV TTQGVKSLLT SMYVKEFLIS SSQDGHQWTL FFQNGKVKVF QGFQDSFTPV VNSLDPPLLT IYLRIHPQSW VHQIALRMEV LEC
C2F8-S3 (SEQ ID No 16)CSMPLGMESK AISDAQITAS SYKTNMFATW SPSKARLHLQ GRSNAWRAQV NNPKQWLQVD FQKTMKVTGV TTQGVKSLLT SMYVKEFLIS SSQDGHQWTL FFQNGKVKVF QGFQDSFTPV VNSLQLIAL C2F8-S3 (SEQ ID No 16)
CSMPLGMESK AISDAQITAS SYKTNMFATW SPSKARLHLQ GRSNAWRPQV NNPKEWLQVD FQKTMKVTGV TTQGVKSLLT SMYVKEYLIS SSQDGHQWTL FYQNGKVKVF QGNQDSFTPV VNSLDPFLLT RYLRIHPQSW VHQIALRMEV LECCSMPLGMESK AISDAQITAS SYKTNMFATW SPSKARLHLQ GRSNAWRPQV NNPKEWLQVD FQKTMKVTGV TTQGVKSLLT SMYVKEYLIS SSQDGHQWTL FYQNGKVKVF QGNQDSFTPV VNSRDP VNSLDP
Dans un mode préféré de réalisation, le segment de ciblage C est un polypeptide construit sur la base d'une topologie de type domaine 5 des β2-Glycoprotéines-I (β2GP-I) (SEQ ID No 17). De préférence, le segment de ciblage C comprend un polypeptide de séquence choisie parmi SEQ ID Nos 17-22, de préférence SEQ ID Nos 18-22, ou un fragment de celui-ci.In a preferred embodiment, the targeting segment C is a polypeptide constructed on the basis of a domain 5 topology of β2-Glycoproteins-I (β2GP-I) (SEQ ID No 17). Preferably, the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 17-22, preferably SEQ ID Nos 18-22, or a fragment thereof.
Domaine 5 des β2-Glycoprotéines-I humaines — β2GP-I séquence sauvage (SEQ ID No 17) TKASCKVPVK KATWYQGER VKIQEKFKNG MLHGDKVSFF CKNKEKKCSY TEDAQCIDGT IEVPKCFKEH SSLAFWKTDA SDVKPCDomain 5 of human β2-Glycoproteins-I - wild-type β2GP-I (SEQ ID No 17) TKASCKVPVK KATWYQGER VKIQEKFKNG MLHGDKVSFF CKNKEKKCSY TEDAQCIDGT IEVPKCFKEH SSLAFWKTDA SDK
Dans un mode de réalisation préféré, le segment de ciblage C comprend un polypeptide dont la séquence générale est la suivante : TJ2ASCKU7PU9KJ11U12TU14U15U16J17GERU21J22U23QEKU27J28NGMLIn a preferred embodiment, the targeting segment C comprises a polypeptide whose general sequence is as follows: TJ 2 ASCKU 7 PU 9 KJ 11 U 12 TU 14 U 15 U 16 J 17 GERU 21 J 22 U 23 QEKU 27 J 28 NGML
HGDKU37SFU40CJ42NJ44EJ46J47CJ49YTEDU54QCIDGTU61EVPKCU67 HGDKU 37 SFU 40 CJ 42 NJ 44 EJ 46 J 47 CJ 49 YTEDU 54 QCIDGTU 61 EVPKCU 67
J68 E H S J72 U73 U74 J75 J76 J77 T D A S D V J84 P C (SEQ ID No 18) (S4) où:J 68 EHSJ 72 U 73 U 74 J 75 J 76 J 77 TDASDVJ 84 PC (SEQ ID No 18) (S4) where:
J2 = K , D, E ; Jl 1, J22, J28, J42, J44, J46, J47, J68, J77, Jl 7 = Q, E ; J84 = K, R ; J49 = S, T ; J72 = S, T, M ; U7 = L, V, I ; U9 = V, I, T ; U12 = A, M ; U14, U15, U21, U23, U37 =J2 = K, D, E; Jl 1, J22, J28, J42, J44, J46, J47, J68, J77, Jl 7 = Q, E; J84 = K, R; J49 = S, T; J72 = S, T, M; U7 = L, V, I; U9 = V, I, T; U12 = A, M; U14, U15, U21, U23, U37 =
V, I, T ; U16, U27, U40 ,U67 = F, Y ; U54 = A, V, I ; U61 = I, V, M ; U73,U74,U75,U76LIVES ; U16, U27, U40, U67 = F, Y; U54 = A, V, I; U61 = I, V, M; U73, U74, U75, U76
= L, I, F, Y, M, W.= L, I, F, Y, M, W.
De préférence, le segment de ciblage C comprend un polypeptide de séquence choisie parmi SEQ ID Nos 19-22 ou un fragment de celui-ci :Preferably, the targeting segment C comprises a polypeptide of sequence chosen from SEQ ID Nos 19-22 or a fragment thereof:
Polypeptides construits sur la base du domaine 5 des β2-Glycoprotéines-I humaines GPI-Sl (SEQ ID No 19)Polypeptides constructed on the basis of domain 5 of human β2-Glycoproteins-I GPI-S1 (SEQ ID No 19)
TEASCKVPVK RATWYEGER VRIQEKFKNG MLHGDKVSFF CRNRERRCSY TEDAQCIDGT IEVPKCYREH SMLTWWRTDA SDVKPC
6PI-S2 (SEQ ID No 20)TEASCKVPVK RATWYEGER VRIQEKFKNG MLHGDKVSFF CRNRERRCSY TEDAQCIDGT IEVPKCYREH SMLTWWRTDA SDVKPC 6PI-S2 (SEQ ID No 20)
TEASCKLPTK RMTWYEGER VRIQEKFKNG MLHGDKISFF CRNRERRCSY TEDΆQCIDGT IEVPKCYREH SMITWWRTDA SDVKPCTEASCKLPTK RMTWYEGER VRIQEKFKNG MLHGDKISFF CRNRERRCSY TEDΆQCIDGT IEVPKCYREH SMITWWRTDA SDVKPC
6PI-S3 (SEQ ID No 21)6PI-S3 (SEQ ID No 21)
TKASCKVPTK KMTVVYQGER VKIQEKFKNG MLHGDKISFF CKNKEKKCSY TEDAQCIDGT IEVPKCYKEH SSLAWWKTDA SDVKPCTKASCKVPTK KMTVVYQGER VKIQEKFKNG MLHGDKISFF CKNKEKKCSY TEDAQCIDGT IEVPKCYKEH SSLAWWKTDA SDVKPC
GPI-S4 (SEQ ID No 22)GPI-S4 (SEQ ID No 22)
TKASCKVPTK KMTVVYQGER VKIQEKFKNG MLHGDKISFF CKNKEKKCSY TEDAQCIDGT IEVPKCYKEH SSLAFWKTDA SDVKPCTKASCKVPTK KMTVVYQGER VKIQEKFKNG MLHGDKISFF CKNKEKKCSY TEDAQCIDGT IEVPKCYKEH SSLAFWKTDA SDVKPC
Dans un mode de réalisation préféré, le segment de ciblage C comprend un polypeptide dont la séquence générale est la suivante : jl.J2j3.J4_J5_J6.z7_u8_J9_J10.ull_R_J13_J14_ul5_κ_G_χ18_G_τ_J21_E_j23_J24_u25_J26_J27.J28_In a preferred embodiment, the targeting segment C comprises a polypeptide whose general sequence is as follows: jl. D 2d3. J 4_ J 5_ J 6. z 7_ u 8_ J 9_ J 10. u ll_ R _ J 13_ J 14_ u l 5 _ κ _ G _ χ 18_ G _ τ _ J 21_ E _j23_ J 24_ u 25_ J 26_ J 27 . J 28_
U29J30-J31-RJ33J34-J35J36-B^ J5lD-U56-K-S-ZS9-L-J^U 29 J 30 -J 31 -RJ 33 J 34 -J 35 J 36 -B ^ J 5 lD-U 56 -KSZ S9 -LJ ^
(S5) dans laquelle J, Z, U, X, et B représentent des acides aminés tels que :(S5) in which J, Z, U, X, and B represent amino acids such as:
- les acides aminés J sont choisis indépendamment les uns des autres parmi les acides aminés naturels, ou des dérivés de ceux-ci, de telle manière qu'au moins 50 % d'entre eux sont des résidus polaires choisis parmi R, N, D, C, Q, E, G, H, K, Orn, P, S, T et Y,- the amino acids J are chosen independently of each other from natural amino acids, or derivatives thereof, such that at least 50% of them are polar residues chosen from R, N, D , C, Q, E, G, H, K, Orn, P, S, T and Y,
- les acides aminés U sont choisis parmi A, C, G, I, L, M, F, W, Y, et V, - l'acide aminé X18 est choisi indépendamment des autres acides aminés de la séquence parmi A, N, C, Q, G, H, I, L, M, F, S, T, W, Y et V,- the amino acids U are chosen from A, C, G, I, L, M, F, W, Y, and V, - amino acid X 18 is chosen independently of the other amino acids of the sequence from A, N , C, Q, G, H, I, L, M, F, S, T, W, Y and V,
- l'acide aminé B37 est choisi indépendamment des autres acides aminés de la séquence parmi R, A, C5 G, I, L, M, F, W, Y, et V,amino acid B 37 is chosen independently of the other amino acids of the sequence from R, A, C 5 G, I, L, M, F, W, Y, and V,
- l'acide aminé Z7 est choisi indépendamment des autres acides aminés de la séquence parmi D et E,the amino acid Z 7 is chosen independently of the other amino acids of the sequence from D and E,
- les acides aminés Z59 et Z65 sont choisis indépendamment parmi E, D, K, et R, les exposants indiquant la position des acides aminés dans la séquence.- the amino acids Z 59 and Z 65 are chosen independently from E, D, K, and R, the exponents indicating the position of the amino acids in the sequence.
De préférence, les acides aminés J peuvent être choisis indépendamment les uns des autres parmi l'ensemble des résidus A, R, N, D, C, Q, E, G, H, I, L, K, M, Orn, F, P, S, T, W, Y,
et V, et de telle manière qu'au moins 50 % d'entre eux sont des résidus polaires choisis parmi R, N, D, C, Q, E, G, H, K, Om, P, S, T.Preferably, the amino acids J can be chosen independently of each other from the set of residues A, R, N, D, C, Q, E, G, H, I, L, K, M, Orn, F , P, S, T, W, Y, and V, and in such a way that at least 50% of them are polar residues chosen from R, N, D, C, Q, E, G, H, K, Om, P, S, T.
Différentes combinaisons de résidus U et B sont données dans le tableau 1 ci-dessous :Different combinations of residues U and B are given in table 1 below:
A titre d'exemple, le peptide de formule Sl peut être avantageusement une séquence peptidique choisie parmi les séquences peptidiques SEQ ID No 23-32.By way of example, the peptide of formula S1 can advantageously be a peptide sequence chosen from the peptide sequences SEQ ID No 23-32.
La séquence Sl représente un type de peptides dans sa forme la plus courte. Il est bien entendu que cette séquence peut comprendre en outre un ou plusieurs acides aminés supplémentaire à l'une ou l'autre des extrémités, par exemple de 1 à 15 acides aminés, en général de 1 à 10 acides aminés pour obtenir une fonctionnalisation supplémentaire. Par exemple, une petite séquence, dite de fonctionnalisation, peut être liée au peptide permettant la fixation au segment L. Cette séquence de fonctionnalisation peut être située à l'extrémité N-terminale de la séquence Sl. Elle peut être d'environ 3 acides aminés choisis de préférence parmi G-S-C-, G-S-T-, G-S-P-, G-S-S-, G-S-G-, et G-S-Q-. Elle peut être également d'environ 4 acides aminés, choisis de préférence parmi les séquences G-S-Aa- C-, G-C-Aa-S-, G-S-Aa-S-, G-C-Aa-C-, et G-C-Aa-S- où Aa est un acide aminé quelconque.
Ces séquences de fonctionnalisation sont avantageuses en ce qu'elles permettent en particulier le marquage aisé par des radio-traceurs comme le 99mTc ou le 18F et permettent, par injection chez l'homme à dose traceuse, de suivre parfaitement in vivo le devenir du médicament, sa bio-distribution et de contrôler sa bonne localisation.The sequence S1 represents a type of peptide in its shortest form. It is understood that this sequence can also comprise one or more additional amino acids at one or the other of the ends, for example from 1 to 15 amino acids, in general from 1 to 10 amino acids to obtain additional functionalization. . For example, a small sequence, called a functionalization sequence, can be linked to the peptide allowing attachment to the L segment. This functionalization sequence can be located at the N-terminal end of the sequence S1. It can be around 3 amino acids preferably chosen from GSC-, GST-, GSP-, GSS-, GSG-, and GSQ-. It can also be around 4 amino acids, preferably chosen from the sequences GS-Aa- C-, GC-Aa-S-, GS-Aa-S-, GC-Aa-C-, and GC-Aa- S- where Aa is any amino acid. These functionalization sequences are advantageous in that they allow in particular easy labeling by radio-tracers such as 99m Tc or 18 F and allow, by injection into humans at a tracer dose, to follow in vivo the fate perfectly. of the drug, its bio-distribution and to control its good localization.
Par ailleurs la séquence Sl peut être dupliquée au sein d'un même peptide pour produire une molécule présentant une affinité encore plus élevée pour les sites apoptotiques.Furthermore, the sequence S1 can be duplicated within the same peptide to produce a molecule exhibiting an even higher affinity for the apoptotic sites.
Segment de Liaison LLink segment L
Le segment L est une molécule de liaison clivable sur le site cible, et reliant la partie A et la partie C. Le segment L peut être toute molécule ou liaison chimique, de type covalent, y compris des molécules en partie ou totalement de nature peptidique, modifiée ou non, naturelle ou non. Le segment L contient avantageusement une fonction chimique reconnue et clivable dans l'environnement du tissu ou des cellules pathologiques, par exemple par une enzyme ou un ensemble d'enzymes spécifiques de l'environnement des cellules ciblées.The segment L is a binding molecule cleavable at the target site, and connecting part A and part C. Segment L can be any molecule or chemical bond, of covalent type, including molecules in part or totally of peptide nature , modified or not, natural or not. The L segment advantageously contains a recognized chemical function which can be cleaved in the environment of the tissue or pathological cells, for example by an enzyme or a set of enzymes specific to the environment of the targeted cells.
La présence, entre les parties A et C, du segment de liaison L clivable préférentiellement dans l'environnement des cellules ciblées permet une libération locale et ciblée du principe actif et confère aux molécule de l'invention un comportement de type pro-drogue ciblée. En effet, la molécule est peu active tant qu'elle ne réside pas dans l'environnement des cellules ciblées possédant les enzymes ou autres facteurs de clivage.The presence, between parts A and C, of the linker segment L which can be cleaved preferentially in the environment of the targeted cells allows a local and targeted release of the active principle and gives the molecules of the invention a behavior of the targeted pro-drug type. Indeed, the molecule is not very active as long as it does not reside in the environment of the targeted cells possessing the enzymes or other cleavage factors.
Le segment de liaison L peut être simple ou ramifié. L'intérêt d'une ramification est de pouvoir amener et distribuer plusieurs molécules thérapeutiques avec une seule molécule de ciblage C. Dans ce mode de mise en œuvre, la structure générale du segment de liaison est donc L = D(LO)n, où D est un élément de ramification, n est un nombre entier égal ou supérieur à 1 (correspondant au nombre de bras que comporte la ramification), et LO est le lien proprement dit.The linking segment L can be simple or branched. The advantage of a branching is to be able to bring and distribute several therapeutic molecules with a single targeting molecule C. In this mode of implementation, the general structure of the link segment is therefore L = D (LO) n , where D is a branching element, n is an integer equal to or greater than 1 (corresponding to the number of arms in the branching), and LO is the link itself.
Il en découle que le composé faisant l'objet de la présente invention possède l'une des deux formules générales suivantes selon l'ordre dans lequel se succèdent les différentes parties :
C-D-(LO-A)n (F4A)It follows that the compound which is the subject of the present invention has one of the following two general formulas according to the order in which the different parts succeed one another: CD- (LO-A) n (F4A)
(A-LO)n-D-C (F4B)(A-LO) n -DC (F4B)
Le segment L (ou LO) peut être de nature variée, comme une liaison ou molécule chimique, et en particulier de nature peptidique.The L (or LO) segment can be of a varied nature, such as a bond or chemical molecule, and in particular of a peptide nature.
Dans un mode de mise en œuvre préféré, le segment L est un lien peptidique clivable sensible aux protéases (ou autres enzymes), dénommées dans la suite du texte « protéases intervenantes », plus spécifiquement sur-exprimées soit à la surface des cellules présentant la pathologie, soit libérées dans l'environnement des cellules ciblées, soit encore libérées par les cellules en phase apoptotique.In a preferred embodiment, the L segment is a cleavable peptide link sensitive to proteases (or other enzymes), called in the following text "intervening proteases", more specifically overexpressed either on the surface of cells presenting the pathology, either released into the environment of the target cells, or even released by the cells in the apoptotic phase.
Les cellules tumorales et inflammatoires, ainsi que, par exemple, les cellules stromales recrutées dans l'environnement de celles-ci, sont connues pour excréter une variété de protéases intervenantes, en particulier des métallo-protéases de la matrice extra-cellulaire (MMP), des urokinases, les protéases spécifiques du clivage du segment extracellulaire des cytokines membranaires ou de leurs récepteurs (ADAM), etc. Des exemple de séquences clivées par ces protéases sont données dans le Tableau 2. Ces protéases intervenantes jouent un rôle important dans l'évolution de la tumeur ou du tissu inflammatoire et notamment dans l'envahissement des tissus environnants et la formation de métastases, ou l'envahissement par les cellules spécialisées de réaction inflammatoire. Par exemple, le taux de MMP dans l'environnement tumoral ou inflammatoire est bien supérieur à celui présent dans un tissu normal car, en particulier, le contrôle de l'expression de ces MMP dépend de l'action de certaines cytokines. Il donc possible de mettre à profit ce différentiel d'expression pour amplifier le principe du ciblage du composé anti-tumoral ou anti- inflammatoire en ne permettant l'activation de ce composé qu'aux sites de ciblage. Des pro-drogues simples ont déjà été conçues mais elle ne résolvent pas le problème de la distribution uniforme du médicament dans l'ensemble de l'organisme car il n'y a pas d'accumulation de la pro-drogue au sein du tissu cancéreux ou inflammatoire. Au contraire, dans la présente invention, on propose un moyen d'accumuler le principe antitumoral ou anti-inflammatoire uniquement dans le tissu tumoral ou inflammatoire comportant déjà des cellules en voie d'apoptose, et de rendre actif le médicament essentiellement dans ce tissu. Autrement dit, l'ensemble C-L ou L-C constitue un système de vectorisation-activation de composés anti-tumoraux ou anti-inflammatoires. Cet
ensemble répond donc au double impératif suivant : réduire la concentration effective moyenne du médicament dans l'organisme, c'est à dire réduire les effets toxiques secondaires, et restreindre l'action du médicament au seul tissu intéressant, c'est à dire augmenter son efficacité.Tumor and inflammatory cells, as well as, for example, stromal cells recruited from the environment thereof, are known to excrete a variety of intervening proteases, in particular metallo-proteases of the extracellular matrix (MMP) , urokinases, specific proteases for the cleavage of the extracellular segment of membrane cytokines or their receptors (ADAM), etc. Examples of sequences cleaved by these proteases are given in Table 2. These intervening proteases play an important role in the evolution of the tumor or of the inflammatory tissue and in particular in the invasion of the surrounding tissues and the formation of metastases, or l invasion by specialized inflammatory reaction cells. For example, the level of MMP in the tumor or inflammatory environment is much higher than that present in normal tissue because, in particular, the control of the expression of these MMPs depends on the action of certain cytokines. It is therefore possible to take advantage of this expression differential to amplify the principle of targeting of the anti-tumor or anti-inflammatory compound by only allowing activation of this compound at the targeting sites. Simple pro-drugs have already been designed but they do not solve the problem of uniform distribution of the drug throughout the body because there is no accumulation of the pro-drug within the cancer tissue or inflammatory. On the contrary, in the present invention, a means is proposed to accumulate the antitumor or anti-inflammatory principle only in tumor or inflammatory tissue already comprising cells in the process of apoptosis, and to make the drug active essentially in this tissue. In other words, the CL or LC assembly constitutes a vectorization-activation system of anti-tumor or anti-inflammatory compounds. This together therefore meets the following double imperative: reduce the average effective concentration of the drug in the body, that is to say reduce the secondary toxic effects, and restrict the action of the drug to the only tissue of interest, that is to say increase its efficiency.
Le segment de liaison clivable L (ou LO) est donc un lien au moins partiellement peptidique comportant une séquence reconnue et clivée par une protéase intervenante majoritairement présente dans le tissu ciblé. Le lien L ou LO peut donc être représenté comme comprenant deux parties, L1-L2, conçues de telle sorte que les protéases intervenantes clivent la liaison peptidique du lien entre Ll et L2 et que la molécule libérée L2-A ou A-Ll, selon les molécules choisies, soit une molécule active au plan thérapeutique, de préférence au moins autant que la molécule initiale A. La longueur des parties Ll et L2 peut être optimisée en fonction de l'accessibilité nécessaire au site actif des protéases intervenantes, avec la contrainte de limiter autant qu'il se peut la taille finale de la molécule finale pour les raisons évoquées plus haut. Pour tenir compte de toutes les possibilités associées à la structure finale du composé thérapeutique, A-L-C ou C-L-A, la structure la plus générale proposée pour le lien L est la suivante : L = D-(Ll -L2)n (F5A)The cleavable linker segment L (or LO) is therefore an at least partially peptide link comprising a sequence recognized and cleaved by an intervening protease mainly present in the targeted tissue. The L or LO link can therefore be represented as comprising two parts, L1-L2, designed such that the intervening proteases cleave the peptide bond of the link between L1 and L2 and that the released molecule L2-A or A-L1, depending on the molecules chosen, ie a molecule which is therapeutically active, preferably at least as much as the initial molecule A. The length of the parts L1 and L2 can be optimized as a function of the accessibility necessary to the active site of the intervening proteases, with the constraint limit as much as possible the final size of the final molecule for the reasons mentioned above. To take into account all the possibilities associated with the final structure of the therapeutic compound, ALC or CLA, the most general structure proposed for the link L is as follows: L = D- (Ll -L2) n (F5A)
L = (L1-L2)n-D (F5B) où D, Ll , L2 et n ont la définition donnée plus haut.L = (L1-L2) n -D (F5B) where D, Ll, L2 and n have the definition given above.
La liaison entre les différents éléments fonctionnels des molécules de l'invention peut être réalisée par toute méthode de couplage chimique, enzymatique ou génétique connue en soi de l'homme du métier. Ainsi, il peut s'agir de liaisons chimiques, peptidiques, nucléiques, etc. Les groupements peuvent être couplés entre-eux par des liaisons maléimides, succinimide, intéine, biotine, aminé, amide, carboxyliques, phosphate, ester, éther, etc.The connection between the different functional elements of the molecules of the invention can be carried out by any chemical, enzymatic or genetic coupling method known per se to those skilled in the art. Thus, they can be chemical, peptide, nucleic bonds, etc. The groups can be coupled together by maleimide, succinimide, intein, biotin, amino, amide, carboxylic, phosphate, ester, ether, etc. bonds.
Dans une variante de l'invention, le lien L est lié à la molécule C (et/ou A) par un groupe maléimide, connu pour sa réaction rapide et totale avec un groupe thiol porté par un résidu cystéine accessible du segment de ciblage C (et/ou de la molécule A).In a variant of the invention, the link L is linked to the molecule C (and / or A) by a maleimide group, known for its rapid and total reaction with a thiol group carried by an accessible cysteine residue from the targeting segment C (and / or of molecule A).
Dans une autre variante, le lien L est lié à la molécule C (et/ou A) par réaction du groupe carboxylique terminal du peptide L avec un groupe amino porté par le segment thérapeutique A (ou de ciblage C).
Dans une autre variante de réalisation, le segment de liaison L est couplé à l'extrémité C- terminale (dans le cas d'une molécule H2N-L-A) ou N-terminale (dans le cas d'une molécule A-L-COOH) du segment C au moyen d'une intéine. L'intérêt de ce mode de construction de la molécule finale, par rapport au mode précédant utilisant une liaison par groupe maléimide, est qu'il préserve la possibilité de disposer d'une cystéine libre dans la molécule, pour une autre fonctionalisation ou pour un radio-marquage éventuel pour le suivi du médicament. Il y a en effet un grand intérêt thérapeutique à pouvoir suivre et contrôler au moyen de l'imagerie la bio-distribution et la cinétique de cette bio-distribution pour ce type de médicament ciblé.In another variant, the link L is linked to the molecule C (and / or A) by reaction of the terminal carboxylic group of the peptide L with an amino group carried by the therapeutic segment A (or targeting C). In another alternative embodiment, the linking segment L is coupled to the C-terminal (in the case of an H 2 NLA molecule) or N-terminal (in the case of an AL-COOH molecule) end of the segment C by means of an intein. The advantage of this mode of construction of the final molecule, compared to the previous mode using a linkage by maleimide group, is that it preserves the possibility of having a free cysteine in the molecule, for another functionalization or for a possible radiolabeling for monitoring the drug. There is indeed a great therapeutic interest in being able to follow and control by means of imaging the bio-distribution and the kinetics of this bio-distribution for this type of targeted drug.
Dans certains modes de réalisation, le segment L (ou la fonction de clivage) fait partie de l'élément C ou A. Il peut s'agir par exemple d'une extension N-terminale ou C-terminale du segment C ou A, notamment lorsque ce dernier est de nature peptidique.In certain embodiments, the segment L (or the cleavage function) is part of the element C or A. It can be for example an N-terminal or C-terminal extension of the segment C or A, especially when the latter is peptide in nature.
Les molécules de l'invention peuvent être assemblées en une ou plusieurs étapes, selon les techniques de couplage mises en œuvre. Ainsi, une molécule de type C-L peut être réalisée dans un premier temps, puis couplée avec une ou plusieurs molécules thérapeutiques A. Alternativement, lorsque les liaisons entre les segments fonctionnels font appel à des réactions chimiques différentes, une synthèse ou un assemblage simultanée sont possibles.The molecules of the invention can be assembled in one or more steps, depending on the coupling techniques used. Thus, a CL type molecule can be produced first, then coupled with one or more therapeutic molecules A. Alternatively, when the connections between the functional segments call for different chemical reactions, simultaneous synthesis or assembly is possible .
Etant donnée la taille du segment de liaison (généralement de environ cinq à environ vingt résidus, pour un segment de nature peptidique), la version purement peptidique du lien L est de préférence obtenue par synthèse directe, en utilisant notamment les synthétiseurs de peptides courants et les méthodes classiques de synthèse, notamment en phase solide. L'avantage de la synthèse directe du lien est qu'elle autorise l'utilisation de résidus aminoacides non naturels permettant ainsi une meilleure adaptation de la séquence aux protéases intervenantes. Cette séquence de reconnaissance peut en outre être modifiée par rapport à la séquence naturelle de reconnaissance par une enzyme ou un facteur de clivage, par exemple pour lui conférer une meilleure affinité ou spécificité envers la protéase en question.Given the size of the linker segment (generally from about five to about twenty residues, for a segment of peptide nature), the purely peptide version of the L link is preferably obtained by direct synthesis, using in particular the common peptide synthesizers and conventional methods of synthesis, especially in solid phase. The advantage of the direct synthesis of the link is that it allows the use of non-natural amino acid residues thus allowing better adaptation of the sequence to the intervening proteases. This recognition sequence can also be modified with respect to the natural recognition sequence by an enzyme or a cleavage factor, for example to give it a better affinity or specificity towards the protease in question.
La longueur du segment de liaison peut être adaptée par l'homme du métier en fonction des besoins et de la nature des segments C et A. De manière générale, on utilise un
segment de liaison assez court et essentiellement non immunogène. Il s'agit typiquement d'un segment de nature peptidique comprenant de 3 à 20 résidus d'acides aminés, de préférence de 3 à 15, encore plus préférentiellement de 4 à 12. Dans certains cas, comme indiqué ci-après, il peut être intéressant de modifier la longueur du segment L, notamment pour éloigner la partie peptidique du segment C ou A, ou pour créer des molécules à fonction particulière (pénétration dans la cellule, action sur cellules voisines, etc.).The length of the link segment can be adapted by a person skilled in the art according to the needs and the nature of the segments C and A. In general, a Fairly short and essentially non-immunogenic linker. It is typically a segment of peptide nature comprising from 3 to 20 amino acid residues, preferably from 3 to 15, even more preferably from 4 to 12. In certain cases, as indicated below, it can be interesting to modify the length of the segment L, in particular to distance the peptide part from the segment C or A, or to create molecules with particular function (penetration in the cell, action on neighboring cells, etc.).
Ainsi, il peut y avoir avantage à ce que le lien L ou LO contienne une partie d'espacement pour éloigner le site de clivage (et la partie peptidique) du segment de ciblage C. Dans ce cas L ou LO peut prendre l'une des deux structures suivantes :Thus, it may be advantageous for the L or LO link to contain a spacing part in order to separate the cleavage site (and the peptide part) from the targeting segment C. In this case L or LO can take one of the following two structures:
L'l-L"l-L2 (F6A)L'l-L "l-L2 (F6A)
Ll-L"2-L'2 (F6B) où, dans l'un et l'autre cas :Ll-L "2-L'2 (F6B) where, in either case:
- L'1 est un groupe d'espacement non-peptidique et L"l la partie peptidique proprement dite ;- L'1 is a non-peptide spacing group and L "l is the peptide part proper;
- L'2 est un groupe d'espacement non-peptidique et L"2 la partie peptidique proprement dite.- L'2 is a non-peptide spacing group and L "2 the peptide part proper.
Le groupe d'espacement non peptidique peut être choisi parmi toute molécule chimique synthétique, de préférence stable chimiquement et peu immunogène. Il peut s'agir notamment d'un polymère, par exemple de type polyoxyéthylène, dextran, polyéthylèneimine, etc. Un exemple préféré est le polyoxyéthylène, fonctionnalisé ou non.The non-peptide spacer group can be chosen from any synthetic chemical molecule, preferably chemically stable and not very immunogenic. It may especially be a polymer, for example of the polyoxyethylene, dextran, polyethyleneimine, etc. type. A preferred example is polyoxyethylene, functionalized or not.
Dans les formules ci-dessus, L"l-L2 et Ll-L"2 peuvent représenter le même peptide. Par ailleurs, le nombre de résidus des segments peptidiques L"l-L2 ou Ll-L"2 peut varier de quatre à plus de vingt, la valeur optimale étant de l'ordre de six.In the above formulas, L "l-L2 and L1-L" 2 can represent the same peptide. Furthermore, the number of residues of the peptide segments L "l-L2 or Ll-L" 2 can vary from four to more than twenty, the optimal value being of the order of six.
Dans un exemple particulier de mise en œuvre, le segment de liaison clivable répond à la formule suivante :In a particular example of implementation, the cleavable link segment corresponds to the following formula:
L (ou LO) = -(CH2-CH2-0)m-(CH2)n-CO-L"l -L2 (F7A) L (ou LO) = Ll-L"2-NH-(CH2)n -(OCH2-CH2)m- (F7B) où m est un nombre entier supérieur ou égal à 0 et L" 1 et L"2 un peptide dont la séquence comprend au mois un site de clivage par une des protéases généralement présentes dans l'environnement ciblé. On notera que L"l-L2 et Ll-L"2 peuvent
représenter le même peptide. Le nombre de résidus des segments peptidiques L"l-L2 ou Ll-L"2 peut varier de quatre à plus de vingt, la valeur optimale étant de l'ordre de six.L (or LO) = - (CH 2 -CH 2 -0) m - (CH 2 ) n -CO-L "l -L2 (F7A) L (or LO) = Ll-L" 2-NH- (CH 2 ) n - (OCH 2 -CH2) m - (F7B) where m is an integer greater than or equal to 0 and L "1 and L" 2 a peptide whose sequence includes at least one site of cleavage by one of the proteases generally present in the target environment. Note that L "l-L2 and Ll-L" 2 can represent the same peptide. The number of residues of the peptide segments L "l-L2 or Ll-L" 2 can vary from four to more than twenty, the optimal value being of the order of six.
On présente dans les exemples suivants un ensemble de séquences peptidiques pour L"l- L2 ou Ll-L"2 répondant aux divers critères donnés dans l'ensemble du texte qui précède :We present in the following examples a set of peptide sequences for L "l-L2 or Ll-L" 2 meeting the various criteria given in all of the above text:
J-n— J0-B1-B2-J3— Jc (S6) où :J-n— J0-B1-B2-J3— Jc (S6) where:
* J-O-J0-B1 représente indifféremment les segments L"l et Ll ;* JOJ 0 -B 1 indifferently represents the segments L "l and Ll;
* B2-J3-Jc représente indifféremment les segments L2 et L" 2 ; * la liaison peptidique B1-B2 est la liaison clivée par les protéases intervenantes.* B 2 -J 3 -Jc indifferently represents the segments L2 and L "2; * the peptide bond B 1 -B 2 is the bond cleaved by the intervening proteases.
* n et c peuvent varier de 0 à environ 10 et dépendent de l'extrémité choisie pour la liaison au segment A ; pour l'extrémité liée à A, la valeur de n ou c sera faible et de préférence égale à 0 (J3 seulement présent) et pour l'extrémité opposée la valeur de n ou c n'est pas limitée et les résidus correspondants seront choisis en fonction de la spécificité des protéases intervenantes ciblées.* n and c can vary from 0 to around 10 and depend on the end chosen for the connection to segment A; for the end linked to A, the value of n or c will be low and preferably equal to 0 (J 3 only present) and for the opposite end the value of n or c is not limited and the corresponding residues will be chosen according to the specificity of the targeted intervening proteases.
Le tableau suivant donne un exemple d'ensemble de séquences B1-B2 reconnues et clivées par les différentes protéases intervenantes et utilisables préférablement pour un segment L clivable : Tableau 2The following table gives an example of a set of sequences B 1 -B 2 recognized and cleaved by the different proteases involved and usable preferably for a cleavable L segment: Table 2
Les séquences J-1-J0 et J3-J4 qui encadrent le site de clivage B1-B2 interviennent dans les interactions du lien avec la protéase visée et donc sur la vitesse de la réaction enzymatique
de coupure de la liaison B1-B2. Les résidus J-i, J0, J3 et J4 de S5 seront avantageusement choisis dans les ensembles suivants : J-i = résidu polaire de préférenceThe sequences J- 1 -J 0 and J 3 -J 4 which frame the cleavage site B 1 -B 2 are involved in the interactions of the link with the targeted protease and therefore on the speed of the enzymatic reaction to cut the link B 1 -B 2 . The residues Ji, J 0, J 3 and J 4 of S5 will advantageously be chosen from the following sets: Ji = polar residue preferably
Jo = GIy, AIa, Leu, Ile, Val, Phe et tout résidu aminoacide non naturel hydrophobe. J3 = GIy, AIa, Leu, He, Val, PheJo = GIy, AIa, Leu, Ile, Val, Phe and any hydrophobic non-natural amino acid residue. J 3 = GIy, AIa, Leu, He, Val, Phe
J4 = GIy, AIa, Leu, Ile, Val, Phe ou tout résidu non-naturel hydrophobe ou absentJ 4 = GIy, AIa, Leu, Ile, Val, Phe or any hydrophobic or absent non-natural residue
Les autres résidus, J-2~J-n et J5~Jc peuvent être n'importe quel résidu aminoacide naturel ou non naturel selon les besoins.The other residues, J-2 ~ J-n and J5 ~ Jc can be any natural or unnatural amino acid residue as required.
D'autre part, la longueur et/ou les propriétés du segment de liaison peuvent être ajustées, par exemple pour construire une molécule permettant au composé thérapeutique A d'interagir avec ou de pénétrer dans une cellule voisine de la cellule cible sur laquelle le segment C la conduit. Dans ce cas, par exemple, le segment de liaison L: - doit être suffisamment long pour atteindre les cellules voisines. Pour ce type de lien on choisit de préférence un oligomère chimique, par exemple de type polyoxyéthylène, comprenant un nombre suffisant de monomères pour que la longueur du lien soit d'environ 80 à 200 angstrôm, typiquement de 130 à 150 angstrôm; et/ou - comprend un domaine permettant ou facilitant le passage de A dans la membrane cellulaire et, le cas échéant, une région de clivage sensible aux enzymes intra-cellulaires.On the other hand, the length and / or the properties of the linking segment can be adjusted, for example to construct a molecule allowing the therapeutic compound A to interact with or to penetrate into a cell neighboring the target cell on which the segment C leads her. In this case, for example, the link segment L: - must be long enough to reach neighboring cells. For this type of link, a chemical oligomer, for example of the polyoxyethylene type, is preferably chosen, comprising a sufficient number of monomers so that the length of the link is approximately 80 to 200 angstroms, typically 130 to 150 angstroms; and / or - comprises a domain allowing or facilitating the passage of A through the cell membrane and, where appropriate, a cleavage region sensitive to intracellular enzymes.
Dans ce mode de réalisation, le lien possède avantageusement l'une des deux structures suivantes :In this embodiment, the link advantageously has one of the following two structures:
L ou LO ≈ LE-LTM-L3-A (F9A)L or LO ≈ LE-LTM-L3-A (F9A)
L ou L0 = A-L3-LMT-LE (F9B) où LE est une partie essentiellement extracellulaire du lien, LTM une partie trans- membranaire et L3 une fonction ou un élément clivable par les protéases ou les estérases intra-cellulaires (e.g., cytosoliques).L or L0 = A-L3-LMT-LE (F9B) where LE is an essentially extracellular part of the link, LTM a transmembrane part and L3 a function or element cleavable by proteases or intra-cellular esterases (eg, cytosolic).
La partie LE est préférentiellement suffisamment hydrophile pour permettre une solvatation convenable en milieu aqueux afin d'obtenir une structure suffisamment étendue.
La partie LTM, d'une longueur au moins égale à environ 40 Â, être préférentiellement suffisamment amphiphile pour que, d'une part, sa structure dans le milieu aqueux extracellulaire reste faiblement compacte et que, d'autre part, elle puisse traverser le milieu hydrophobe de la membrane plasmique.The LE part is preferably sufficiently hydrophilic to allow suitable solvation in an aqueous medium in order to obtain a sufficiently extensive structure. The LTM part, of a length at least equal to about 40 Å, preferably be sufficiently amphiphilic so that, on the one hand, its structure in the extracellular aqueous medium remains weakly compact and that, on the other hand, it can cross the hydrophobic medium of the plasma membrane.
La composition chimique de LE et LMT pourra par exemple être la suivante : LE = -[O-(CH2)P-O]- (F 10)The chemical composition of LE and LMT could for example be as follows: LE = - [O- (CH2) P -O] - (F 10)
LMT = -[O-(CH2)q-O]- (Fl 1) où q et p sont des nombres entiers différents de 0, q >p de telle sorte que, pour LMT, l'environnement lipidique de la membrane soit au plan énergétique plus favorable que l'environnement aqueux. Les valeurs p = 2 et 5 > q > 3 sont préférables.LMT = - [O- (CH2) q -O] - (Fl 1) where q and p are whole numbers different from 0, q> p so that, for LMT, the lipid environment of the membrane is at more favorable energy plan than the aqueous environment. The values p = 2 and 5>q> 3 are preferable.
Comme indiqué précédemment, l'élément de ciblage peut être synthétisé par des techniques connues en soi de la chimie ou de la biologie. L'élément C-L constitue par ailleurs un objet particulier de l'invention.As indicated above, the targeting element can be synthesized by techniques known per se from chemistry or biology. The element C-L also constitutes a particular object of the invention.
Segment Thérapeutique ATherapeutic segment A
L'invention peut être mise en œuvre avec tout type de molécule thérapeutique susceptible d'être associé au segment C. Il peut s'agir de composés chimiques, de médicaments, petites molécules, etc.) de composés peptidiques, nucléiques, lipidiques, etc.The invention can be implemented with any type of therapeutic molecule capable of being associated with the C segment. They may be chemical compounds, drugs, small molecules, etc.) of peptide, nucleic, lipid, etc. compounds. .
D'une façon générale, le segment thérapeutique A est une molécule présentant une activité biologique. De préférence, cette activité biologique est réduite (ou inexistante) lorsque le segment thérapeutique est lié aux segments de liaison L et de ciblage C. De ce fait, l'activité biologique s'exprime surtout dans l'environnement des tissus pathologiques, après ciblage et clivage in vivo.In general, therapeutic segment A is a molecule exhibiting biological activity. Preferably, this biological activity is reduced (or nonexistent) when the therapeutic segment is linked to the L-binding and targeting C segments. Therefore, the biological activity is expressed mainly in the environment of pathological tissues, after targeting. and cleavage in vivo.
Les composés thérapeutiques peuvent avoir des propriétés variées, dans des domaines thérapeutiques variés. Il peut s'agir de médicaments déjà connus, ou de molécules nouvelles ou en développement. Il peut s'agir de composés dont le mode d'action implique une pénétration dans les cellules ou dont l'action implique uniquement une interaction à la
surface de la membrane plasmique. Les composés A préférés de l'invention sont des antitumoraux ou anti-inflammatoires.Therapeutic compounds can have various properties, in various therapeutic fields. These may be already known drugs, or new or developing molecules. They may be compounds whose mode of action involves penetration into cells or whose action only involves interaction with the surface of the plasma membrane. The preferred compounds A of the invention are anti-tumor or anti-inflammatory.
Composés anti-tumoraux Dans un mode de réalisation particulier, la molécule biologiquement active présente des propriétés anti-tumorales. A peut être n'importe quelle molécule anti-tumorale ou un dérivé actif de ces mêmes molécules. La seule contrainte est que ces composés antitumoraux puissent être liés chimiquement au reste de la molécule de vectorisation.Anti-tumor compounds In a particular embodiment, the biologically active molecule has anti-tumor properties. A can be any anti-tumor molecule or an active derivative of these same molecules. The only constraint is that these anti-tumor compounds can be linked chemically to the rest of the vectorization molecule.
Comme il a été décrit plus haut, A peut être libérée dans le milieu extra-cellulaire et diffuser de façon passive ou active à l'intérieur des cellules voisines ou bien être amenée dans ces cellules par un lien du type LE-LMT puis libérée par l'action de protéases ou estérases endogènes.As described above, A can be released into the extracellular medium and passively or actively diffuse inside neighboring cells or else be brought into these cells by a link of the LE-LMT type and then released by the action of endogenous proteases or esterases.
Un exemple de composé anti-tumoral est constitué par les molécules de la famille des antracyclines et de leurs dérivés.An example of an anti-tumor compound is constituted by the molecules of the antracycline family and their derivatives.
Ces molécules d'antracycline comportent un sucre aminé. Le groupe amino est avantageusement utilisé pour la liaison au segment L (par exemple à la partie L2 ou LMT) du lien défini plus haut .These antacycline molecules contain an amino sugar. The amino group is advantageously used for the link to the L segment (for example to the L2 or LMT part) of the link defined above.
Un autre exemple de composé anti-tumoral est constitué par les molécules de la famille des TNFα ou dérivés de ceux-ci. Ces molécules agissent sur des récepteurs de surface des cellules et induisent l'apoptose.Another example of an anti-tumor compound is constituted by molecules of the TNFα family or derivatives thereof. These molecules act on cell surface receptors and induce apoptosis.
Parmi les molécules de la famille des TNFα, le facteur TRAIL ou Aρo2L (P_W19777) est probablement le plus intéressant dans la mesure où les cellules normales semblent protégées de son action alors que les cellules tumorales y sont sensibles et peuvent être sélectivement éliminées par l'action de cette cytokine pro-apoptotique. Ce facteur peu donc être très utile dans les cancers dit « solides » ce qui implique un ciblage efficace pour éviter au maximum les effets secondaires dus à la présence de ces molécules dans le milieu sanguin. Comme toutes les molécules de la famille du TNF, TRAIL est initialement une protéine membranaire associée en trimère et seule la partie extracellulaire est active. Cette partie extracellulaire, TRAIL-Do, ou un ensemble contenant TRAIL-Do, peut donc être
ciblé grâce au segment C et libéré dans l'espace inter-cellulaire grâce à l'action des protéases intervenantes sur le lien clivable L qui relie C et TRAIL-Do. La molécule thérapeutique ainsi constituée possède la structure suivante :Among the molecules of the TNFα family, the factor TRAIL or Aρo2L (P_W19777) is probably the most interesting since normal cells seem to be protected from its action whereas tumor cells are sensitive to it and can be selectively eliminated by it. action of this pro-apoptotic cytokine. This factor can therefore be very useful in so-called “solid” cancers, which implies effective targeting to avoid as much as possible the side effects due to the presence of these molecules in the blood. Like all molecules of the TNF family, TRAIL is initially a membrane protein associated in trimer and only the extracellular part is active. This extracellular part, TRAIL-Do, or a set containing TRAIL-Do, can therefore be targeted thanks to the C segment and released in the inter-cellular space thanks to the action of proteases intervening on the cleavable link L which connects C and TRAIL-Do. The therapeutic molecule thus constituted has the following structure:
C-L' 1 -L" 1 -L2-( TRAIL-Do) (selon la formule F6A) (TRAIL-Do)-Ll -L' '2-U2-C (selon la formule F6B)C-L '1 -L "1 -L2- (TRAIL-Do) (according to formula F6A) (TRAIL-Do) -Ll -L' '2-U2-C (according to formula F6B)
Un avantage de l'une ou l'autre de ces dispositions est que l'assemblage en trimère des molécules de la famille des TNF, nécessaire à la liaison à leurs récepteurs, est gêné par la présence des segments de ciblage et de liaison. Ainsi la molécule reste faiblement active tant que le lien n'est pas clivé par une protéase intervenante. Pour bénéficier de cet avantage particulier il faut que le lien clivable ait une longueur suffisamment faible tout en conservant une accessibilité convenable aux protéases intervenantes.An advantage of one or the other of these provisions is that the trimer assembly of the molecules of the TNF family, necessary for binding to their receptors, is hampered by the presence of the targeting and binding segments. Thus the molecule remains weakly active as long as the link is not cleaved by an intervening protease. To benefit from this particular advantage, the cleavable link must have a sufficiently short length while retaining suitable accessibility to the intervening proteases.
Un autre exemple de cytokine, très intéressante pour le traitement de certains cancers et notamment le mélanome et le gliome intracrânien, est PInterleukine-4 (IL4, 1310839). Malheureusement, étant donnés ses effets secondaires importants, cette protéine ne peut pas être utilisée sans être convenablement ciblée. La liaison à un segment de ciblage C de l'IL4 humaine ou de l'une de ses isoformes ou encore d'un ensemble contenant l'une de ces protéines, par l'intermédiaire d'un segment clivable permet de constituer une molécule thérapeutique intéressante en oncologie :Another example of a cytokine, which is very interesting for the treatment of certain cancers and in particular melanoma and intracranial glioma, is Interleukin-4 (IL4, 1310839). Unfortunately, given its significant side effects, this protein cannot be used without being properly targeted. The binding to a targeting segment C of human IL4 or one of its isoforms or of an assembly containing one of these proteins, via a cleavable segment makes it possible to constitute a therapeutic molecule interesting in oncology:
C-L' 1 -L" 1 -L2-(IL4) (selon la formule F6 A)C-L '1 -L "1 -L2- (IL4) (according to formula F6 A)
(IL4)-L1 -L' '2-L'2-C (selon la formule F6B)(IL4) -L1 -L '' 2-L'2-C (according to formula F6B)
D'autres exemples de composés anti-tumoraux sont notamment :Other examples of anti-tumor compounds are in particular:
a) Le méthotrexate :
a) Methotrexate:
Le méthotrexate est un composé anti-tumoral couramment utilisé pour le traitement des tumeurs cancéreuses. Il s'agit d'un analogue de l'acide folique qui agit d'abord comme un faux substrat en inhibant la déhydrofolate réductase (DHFR). Il agit aussi par inhibition indirecte de la thymidilate synthétase (TS).Methotrexate is an anti-tumor compound commonly used for the treatment of cancerous tumors. It is an analogue of folic acid which first acts as a false substrate by inhibiting dehydrofolate reductase (DHFR). It also acts by indirect inhibition of thymidilate synthetase (TS).
Le méthotrexate contient un aminoacide, l'acide glutamique, qui peut être inséré dans l'extrémité N-terminale d'un peptide de lien clivable selon la formule (F6B) ou (F4B).Methotrexate contains an amino acid, glutamic acid, which can be inserted into the N-terminus of a cleavable link peptide according to the formula (F6B) or (F4B).
b) Le méthoxyestradiolb) Methoxyestradiol
Le 2-méthoxyestradiol (1,3,5 (10)-oestratriène-2,3,17β-triol 2-méthyl ether) appelé 2ME2, est un sous-produit du métabolisme des œstrogènes ayant la propriété de bloquer la croissance des cellules endothéliales en division rapide et des cellules tumorales.2-methoxyestradiol (1,3,5 (10) -oestratriene-2,3,17β-triol 2-methyl ether) called 2ME 2 , is a byproduct of the metabolism of estrogens having the property of blocking the growth of cells rapidly dividing endothelial cells and tumor cells.
c) les taxanes :c) taxanes:
Les molécules de cette famille ont pour effet le blocage du cycle cellulaire en G2 et M par leur action sur les cytosquelette microtubulaire. Il en résulte une inhibition de la réorganisation normale nécessaire au déroulement de l'interphase de la mitose.The molecules of this family have the effect of blocking the cell cycle in G2 and M by their action on the microtubular cytoskeleton. This results in an inhibition of the normal reorganization necessary for the progress of the interphase of mitosis.
Les taxanes, et particulièrement le docetaxel, comportent des fonctions utilisables pour des modifications permettant son incorporation à l'extrémité d'un peptide clivable par les protéases intervenantes de l'environnement tumoral.
Taxanes, and in particular docetaxel, contain functions which can be used for modifications allowing its incorporation at the end of a peptide cleavable by the proteases intervening in the tumor environment.
R1 = tBuOCO, R2 = H (docetaxel) R, = C6H5CO, R2 = Ac (paclitaxel)R 1 = tBuOCO, R 2 = H (docetaxel) R, = C 6 H 5 CO, R 2 = Ac (paclitaxel)
LES TAXANESTAXANES
d) les antipyrimidines sucre modifies :d) modified sugar antipyrimidines:
La cytosine arabinoside (Ara-C) ou cytarabine ou Aracytine est le représentant principal de cette famille. D'autres molécules de cette famille sont la difluoro-déoxy-cytidine (Gemcitabine).The cytosine arabinoside (Ara-C) or cytarabine or Aracytine is the main representative of this family. Other molecules in this family are difluoro-deoxy-cytidine (Gemcitabine).
e) Les agents alkylants :e) Alkylating agents:
Dérivés des « moutardes à l'azote », ces agents ont donné naissance à divers composés anti-tumoraux agissant sur les acides nucléiques et donc dans l'espace intra-cellulaire. Il s'agit en particulier le Melphalan et le Chlorambucil, deux agents alkylants bifonctionnels intéressant pour liaison aisée à un lien peptidique clivable.Derived from "nitrogen mustards", these agents have given rise to various anti-tumor compounds acting on nucleic acids and therefore in the intra-cellular space. These are in particular Melphalan and Chlorambucil, two bifunctional alkylating agents of interest for easy bonding to a cleavable peptide bond.
Le Melphalan est la Phenylalanine-Moutarde (L-PAM) est aminoacide non naturel qui peut être introduit facilement au début ou à la fin de la synthèse peptidique d'un lien clivable par protéases intervenantes :Melphalan is Phenylalanine-Mustard (L-PAM) is an unnatural amino acid which can be introduced easily at the beginning or at the end of the peptide synthesis of a cleavable link by intervening proteases:
Le Chlorambucil ne comporte qu'une fonction carboxylique et ne pourra être introduit directement dans un peptide qu'en fin de synthèse du lien peptidique clivable par les protéases intervenantes et à l'extrémité N-terminale. Chlorambucil only has a carboxylic function and can only be introduced directly into a peptide at the end of synthesis of the peptide link cleavable by the intervening proteases and at the N-terminal end.
Par l'utilisation d'un segment de lien bivalent comme Péthanolamine ou le diamino- éthane, ce composé pourra aussi être introduit à l'extrémité C-terminale du lien peptidique clivable.By the use of a bivalent link segment such as ethanolamine or diaminoethane, this compound can also be introduced at the C-terminal end of the cleavable peptide link.
Dans les deux cas la molécule libérée dans l'environnement tumoral est un dérivé aminoacide hydrophobe comme par exemple le Leu-Melphalan ou le Chlorambucil-Leu. Ces composés peuvent traverser facilement de façon passive la membrane plasmique des cellules tumorales et agir sur les acides nucléiques soit directement puisque la fonction alkylante n'est pas modifiée soit après clivage de l' aminoacide supplémentaire par les peptidases ou estérases endogènes.In both cases, the molecule released in the tumor environment is a hydrophobic amino acid derivative such as, for example, Leu-Melphalan or Chlorambucil-Leu. These compounds can easily passively pass through the plasma membrane of tumor cells and act on nucleic acids either directly since the alkylating function is not modified or after cleavage of the additional amino acid by endogenous peptidases or esterases.
Composés anti-inflammatoiresAnti-inflammatory compounds
Dans un autre mode de réalisation particulier, la molécule biologiquement active présente des propriétés anti-inflammatoires.In another particular embodiment, the biologically active molecule has anti-inflammatory properties.
Libération depeptides dérivés du segment N-terminal de l'annexine I.Release of peptides derived from the N-terminal segment of annexin I.
Un exemple dé tels composés est un peptide, nommé ici NTAl, aux propriétés anti- inflammatoires identique à ou dérivé du segment N-terminal de l'annexine I. Les propriétés anti-inflammatoires de ce peptide résultent probablement de son action sur le récepteur du fMLP inhibant ainsi que le chimiotactisme et l'activation des cellules phagocytaires et en particulier leur dégranulation et leur production de métabolites toxiques de l'oxygène.
La séquence du segment N-terminal de l'annexine I humaine est la suivante :An example of such compounds is a peptide, named here NTAl, with anti-inflammatory properties identical to or derived from the N-terminal segment of annexin I. The anti-inflammatory properties of this peptide probably result from its action on the receptor of the fMLP thus inhibiting the chemotaxis and the activation of phagocytic cells and in particular their degranulation and their production of toxic oxygen metabolites. The sequence of the N-terminal segment of human annexin I is as follows:
AMVSEFLKQAWFIENEEQEYVQTVKSSKGGP ( SEQ ID NO 33 )AMVSEFLKQAWFIENEEQEYVQTVKSSKGGP (SEQ ID NO 33)
Dans un mode plus général de réalisation, le peptide anti-inflammatoire dérivé du segment N-terminal de l'annexine I sera avantageusement choisi parmi les séquences suivantes :In a more general embodiment, the anti-inflammatory peptide derived from the N-terminal segment of annexin I will advantageously be chosen from the following sequences:
1 5 10 15 20 25 301 5 10 15 20 25 30
I I I I I I I AMVSEFLKQAWFhaNpEQEYhpoVKooKGGP (S7) (SEQ ID No 34) IN YYIE E DCVQTTQSSHVV C LD Q IKSS TYS M L NC CVP EA GGI I I I I I I AMVSEFLKQAWFhaNpEQEYhpoVKooKGGP (S7) (SEQ ID No 34) IN YYIE E DCVQTTQSSHVV C LD Q IKSS TYS M L NC CVP EA GG
La séquence soulignée représente une séquence dite consensus possédant les propriétés anti-inflammatoires recherchées. Sous chaque résidu variable de cette séquence est indiquée une liste de résidus pouvant remplacer celui indiqué dans la séquence consensus : a résidu acide ; h résidu hydrophobe ; p résidu polaire ; o Thr ou Ser de préférence.The underlined sequence represents a so-called consensus sequence having the desired anti-inflammatory properties. Under each variable residue of this sequence is indicated a list of residues which can replace that indicated in the consensus sequence: an acid residue; h hydrophobic residue; p polar residue; o Thr or Ser preferably.
II est également possible de choisir une séquence plus courte pour NTAl. On peut ainsi supprimer les huit à treize premiers résidus. On pourra utiliser en particulier utiliser la séquence :It is also possible to choose a shorter sequence for NTA1. We can thus remove the first eight to thirteen residues. We can use in particular the sequence:
ENEEQEYVQTVKSSKGGP (SEQ ID NO 35 ) (S8)ENEEQEYVQTVKSSKGGP (SEQ ID NO 35) (S8)
Toutes les mutations correspondant à ce fragment et indiquées pour la séquence (S7) seront utilisables dans la séquence S8.All mutations corresponding to this fragment and indicated for the sequence (S7) will be usable in the S8 sequence.
II existe dans l'environnement inflammatoire au moins une protéase susceptible de cliver spécifiquement le segment NTAl au niveau de l'un des deux résidus Lysine 25 ou 28 présents dans sa partie N-terminale -Thr-Val-Lys-Ser-Ser-Lys-Gly-Gly-, Ces protéases sont normalement responsables de la libération in vivo du segment N-terminal de l'annexine I.There exists in the inflammatory environment at least one protease capable of specifically cleaving the NTAl segment at the level of one of the two residues Lysine 25 or 28 present in its N-terminal part -Thr-Val-Lys-Ser-Ser-Lys -Gly-Gly-, These proteases are normally responsible for the in vivo release of the N-terminal segment of annexin I.
Dans un premier mode simple de réalisation, le peptide NTAl ou une version judicieusement mutée est simplement intégré à la partie N-terminale du segment C pour
l'In a first simple embodiment, the NTA1 peptide or a judiciously mutated version is simply integrated into the N-terminal part of the C segment for the
former la protéine thérapeutique : NTAl-C. Le segment C est pris ici dans son acceptation la plus large et définie plus haut.form the therapeutic protein: NTAl-C. Segment C is taken here in its widest sense and defined above.
Dans un second mode de réalisation, le peptide NTAl ou une version judicieusement mutée est relié au segment C par l'intermédiaire d'un lien simple clivable par une protéases intervenantes selon la formule F6A ou F6B ou d'un lien multiple comportant un élément de ramification D comme défini plus haut (F5A, F5B).In a second embodiment, the NTA1 peptide or a judiciously mutated version is linked to the C segment via a simple link cleavable by an intervening proteases according to the formula F6A or F6B or a multiple link comprising an element of branch D as defined above (F5A, F5B).
Dans un autre mode de réalisation, la partie A peut aussi contenir une répétition de l'une des séquences choisi pour le segment NTAl afin d'augmenter la concentration locale du peptide anti-inflammatoire et donc son efficacité.In another embodiment, part A can also contain a repetition of one of the sequences chosen for the NTA1 segment in order to increase the local concentration of the anti-inflammatory peptide and therefore its effectiveness.
(NTAl)1n-C (F2)(NTAl) 1n -C (F2)
Pour optimiser le comportement in vivo de la molécule thérapeutique, on choisira de préférence m = 2.To optimize the in vivo behavior of the therapeutic molecule, we will preferably choose m = 2.
Dans un autre mode de réalisation, il peut être avantageux de lier le segment NTAl à l'extrémité C-terminale du segment C. Pour cette réalisation, on utilisera un lien bifonctionnel de façon à relier entre elles les extrémité C-terminales de C et NTAl : C-L-NTAlIn another embodiment, it may be advantageous to link the NTAl segment to the C-terminal end of the C segment. For this embodiment, a bifunctional link will be used so as to connect the C-terminal ends of C and NTAl: CL-NTAl
Libération de Cytokines anti-inflammatoires.Release of anti-inflammatory cytokines.
Les maladies inflammatoires chroniques, et particulièrement la polyarthrite rhumatoïde, la maladie de Crohn et le Psoriasis, sont provoquées par un déséquilibre important dans la production dans l' environnement cellulaire d'un certain nombre de molécules de signalisation. L'amplification et la pérennisation du phénomène inflammatoire dans ces maladies résultent d'un équilibre complexe entre un nombre important de protéines aux influences opposées, molécules pro-inflammatoires et molécules anti-inflammatoires.Chronic inflammatory diseases, particularly rheumatoid arthritis, Crohn's disease and Psoriasis, are caused by a large imbalance in the production in the cellular environment of a number of signaling molecules. The amplification and sustainability of the inflammatory phenomenon in these diseases results from a complex balance between a large number of proteins with opposite influences, pro-inflammatory molecules and anti-inflammatory molecules.
Parmi les cytokines jouant un rôle anti-inflammatoire, l'interleukine 10 (ILlO) (SwissProt, P22301), ou sur l'une quelconque de ses isoformes, est la plus intéressante par l'effet régulateur qu'elle produit sur la réaction inflammatoire. Mais comme beaucoup de molécules de la signalisation de la réaction inflammatoire, ILlO possède de multiples
fonctions dont des fonctions de stimulation du système immunitaire. Il est donc très avantageux de cibler cette protéine au site inflammatoire proprement dit de façon à localiser strictement son action.Among the cytokines playing an anti-inflammatory role, interleukin 10 (IL10) (SwissProt, P22301), or on any of its isoforms, is the most interesting by the regulatory effect it produces on the inflammatory reaction . But like many signaling molecules for the inflammatory response, IL10 has multiple functions including functions of stimulation of the immune system. It is therefore very advantageous to target this protein at the inflammatory site proper so as to strictly localize its action.
L' ILlO agit en tant qu'homodimère sur son récepteur hétéro tétramérique. La structure tridimensionnelle de PILlO et du complexe avec son récepteur, PILlOR, offre un avantage supplémentaire. En effet, la structure du complexe ILlO-ILlOR, montre que les extrémités N et C-terminale de PILlO sont relativement proches dans sa structure. De plus l'extrémité N-terminale est enfouie au cœur du récepteur et l'extrémité C-terminale est située dans la région de dimérisation de cette cytokine. De ce fait, le blocage par le segment C-L ou L-C de l'une des extrémités N ou C-terminale de PILlO, interdit la formation du complexe et finalement bloque son action. L'activation de PILlO ne peut donc se faire que par l'action des protéases intervenantes de l'environnement inflammatoire qui ont pour effet de libérer cette cytokine exclusivement dans cet environnement. Le même raisonnement peut être appliqué à une autre cytokine anti-inflammatoire, P IL 13 (P35225) ou à l'une de ses isoformes.IL10 acts as a homodimer on its hetero tetrameric receptor. The three-dimensional structure of PILlO and the complex with its receptor, PILlOR, offers an additional advantage. Indeed, the structure of the IL10-IL10OR complex shows that the N and C-terminal ends of PIL10 are relatively close in structure. In addition, the N-terminal end is buried in the heart of the receptor and the C-terminal end is located in the dimerization region of this cytokine. Therefore, blocking by the C-L or L-C segment of one of the N or C-terminal ends of PIL10, prohibits the formation of the complex and finally blocks its action. The activation of PIL10 can therefore only be done by the action of proteases intervening in the inflammatory environment which have the effect of releasing this cytokine exclusively in this environment. The same reasoning can be applied to another anti-inflammatory cytokine, P IL 13 (P35225) or to one of its isoforms.
La molécule thérapeutique basée sur PILlO ou PILl 3 possède l'une des structures générales suivantes, selon le choix fait pour le positionnement de PILlO ou de PIL13 : C-L' 1 -L" 1 -L2-(IL10/IL13) (selon la formule F6A) (ILl 0/IL13)-Ll -V '2-L'2-C (selon la formule F6B)The therapeutic molecule based on PILlO or PILl 3 has one of the following general structures, depending on the choice made for the positioning of PILlO or PIL13: CL '1 -L "1 -L2- (IL10 / IL13) (according to the formula F6A) (ILl 0 / IL13) -Ll -V '2-L'2-C (according to formula F6B)
Le site de clivage des protéases intervenantes est prévu entre L"l et L"l ou entre L"2 et L'2. La longueur du segment résiduel L"l-L2 ou Ll-L"2 est telle qu'elle ne gêne pas la formation du complexe IL10-1L10R ou IL13-lL13Rαl/2. Il est aisé d'ajuster la séquence effective de PILlO pour satisfaire cette contrainte. Dans l'un et l'autre cas le segment Ll ou L2 peut être absent.The cleavage site of the intervening proteases is provided between L "l and L" l or between L "2 and L'2. The length of the residual segment L" l-L2 or Ll-L "2 is such that it does not interfere not the formation of the IL10-1L10R or IL13-IL13Rαl / 2 complex It is easy to adjust the effective sequence of PIL10 to satisfy this constraint In either case the L1 or L2 segment may be absent.
Libération d'inhibiteurs de Cytokines pro-inflammatoires. Le segment thérapeutique A peut être sélectionné parmi les inhibiteurs non activants des récepteurs membranaires des cytokines pro-inflammatoires.Release of pro-inflammatory Cytokine inhibitors. Therapeutic segment A can be selected from non-activating inhibitors of membrane receptors for pro-inflammatory cytokines.
Il existe des inhibiteurs naturels de certaines cytokines et notamment de Pinterleukine 1 (ILl), une cytokine pro-inflammatoire dont l'incidence dans les maladies inflammatoires vient immédiatement après celle du TNFα qui est la cytokine dont le rôle est central.
L'inhibiteur soluble du récepteur de PILl, PILlR, est une petite protéine, le sILIRa (Swiss-Prot P18510), qui agit en se liant au ILlR ans l'activer, bloquant ainsi de PILl. L'efficacité du sILIRa a été testée dans divers maladies et en particulier dans l'arthrite rhumatoïde et se montre relativement actif. Cependant les doses utilisées chez les malades en injections sous cutanées sont énormes, de 30mg à 150mg. La pharmacocinétique est par ailleurs défavorable puisque le temps de demie- vie dans la circulation n'est que de 21 min, ce qui est très faible pour une utilisation thérapeutique dans le cas de l'arthrite rhumatoïde.There are natural inhibitors of certain cytokines and in particular of interleukin 1 (IL1), a pro-inflammatory cytokine whose incidence in inflammatory diseases comes immediately after that of TNFα which is the cytokine whose role is central. The soluble inhibitor of the PIL1 receptor, PILlR, is a small protein, sILIRa (Swiss-Prot P18510), which works by binding to ILlR and activating it, thereby blocking PILl. The efficacy of sILIRa has been tested in various diseases and in particular in rheumatoid arthritis and has been shown to be relatively active. However, the doses used in patients under subcutaneous injections are enormous, from 30mg to 150mg. The pharmacokinetics is also unfavorable since the half-life time in the circulation is only 21 min, which is very short for therapeutic use in the case of rheumatoid arthritis.
Comme précédemment pour PILlO, l'ensemble C-L-(ILlRa) ou (ILlRa)-L-C est totalement inactif. En effet, la structure du complexe ILlRa-ILlR montre que les extrémités N et C-terminale de PILlRa sont très proches dans la structure et sont enfouies au cœur du récepteur. De ce fait, l'activation de l'inhibiteur ne peut se faire que par l'action des protéases intervenantes de l'environnement inflammatoire qui ont pour effet de libérer l'inhibiteur exclusivement dans cet environnement.As previously for PIL10, the C-L- (ILlRa) or (ILlRa) -L-C group is completely inactive. Indeed, the structure of the ILlRa-ILlR complex shows that the N and C-terminal ends of PILlRa are very close in structure and are buried at the heart of the receptor. Therefore, the activation of the inhibitor can only be done by the action of proteases intervening in the inflammatory environment which have the effect of releasing the inhibitor exclusively in this environment.
La molécule thérapeutique basée sur PILlRa ou sur l'une quelconque de ses isoformes, possède l'une des structures générales suivantes, selon le choix fait pour le positionnement de PILlRa :The therapeutic molecule based on PILlRa or on any of its isoforms has one of the following general structures, depending on the choice made for the positioning of PILlRa:
C-L' 1 -L" 1 -L2-(ILlRa) (selon la formule F6A) (ILl Ra)-Ll -L' '2-L'2-C (selon la formule F6B)C-L '1 -L "1 -L2- (ILlRa) (according to formula F6A) (ILl Ra) -Ll -L' '2-L'2-C (according to formula F6B)
Le site de clivage des protéases intervenantes est prévu entre L"l et L"l ou entre L" 2 et L'2. La longueur du segment résiduel L"l-L2 ou Ll-L"2 est telle qu'elle ne gêne pas la formation du complexe ILl-ILlRa. Comme pour PILlO, il est aisé d'ajuster la séquence effective de PILlRa pour satisfaire cette contrainte. Dans l'un et l'autre cas le segment Ll ou L2 peut être absent.The cleavage site of the intervening proteases is provided between L "l and L" l or between L "2 and L'2. The length of the residual segment L" l-L2 or Ll-L "2 is such that it does not interfere not the formation of the IL1-ILlRa complex. As with PILlO, it is easy to adjust the effective sequence of PILlRa to satisfy this constraint. In either case, the L1 or L2 segment may be absent.
Libération de médicaments anti-inflammatoires.Release of anti-inflammatory drugs.
II existe de nombreuses molécules non peptidiques possédant des propriétés antiinflammatoires importantes comme les Glucocorticoïdes, les anti-inflammatoires non stéroïdiens (AINS), le Méthotrexate.
a) Les Glucocorticoïdes :There are many non-peptide molecules with important anti-inflammatory properties such as Glucocorticoids, non-steroidal anti-inflammatory drugs (NSAIDs), Methotrexate. a) Glucocorticoids:
Initialement, les Glucocorticoïdes sont des molécules hormonales naturelles produites par l'organisme et interviennent dans de nombreux processus physiologiques. Leur action est strictement intracellulaire et intervient par leur liaison à des récepteurs nucléaires induisant la transcription d'un certain nombre de gènes, d'où le rôle complexe de ces hormones à de multiples étapes de la réaction inflammatoire. L'utilisation des Glucocorticoïdes et de leurs dérivés non naturels comme médicament est donc toujours très délicate alors que leur efficacité peut être très grande. Leur ciblage et leur libération stricte dans l'environnement inflammatoire sont donc cruciaux.Initially, Glucocorticoids are natural hormonal molecules produced by the body and are involved in many physiological processes. Their action is strictly intracellular and intervenes by their binding to nuclear receptors inducing the transcription of a certain number of genes, hence the complex role of these hormones at multiple stages of the inflammatory reaction. The use of Glucocorticoids and their non-natural derivatives as a medicine is therefore always very delicate, while their effectiveness can be very great. Their targeting and strict release into the inflammatory environment is therefore crucial.
Les Glucocorticoïdes sont des molécules stéroïdiennes, donc assez hydrophobes, et leurs action s'effectue au niveau du noyau cellulaire après diffusion passive à travers la membrane plasmique. Pour une utilisation comme médicament ciblé, les Glucocorticoïdes peuvent donc être simplement libérés dans l'environnement inflammatoire.Glucocorticoids are steroid molecules, therefore quite hydrophobic, and their action takes place at the level of the cell nucleus after passive diffusion through the plasma membrane. For use as a targeted drug, Glucocorticoids can therefore simply be released into the inflammatory environment.
Toutes ces molécules comportent des fonctions chimiques, par exemple des groupes hydroxyles, permettant leur greffage sur des molécules peptidiques et en particulier sur un segment L clivable par des protéases intervenantes comme pour les composés anti- tumoraux.All of these molecules have chemical functions, for example hydroxyl groups, allowing their grafting on peptide molecules and in particular on an L segment cleavable by intervening proteases as for anti-tumor compounds.
La molécule thérapeutique basée sur les Glucocorticoïdes possède l'une des structures générales suivantes, selon le choix fait pour le positionnement de la molécule par rapport au segment de ciblage : C-L' 1 -L" 1 -L2-(0-Glucocorticoïde) (selon la formule F6 A) (Glucocorticoïde-0)-Ll-L' '2-L'2-C (selon la formule F6B)The Glucocorticoids-based therapeutic molecule has one of the following general structures, depending on the choice made for positioning the molecule with respect to the targeting segment: CL '1 -L "1 -L2- (0-Glucocorticoid) (according to formula F6 A) (Glucocorticoid-0) -Ll-L '' 2-L'2-C (according to formula F6B)
Sous cette forme ces molécules sont totalement inactives.In this form these molecules are completely inactive.
L'action des protéases intervenantes libère soit la molécule L"l-L2-(O-Glucocorticoïde) soit la molécule (Glucocorticoïde-O)-Ll-L"2, c'est à dire une pro-drogue qui doit diffuser passivement dans les cellules environnantes où elles seront traitées par les protéases et estérases endogènes pour libérer finalement la molécule active.
Dans cette application particulière de la présente invention, il est donc important que les segments L"l-L2 ou Ll-L"2 soit hydrophobes et les plus court possibles, compte tenu des capacités de clivage des protéases intervenantes. Il est avantageux de limiter à deux le nombre de résidus voire à un le nombre de résidus dans L"l ou L"2. Il peut être aussi avantageux de ne pas introduire les segment Ll ou L2.The action of the intervening proteases releases either the L "l-L2- (O-Glucocorticoid) molecule or the (Glucocorticoid-O) -Ll-L" 2 molecule, that is to say a pro-drug which must passively diffuse in the surrounding cells where they will be treated with endogenous proteases and esterases to finally release the active molecule. In this particular application of the present invention, it is therefore important that the segments L "l-L2 or Ll-L" 2 be hydrophobic and as short as possible, taking into account the cleavage capacities of the intervening proteases. It is advantageous to limit the number of residues to two or even to one the number of residues in L "l or L" 2. It may also be advantageous not to introduce the segments L1 or L2.
b) Les anti-inflammatoires non stéroïdiens :b) Non-steroidal anti-inflammatory drugs:
Les anti-inflammatoires non stéroïdiens forment une des classes de médicament les plus prescrits. Ce sont pour la plus part des inhibiteurs des cyclo-oxygénases (COX-I et COX- 2), des enzymes importantes intervenant dans le métabolisme de l'acide arachidonique. Ce sont des médicament généralement réservés au traitement des maladies inflammatoires sévères et utilisés à des doses généralement très élevées et donc génératrices d'effets secondaires indésirables. Parmi les AINS, il existe une classe de composés possédant une fonction carboxylique utilisable pour leur greffage sur des molécules peptidiques et en particulier sur un segment L clivable par des protéases intervenantes comme pour les composés anti-tumoraux ou anti-inflammatoires mentionnés plus haut. Parmi ces composés on mentionnera l'Aspirine, l'Olsalazine, le Diclofénac, l'Etodolac, le Sulindac, l'Idométacine, le Ténidap et l'ensemble des dérivés de l'acide propionique comme Plbuprofène, l'acide Tiaprofénique, le Naproxène, le Kétoprofène et d'une façon générale « profénides ». D'autres familles de composés sont aussi utilisables, les acides anthraniniliques et apparentés comprenant le groupe des fénamates comme l'acide méfénamique, le groupe des dérivés de l'acide nicotinique comme l'acide niflumique.One of the most prescribed classes of drugs is nonsteroidal anti-inflammatory drugs. They are mostly inhibitors of cyclooxygenases (COX-I and COX-2), important enzymes involved in the metabolism of arachidonic acid. These are drugs generally reserved for the treatment of severe inflammatory diseases and used in generally very high doses and therefore generating undesirable side effects. Among the NSAIDs, there is a class of compounds having a carboxylic function which can be used for their grafting on peptide molecules and in particular on an L segment cleavable by intervening proteases as for the anti-tumor or anti-inflammatory compounds mentioned above. Among these compounds, mention will be made of Aspirin, Olsalazine, Diclofenac, Etodolac, Sulindac, Idometacin, Tenidap and all of the propionic acid derivatives such as Plbuprofen, Tiaprofenic acid, Naproxen , Ketoprofen and generally "profenides". Other families of compounds are also usable, anthraninilic and related acids comprising the group of fenamates such as mefenamic acid, the group of derivatives of nicotinic acid such as niflumic acid.
Comme l'ensemble de ces composés anti-inflammatoires sont des acides carboxyliques, ils devront être fixés à l'extrémité N-terminale du lien peptidique clivable selon la formulation suivante :As all of these anti-inflammatory compounds are carboxylic acids, they must be attached to the N-terminal end of the cleavable peptide link according to the following formulation:
(AINS)-CONH-L' '2-L'2-C(NSAIDs) -CONH-L '' 2-L'2-C
Cette configuration est avantageuse en ce qu'elle permet l'introduction de la molécule d'AINS directement en fin de synthèse peptidique en phase solide du segment L"2-L'2. Dans ce mode de réalisation, le segment L"2 devra être suffisamment court et hydrophobe pour permettre la diffusion passive du segment actif (AINS)-CONH-L"2 à travers la membrane plasmique des cellules cibles.
Si, pour des raisons particulières, il est nécessaire d'utiliser l'extrémité C-terminale selon la formule : C-L'1-L"1-L2-(AINS), le segment L2 devra dans ce cas être bi-fonctionnel et hydrophobe comme par exemple l'aminoéthanol : L2 = H2N-CH2-CH2-OH.This configuration is advantageous in that it allows the introduction of the NSAID molecule directly at the end of solid phase peptide synthesis of the L "2-L'2 segment. In this embodiment, the L" 2 segment should be sufficiently short and hydrophobic to allow passive diffusion of the active segment (NSAID) -CONH-L "2 through the plasma membrane of the target cells. If, for particular reasons, it is necessary to use the C-terminal end according to the formula: C-L'1-L "1-L2- (NSAID), the L2 segment must in this case be bifunctional and hydrophobic such as for example aminoethanol: L2 = H 2 N-CH 2 -CH 2 -OH.
c) Le méthotrexatec) Methotrexate
Le méthotrexate possède également des propriétés anti-inflammatoires et peut être utilisé de la même façon que pour ses propriétés anti-tumorales décrites plus haut.Methotrexate also has anti-inflammatory properties and can be used in the same way as for its anti-tumor properties described above.
Réalisation d'inhibiteurs des récepteurs memhranaires de la famille des TNFR.Realization of inhibitors of memhran receptors of the TNFR family.
L'homotrimérisation stricte des domaines extracellulaires en l'absence du ligand est un élément important du fonctionnement correct des TNFR. Cette trimérisation du récepteur vide est assuré essentiellement par un segment N-terminal comprenant le domaine extracellulaire CRDl. Les interactions protéine-protéine sont très spécifiques et évitent ainsi la formation d'hétérotrimères dus à la présence de récepteurs différents à la surface d'une même cellule. On met à profit cette propriété pour produire de nouveaux inhibiteurs spécifiques de n'importe quelle protéines membranaires de la famille des TNFR.The strict homotrimerization of the extracellular domains in the absence of the ligand is an important element of the correct functioning of TNFRs. This trimerization of the empty receptor is essentially ensured by an N-terminal segment comprising the extracellular domain CRDl. Protein-protein interactions are very specific and thus avoid the formation of heterotrimers due to the presence of different receptors on the surface of the same cell. This property is used to produce new inhibitors specific for any membrane protein of the TNFR family.
Ces inhibiteurs utilisent un peptide, nommé ici PCRDX, comprenant au moins le domaine CRDl d'un TNFR quelconque X pour bloquer la trimérisation de celui-ci de façon très spécifique et donc bloquer sa fonction : en se liant à une sous unité membranaire du TNFR (monomère), le peptide PCRDX libre, sous la forme de monomère ou de dimère, bloque la trimérisarion de cette sous unité membranaire sans activer le récepteur puisque celui-ci ne peut plus acquérir sa structure trimérique.These inhibitors use a peptide, here called PCRDX, comprising at least the CRDl domain of any TNFR X to block the trimerization of the latter in a very specific manner and therefore block its function: by binding to a membrane subunit of TNFR (monomer), the free PCRDX peptide, in the form of monomer or dimer, blocks the trimerization of this membrane subunit without activating the receptor since the latter can no longer acquire its trimeric structure.
Dans un mode de réalisation simple, on pourra utiliser un peptide PCRDX, ou une version mutée de ce domaine, lié au segment C par un lien L1-L2 clivable par l'une des protéases intervenantes généralement présentes dans l'environnement inflammatoire de façon à ne libérer l'inhibiteur qu'au site inflammatoire ciblé. La structure générale de la molécule thérapeutique de la présente invention est donc :
C-L1-L2-PCRDX ou PCRDX-Ll -L2-C Où le clivage s'effectue entre Ll et L2.In a simple embodiment, it is possible to use a PCRDX peptide, or a mutated version of this domain, linked to the C segment by an L1-L2 link cleavable by one of the intervening proteases generally present in the inflammatory environment so as to release the inhibitor only at the targeted inflammatory site. The general structure of the therapeutic molecule of the present invention is therefore: C-L1-L2-PCRDX or PCRDX-Ll -L2-C Where the cleavage takes place between Ll and L2.
La structure C- L1-L2-PCRDX est directement active car elle laisse libre l'extrémité C- terminale du CRDl permettant sa liaison au CRDl d'un récepteur cellulaire.The C-L1-L2-PCRDX structure is directly active because it leaves the C-terminal end of CRDl free, allowing it to bind to CRDl of a cellular receptor.
La structure PCRDX- L1-L2-C possède l'avantage supplémentaire de ne rendre actif le segment CRDl que lorsque celui-ci est libéré par le clivage du segment L1-L2 limitant ainsi d'autant le risque d'effets secondaires. En effet dans cette configuration l'extrémité C-terminale du PCRDX est encombrée par la présence du segment L1-L2-C, inadapté à toute interaction avec un domaine extracellulaire d'un TNFR, rendant ainsi plus difficile sont interaction avec celui-ci. L'activité est recouvrée par le clivage du lien L1-L2.The PCRDX-L1-L2-C structure has the additional advantage of only making the CRDl segment active when it is released by cleavage of the L1-L2 segment, thereby limiting the risk of side effects accordingly. In fact, in this configuration, the C-terminal end of the PCRDX is congested by the presence of the L1-L2-C segment, unsuitable for any interaction with an extracellular domain of a TNFR, thus making its interaction more difficult. The activity is recovered by the cleavage of the link L1-L2.
La liste suivante donne des exemples de séquence minimum que doivent contenir les divers segments PCRDX possibles utilisables comme inhibiteur de la trimérisation du TNFRl et du TNFR2 :The following list gives examples of the minimum sequence that the various possible PCRDX segments must contain which can be used as an inhibitor of the trimerization of TNFR1 and TNFR2:
Inhibiteur du TNFRlTNFR1 inhibitor
DSVCPQGKYI HPQNNSICCT KCHKGTYLYN DCPGPGQDTD CRECESGSFT ASENHLRHCL SS ( SEQ ID No 36 )DSVCPQGKYI HPQNNSICCT KCHKGTYLYN DCPGPGQDTD CRECESGSFT ASENHLRHCL SS (SEQ ID No 36)
Inhibiteur du TNFR2TNFR2 inhibitor
PGTCRLREYY DQTAQMCCSK CSPGQHAKVF CTKTSDTVCD SCEDSTYTQL WNWVPECLSSPGTCRLREYY DQTAQMCCSK CSPGQHAKVF CTKTSDTVCD SCEDSTYTQL WNWVPECLSS
(SEQ ID No 37)(SEQ ID No 37)
Ces séquences peuvent être mutées, notamment dans la région d'interaction avec les récepteurs TNFRl et du TNFR2 originaux, afin d'augmenter leur affinité avec ces récepteurs.These sequences can be mutated, in particular in the region of interaction with the original TNFR1 and TNFR2 receptors, in order to increase their affinity with these receptors.
Des séquences analogues provenant de n'importe quel récepteur de cytokines de la famille des TNF peuvent être utilisées pour produire des inhibiteurs spécifiques de ces récepteurs.Analogous sequences from any TNF family cytokine receptor can be used to produce specific inhibitors for these receptors.
Le lien clivable L1-L2 peut être avantageusement choisi parmi les séquences peptidiques reconnues et clivées par les protéases spécifiques dont le rôle est de libérer la partie extracellulaire des TNFR membranaires ou des précurseurs membranaires des TNF. Ces protéases appartiennent à la famille des ADAM déjà mentionnées. Parmi ces protéases, on
choisira en particulier la protéase ADAM- 17 ou TACE spécifique de la libération du TNFα et du TNFβ (LTβ) et on choisira en conséquence la séquence du segment L1-L2 de telle sorte qu'il contienne l'une des séquence suivantes :The cleavable link L1-L2 can be advantageously chosen from the peptide sequences recognized and cleaved by specific proteases whose role is to release the extracellular part of the membrane TNFRs or of the membrane precursors of the TNFs. These proteases belong to the family of ADAMs already mentioned. Among these proteases, in particular, the ADAM-17 or TACE protease specific for the release of TNFα and TNFβ (LTβ) will be chosen and the sequence of the L1-L2 segment will therefore be chosen so that it contains one of the following sequences:
L1*L2 = SPLAQA*VRSSSR (SEQ ID No 38) ou fragments de celle-ci, PLAQ A* VRSSS (SEQ ID No 39), LAQA*VRSS (SEQ ID No 40), AQA*VRS (SEQ ID No 41), QA*VR (SEQ ID No 42), ou toute combinaison des groupes de séquences situées de part et d'autre du site de clivage marqué par une astérisque comme par exemple . PLAQA*VRS (SEQ ID No 43) ou AQA*VRSS (SEQ ID No 44), etc.L1 * L2 = SPLAQA * VRSSSR (SEQ ID No 38) or fragments thereof, PLAQ A * VRSSS (SEQ ID No 39), LAQA * VRSS (SEQ ID No 40), AQA * VRS (SEQ ID No 41) , QA * VR (SEQ ID No 42), or any combination of the groups of sequences located on either side of the cleavage site marked with an asterisk, for example. PLAQA * VRS (SEQ ID No 43) or AQA * VRSS (SEQ ID No 44), etc.
UTILISATIONS DES MOLECULES DE CIBLAGE ET DE LIBERATION DE COMPOSE THERAPEUTIQUEUSES OF THERAPEUTIC COMPOUND TARGETING AND RELEASING MOLECULES
Les molécules de l'invention peuvent être construites pour cibler différents types de cellules ou de tissus pathologiques, de préférence chez l'homme. Elles peuvent être utilisées pour la préparation de médicaments et/ou dans des méthodes de traitement thérapeutique.The molecules of the invention can be constructed to target different types of pathological cells or tissues, preferably in humans. They can be used for the preparation of medicaments and / or in methods of therapeutic treatment.
Ainsi, un objet particulier de l'invention consiste en une composition pharmaceutique comprenant une molécule chimère telle que définie ci-avant.Thus, a particular object of the invention consists of a pharmaceutical composition comprising a chimeric molecule as defined above.
Un autre objet de l'invention concerne l'utilisation d'une molécule chimère telle que définie ci-avant pour la préparation d'un médicament. Dans un mode préféré de réalisation, ces médicaments sont des médicaments anti-tumoraux ou anti-inflammatoires.Another object of the invention relates to the use of a chimeric molecule as defined above for the preparation of a medicament. In a preferred embodiment, these drugs are anti-tumor or anti-inflammatory drugs.
Lorsque le composé thérapeutique A est un anti-inflammatoire, les molécules selon l'invention peuvent être utilisée pour la préparation de médicaments destinés à des pathologies aiguës comme l'asthme, la rectocolite hémorragique, la maladie de Crohn, le choc septique, les maladies du collagène et l'arthrite.When the therapeutic compound A is an anti-inflammatory, the molecules according to the invention can be used for the preparation of medicaments intended for acute pathologies such as asthma, ulcerative colitis, Crohn's disease, septic shock, diseases collagen and arthritis.
Lorsque le composé thérapeutique A est un anti-cancéreux, l'invention est utilisable pour le traitement de différentes tumeurs, notamment de tumeurs solides ou liquides ou hématopoïétiques, en particulier de cancers du sein, du poumon, de l'intestin, du colon et
du rectum, du cerveau, des méninges, de l'estomac, de l'oesophage, du foie, du pancréas, de la vessie, tête-et-cou, des appareils reproductifs mâles ou femelles, de la peau, etc.When the therapeutic compound A is an anti-cancer, the invention can be used for the treatment of various tumors, in particular solid or liquid or hematopoietic tumors, in particular breast, lung, intestinal, colon and rectum, brain, meninges, stomach, esophagus, liver, pancreas, bladder, head and neck, male or female reproductive systems, skin, etc.
Les compositions pharmaceutiques de l'invention peuvent comprendre tout excipient ou véhicule acceptable sur le plan pharmaceutique, tel que sel, solutés, etc. Il peut s'agir de solutions salines, tamponnées, isotoniques, d'eau, etc. Les compositions peuvent comprendre, en outre, d'autres agents actifs, utilisés en combinaison, de manière simultanée, séparée ou espacée dans le temps.The pharmaceutical compositions of the invention can comprise any pharmaceutically acceptable excipient or vehicle, such as salt, solutes, etc. It can be saline, buffered, isotonic, water, etc. The compositions may further comprise other active agents, used in combination, simultaneously, separately or spaced over time.
Un autre objet de l'invention concerne l'utilisation des molécules de ciblage telles que définies ci-avant pour la délivrance locale de principes actifs dans le voisinage de tissus pathologiques chez des sujets.Another object of the invention relates to the use of targeting molecules as defined above for the local delivery of active principles in the vicinity of pathological tissues in subjects.
La présente invention concerne en outre des méthodes de traitement d'une pathologie chez un sujet comprenant l'administration d'une molécule ou d'une composition telles que définies ci-avant. De préférence, la pathologie concernée et un cancer ou une inflammation. La méthode de traitement peut comprendre en outre une étape préalable consistant en un traitement permettant de générer des cellules engagées dans un processus d'apoptose dans le tissu pathologique. Elle concerne également des méthodes de délivrance locale de principes actifs dans le voisinage de tissus pathologiques chez des sujets, comprenant l'administration d'une molécule ou d'une composition telles que définies ci- avant.The present invention also relates to methods of treating a pathology in a subject comprising the administration of a molecule or a composition as defined above. Preferably, the pathology concerned and cancer or inflammation. The treatment method may further comprise a preliminary step consisting of a treatment making it possible to generate cells engaged in a process of apoptosis in the pathological tissue. It also relates to methods of local delivery of active principles in the vicinity of pathological tissues in subjects, comprising the administration of a molecule or of a composition as defined above.
Dans le contexte de l'invention, le terme « traitement » désigne le traitement préventif, curatif, palliatif, ainsi que la prise en charge des patients (réduction de la souffrance, réduction de la taille d'une tumeur ou de la progression de la pathologie, amélioration de la durée de vie, ralentissement de la progression de la maladie, diminution du site inflammatoire), etc. Le traitement peut en outre être réalisé en combinaison avec d'autres agents ou traitements (chimiothérapie, radiothérapie, thérapie génique, etc.). Les traitements et médicaments de l'invention sont tout particulièrement destinés aux humains.In the context of the invention, the term “treatment” designates preventive, curative, palliative treatment, as well as the management of patients (reduction of suffering, reduction of the size of a tumor or of the progression of pathology, improved lifespan, slower disease progression, decreased inflammatory site), etc. The treatment can also be carried out in combination with other agents or treatments (chemotherapy, radiotherapy, gene therapy, etc.). The treatments and medicaments of the invention are very particularly intended for humans.
Pour la mise en œuvre des méthodes thérapeutiques définies ci-avant, le composé thérapeutique peut être utilisé à différentes doses et selon différents protocoles. L'administration peut être réalisée par toute méthode connue de l'homme du métier, de
préférence par injection, typiquement par voie intra-péritonéale, intra-tumorale, intradermique, intra-cérébrale, intra-veineuse, intra-artérielle ou intra-musculaire. Les doses administrées peuvent être adaptées par l'homme de l'art. Typiquement, de 0,01 mg à 100 mg / kg environ sont injectés. Il est entendu que des injections répétées peuvent être réalisées. L'invention est utilisable chez les mammifères, notamment chez l'être humain.For the implementation of the therapeutic methods defined above, the therapeutic compound can be used at different doses and according to different protocols. The administration can be carried out by any method known to those skilled in the art, preferably by injection, typically by intraperitoneal, intra-tumor, intradermal, intra-cerebral, intravenous, intra-arterial or intramuscular route. The doses administered can be adjusted by those skilled in the art. Typically, from about 0.01 mg to 100 mg / kg are injected. It is understood that repeated injections can be carried out. The invention can be used in mammals, in particular in humans.
EXEMPLESEXAMPLES
Example 1 : Exemple de réalisation de segments L clivables pour la libération de composés anti-tumoraux et anti-inflammatoires :Example 1: Example of the production of cleavable L segments for the release of anti-tumor and anti-inflammatory compounds:
Si le segment L est uniquement peptidique et ne contient que des résidus naturels, il sera de préférence intégré dans le segment C à son extrémité N ou C-terminale par les méthodes classique de la biologie moléculaire. H pourra cependant être intégré si nécessaire au segment A si celui est peptidique et obtenu par biologie moléculaire.If the L segment is only peptide and contains only natural residues, it will preferably be integrated into the C segment at its N or C-terminal end by the conventional methods of molecular biology. H can however be integrated if necessary into segment A if that is peptide and obtained by molecular biology.
Dans un mode de réalisation particulier, il y aura avantage à préparer de façon extemporanée le segment L ou l'ensemble L-A sous une forme réactive pour une liaison ultérieure au segment C. Un exemple intéressant se présente dans le cas où un groupe thiol amené par un résidu Cystéine est présent dans le segment C, de préférence loin du site de liaison de C aux membranes chargées négativement. Ce groupe thiol permet, par une réaction chimique simple, rapide et totale, de lier l'ensemble L-A muni du groupe fonctionnel maléimide.In a particular embodiment, it will be advantageous to prepare the L segment or the LA unit in a reactive form for a later connection to the C segment. An interesting example occurs in the case where a thiol group brought by a Cysteine residue is present in segment C, preferably far from the site of binding of C to negatively charged membranes. This thiol group makes it possible, by a simple, rapid and total chemical reaction, to link the L-A assembly provided with the maleimide functional group.
Le protocole de synthèse est décrit dans la figure 1. Le fragment L consiste en un peptide protégé lié à une résine acide-labile rink via la stratégie FMOC bien connue de l'homme de l'art. Le fragment réactif possède la propriété de former une liaison covalente avec un groupe nucléophile - ici le groupe SH d'une Cystéine - de la protéine C. Le groupe réactif peut être un bromoacétamide ou, comme ici et de façon plus avantageuse, un groupe maléimide. Le groupe espaceur entre le maléimide et le peptide L peut être un groupe alkyl, alkoxy ou poly alkoxy terminé par une fonction carboxylique pour le couplage à L. Dans l'exemple de la figure 1, le segment thérapeutique est un composé anti-tumoral de la famille de antracycline, la doxorubicine. Dans la figre 1, AA représente n'importe quelle
séquence d'aminoacides pouvant constituer un lien clivable. L'exemple décrit ci-dessous correspond à la séquence AA ≈ Gly-Ser-Gly-Val-Leu.The synthesis protocol is described in FIG. 1. The fragment L consists of a protected peptide linked to an acid-labile resin rink via the FMOC strategy well known to those skilled in the art. The reactive fragment has the property of forming a covalent bond with a nucleophilic group - here the SH group of a Cysteine - of protein C. The reactive group can be a bromoacetamide or, as here and more advantageously, a maleimide group . The spacer group between the maleimide and the peptide L can be an alkyl, alkoxy or poly alkoxy group terminated by a carboxylic function for coupling to L. In the example of FIG. 1, the therapeutic segment is an anti-tumor compound of the antracycline family, doxorubicin. In Fig. 1, AA represents any amino acid sequence which may constitute a cleavable link. The example described below corresponds to the sequence AA ≈ Gly-Ser-Gly-Val-Leu.
Synthèse du Fmoc-Leu-Résine rink acide (1) : 5 g de résine rink 100-200 Mesh (approximativement 0,35-0,80 mmole/g), Fmoc-Leu-OH (3,2 mmoles) et la DCCI (3,37 mmoles) sont agités pendant 5 minutes de O0C à 50C dans 50 ml de DCE, puis 60 mg de DMAP (0,5 mmole) sont ajoutés et après 20 minutes supplémentaires à 5°C, 275 μl de N-méthylmorpholine (2,5 mmoles) sont ajoutés. Le mélange est agité pendant 4 heures. La résine filtrée est lavée avec 40 ml (pour 30 s chaque fois) par les solvants suivants : 3 fois méthanol, 3 fois DCE, 3 fois DMA. Les groupes hydroxyle non réagis de la résine sont bloqués avec l'anhydride acétique (13,5 mmoles) dans 3 ml de pyridine et 15 ml de DMA puis la résine est lavée comme suit (40 ml chaque fois) : 2 fois isopropanol, 3 fois DMA, 2 fois isopropanol, 6 fois DCE, 2 fois isopropanol, 3 fois DMA, 3 fois isopropanol. La résine est ensuite séchée sous vide et a un contenu en Fmoc d' environ 0,35 mmole/g.Synthesis of Fmoc-Leu-Acid Rink Resin (1): 5 g of 100-200 Mesh Rink Resin (approximately 0.35-0.80 mmol / g), Fmoc-Leu-OH (3.2 mmol) and DCCI (3.37 mmol) are stirred for 5 minutes from 0 ° C. to 5 ° C. in 50 ml of DCE, then 60 mg of DMAP (0.5 mmol) are added and after an additional 20 minutes at 5 ° C., 275 μl of N-methylmorpholine (2.5 mmol) are added. The mixture is stirred for 4 hours. The filtered resin is washed with 40 ml (for 30 s each time) with the following solvents: 3 times methanol, 3 times DCE, 3 times DMA. The unreacted hydroxyl groups of the resin are blocked with acetic anhydride (13.5 mmol) in 3 ml of pyridine and 15 ml of DMA and then the resin is washed as follows (40 ml each time): 2 times isopropanol, 3 times DMA, 2 times isopropanol, 6 times DCE, 2 times isopropanol, 3 times DMA, 3 times isopropanol. The resin is then dried under vacuum and has an Fmoc content of approximately 0.35 mmol / g.
Synthèse du Fmoc-Gly-Ser(Trt)-Gly-Val-Leu-Résine rink acide (2) :Synthesis of Fmoc-Gly-Ser (Trt) -Gly-Val-Leu-Acid rink resin (2):
Lavage et enlèvement du groupe Fmoc à température ambiante :Washing and removal of the Fmoc group at room temperature:
1 g de Fmoc-Leu-Résine rink acide (0,35 mmole) est traité de la façon suivante chaque fois 3 minutes avec 20 ml de 1 fois isopropanol, 4 fois DMA, 6 fois 20% pipéridine dans le1 g of Fmoc-Leu-Resin acid rink (0.35 mmol) is treated as follows each time 3 minutes with 20 ml of 1 time isopropanol, 4 times DMA, 6 times 20% piperidine in the
DMA, 2 fois DMA, 1 fois isopropanol, 4 fois DMA.DMA, 2 times DMA, 1 time isopropanol, 4 times DMA.
Couplage Fmoc-AAn-OH :Fmoc-AA n -OH coupling:
DIEA (3,5 mmoles) dans 10 ml de DMA est ajouté à la résine. Après le gonflement de la résine, les aminoacides protégés par le Fmoc (1,75 mmoles) et le HBTU (1,72 mmoles) dans du DMA sont ajoutés. Après 40 minutes la résine est rincée avec 4 fois 40 ml deDIEA (3.5 mmol) in 10 ml of DMA is added to the resin. After the resin swells, the amino acids protected by Fmoc (1.75 mmol) and HBTU (1.72 mmol) in DMA are added. After 40 minutes the resin is rinsed with 4 times 40 ml of
DMA.DMA.
Synthèse du H-Gly-Ser(Trt)-Gly-Val-Leu-Résine rink acide (3) :Synthesis of H-Gly-Ser (Trt) -Gly-Val-Leu-Acid rink resin (3):
La forme N-terminale libre du peptide protégé et lié à la résine est obtenu par le protocole de clivage et lavage identique au protocole (2)°.The free N-terminal form of the protected peptide and bound to the resin is obtained by the cleavage and washing protocol identical to protocol (2) °.
Synthèse du composé réactif (4) :
A 1 g de résine (3) (3,5 mmoles dans le DMA) on ajoute 3,5 nimoles de DIEA, 1,75 mmoles de N-maléoyl-β-alanine et 1,72 mmoles de HBTU. Après 2 heures, la résine est lavée avec 4 fois 20 ml de DMA puis séchée sous vide.Synthesis of the reactive compound (4): To 1 g of resin (3) (3.5 mmol in DMA) is added 3.5 nimoles of DIEA, 1.75 mmol of N-maleoyl-β-alanine and 1.72 mmol of HBTU. After 2 hours, the resin is washed with 4 times 20 ml of DMA and then dried under vacuum.
Séparation du peptide protégé de la résine pour obtenir (5) :Separation of the protected peptide from the resin to obtain (5):
La résine est dispersée dans le DCM et traitée par 20 ml de mélange de clivage AcOH/DCM (10/90 v/v) pendant une heure puis est filtrée, lavée 3 fois avec 20 ml de mélange de clivage puis 3 fois 20 ml de DMA pour extraire le peptide de la résine. De l'hexane (15 fois le volume) est ajouté au filtrat pour enlever l'acide acétique sous forme azéotrope. Le peptide protégé résultant est séché sous vide et purifié par chromatographie « flash ».The resin is dispersed in DCM and treated with 20 ml of AcOH / DCM cleavage mixture (10/90 v / v) for one hour then is filtered, washed 3 times with 20 ml of cleavage mixture then 3 times 20 ml of DMA to extract the peptide from the resin. Hexane (15 times the volume) is added to the filtrate to remove acetic acid in azeotropic form. The resulting protected peptide is dried under vacuum and purified by "flash" chromatography.
Couplage du peptide protégé au composé anti-tumoral doxorubicine :Coupling of the protected peptide to the anti-tumor compound doxorubicin:
A l'abri de la lumière, on ajoute au composé (5) (0,3 mmole dans 2 ml de DMA), 3 mmoles de DIEA, 0,3 mmole de HBTU et 0,3 mmole de Doxorubicine. Après 2 heures, le solvant est évaporé et le produit brut est dilué dans l'acétonitrile, purifié par chromatographie « flash » sur gel de silice.In the absence of light, 3 mmol of DIEA, 0.3 mmol of HBTU and 0.3 mmol of Doxorubicin are added to compound (5) (0.3 mmol in 2 ml of DMA). After 2 hours, the solvent is evaporated and the crude product is diluted in acetonitrile, purified by "flash" chromatography on silica gel.
Synthèse du composé final (7) : A l'abri de la lumière, le composé (6) est dilué dans une solution à 1% de TFA et 5% de triéthylsilane dans le DCM. Après 2 heures, le produit brut est évaporé sous vide puis dissout dans l'acétonitrile, purifié par HPLC et lyophylisé.Synthesis of the final compound (7): Protected from light, the compound (6) is diluted in a solution containing 1% of TFA and 5% of triethylsilane in DCM. After 2 hours, the crude product is evaporated under vacuum and then dissolved in acetonitrile, purified by HPLC and lyophylized.
Exemple 2 : Synthèse d'un lien mixte peptidique et non-peptidique pour la libération de composés anti-tumoraux.Example 2: Synthesis of a mixed peptide and non-peptide link for the release of anti-tumor compounds.
La partie non peptidique du lien est introduit à l'aide du composé (12), obtenu selon le schéma de la figure 2, en remplacement de la N-maléoyl-β-alanine utilisée dans la synthèse précédente (figure 1). Le schéma de la figure 2 décrit un lien de structure générale et le protocole qui suit décrit le cas particulier m=l , n=2, o=l .The non-peptide part of the link is introduced using the compound (12), obtained according to the diagram in FIG. 2, replacing the N-maleoyl-β-alanine used in the previous synthesis (FIG. 1). The diagram in FIG. 2 describes a general structure link and the protocol which follows describes the particular case m = l, n = 2, o = l.
A une solution de 2-(2-aminoethoxy)-éthanol (47,55 mmol) (8) dans 100 ml de dichlorométhane, on ajoute au goutte à goutte à 0°C une solution de t-butylpyrocarbonate (47.55 mmol) dans 50 ml de dichlorométhane. On laisse remonter à température ambiante
et après deux heures, on évapore à sec le mélange réactionnel. On obtient le carbamate désiré (9) sous forme d'une huile incolore.To a solution of 2- (2-aminoethoxy) -ethanol (47.55 mmol) (8) in 100 ml of dichloromethane, a solution of t-butylpyrocarbonate (47.55 mmol) in 50 is added dropwise at 0 ° C ml of dichloromethane. Let rise to room temperature and after two hours, the reaction mixture is evaporated to dryness. The desired carbamate (9) is obtained in the form of a colorless oil.
A une solution de PPH3ZDIAD (7.5 mmol) dans 25ml de THF fraîchement distillé est ajouté, à 0°C, l'alcool néopentylique (7.5 mmol), le carbamate précèdent (9) (7.5 mmol) et le maléimide (7.5 mmol). On laisse ensuite la réaction à température ambiante pendant la nuit. Le brute réactionnel est évaporé à sec puis flash chromatographié sur silice pour donner le produit attendu (10).To a solution of PPH 3 ZDIAD (7.5 mmol) in 25 ml of freshly distilled THF is added, at 0 ° C, neopentyl alcohol (7.5 mmol), the previous carbamate (9) (7.5 mmol) and maleimide (7.5 mmol ). The reaction is then left at room temperature overnight. The crude reaction product is evaporated to dryness and then flash chromatographed on silica to give the expected product (10).
A une solution du carbamate précédent (10) (6.5 mmol) dans 40 ml de dichlorométhane est ajouté 30 ml d'acide trifluoroacétique. La mixture est laissée aux ultrasons 10 minutes puis agitée à température ambiante 1 heure. Les solvants sont évaporés et le résidu lavé au chloroforme (3x) et à l'éther (4x). Le produit obtenu (11) sous forme de trifluoroacétate est utilisé tel quel à l'étape suivante.To a solution of the preceding carbamate (10) (6.5 mmol) in 40 ml of dichloromethane is added 30 ml of trifluoroacetic acid. The mixture is left to ultrasound for 10 minutes and then stirred at room temperature for 1 hour. The solvents are evaporated and the residue washed with chloroform (3x) and with ether (4x). The product obtained (11) in the form of trifluoroacetate is used as such in the next step.
Au sel de trifluoroacétate du produit précèdent (11) (6 mmol) en suspension dans le dichlorométhane (3OmL), est ajouté à température ambiante le DIEA (12 mmol). Après une heure, on ajoute l'anhydride diglycolique (6.5 mmol). Après deux heures, on évapore à sec et on purifie le produit (12) par flash chromatographié sur silice.DIEA (12 mmol) is added to the trifluoroacetate salt of the above product (11) (6 mmol) in suspension in dichloromethane (30 ml). After one hour, diglycolic anhydride (6.5 mmol) is added. After two hours, the mixture is evaporated to dryness and the product (12) is purified by flash chromatography on silica.
Le composé (12) est ensuite utilisé comme le composé N-maléoyl-β-alanine pour la synthèse d'un lien clivable mixte selon le protocole décrit dans la Figure 1 pour les composés (5) et (6).The compound (12) is then used as the compound N-maleoyl-β-alanine for the synthesis of a mixed cleavable link according to the protocol described in Figure 1 for the compounds (5) and (6).
Exemple 2b : Synthèse d'un bras comportant un groupe d'espacement et un groupe peptidique clivable et couplage d'une part à une molécule de ciblage C et d'autre part à la doxorubicine.Example 2b: Synthesis of an arm comprising a spacer group and a cleavable peptide group and coupling on the one hand to a targeting molecule C and on the other hand to doxorubicin.
Le composé (12) de la Figure 2 avec n=2, M=I et o=l a été couplé au peptide AAn= GIy- Gly-Ala-Leu selon la méthode décrite précédemment (Exemple 2). La molécule obtenue a été couplée à la doxorubicine selon la méthode décrite dans l'exemple précédent (Figure 1) pour obtenir le composé (12) suivant :
The compound (12) of Figure 2 with n = 2, M = I and o = l was coupled to the peptide AAn = GIy-Gly-Ala-Leu according to the method described above (Example 2). The molecule obtained was coupled to doxorubicin according to the method described in the previous example (Figure 1) to obtain the following compound (12):
Composé (12)Compound (12)
Le composé 12 a ensuite été couplé à un segment de ciblage C-SH de la famille (S5) grâce au groupe SH que celui-ci comporte et selon le protocole général suivant : A 4,5mg de C-SH lyophilisé (1 équivalent) dans 5,4mL de tampon PBS (pH = 6.7) dégazé à l'azote, on a ajouté une solution de 1 équivalent de (12) (0,54 mg) dans 540μL de DMSO. On a laissé la réaction se poursuivre Ih à température ambiante puis le mélange réactionnel a été lyophilisé.Compound 12 was then coupled to a targeting segment C-SH of the family (S5) thanks to the SH group which it contains and according to the following general protocol: A 4.5 mg of lyophilized C-SH (1 equivalent) in 5.4 ml of PBS buffer (pH = 6.7) degassed with nitrogen, a solution of 1 equivalent of (12) (0.54 mg) in 540 μL of DMSO was added. The reaction was allowed to continue for 1 h at room temperature and then the reaction mixture was lyophilized.
Le lyophylisat a été repris dans un mélange H2O /DMSO 50/50 (2mL) et a été purifié par HPLC (colonne Source 15RPC 10x250 mm). La fraction correspondant au composé final C-S-(12) a été collectée puis lyophilisée.The lyophylisate was taken up in a H2O / DMSO 50/50 mixture (2 ml) and was purified by HPLC (Source column 15RPC 10 × 250 mm). The fraction corresponding to the final compound C-S- (12) was collected and then lyophilized.
Le composé final C-S-(12) a été ultérieurement soumis à l'action des différentes protéases (MMP2, MMP3 et MMP9) selon le protocole suivant :The final compound C-S- (12) was subsequently subjected to the action of the various proteases (MMP2, MMP3 and MMP9) according to the following protocol:
On a préparé une solution de C-S-(12) (60μM) soit 0,6mg dans ImL dans un tampon Tris- HCl 5OmM pH=7,5. On a séparé ce lot en 3 aliquots de 33OμL chacun. A chaque aliquot, on a ajouté une des MMP après activation (MMP2, MMP3 et MMP9) environ 0,5μg de chaque enzyme. On a laissé incuber 5 heures à température ambiante. Les aliquots ont ensuite été purifiés par HPLC et les différents pics absorbants à 495nm ont été analysés en ESI-TOF.
Exemple 3 : Construction et production anti-inflammatoire NTAl-C.A solution of CS- (12) (60 μM), ie 0.6 mg in ImL, was prepared in a 5OmM Tris-HCl buffer pH = 7.5. This batch was separated into 3 aliquots of 33OμL each. To each aliquot, one of the MMPs was added after activation (MMP2, MMP3 and MMP9) about 0.5 μg of each enzyme. It was incubated for 5 hours at room temperature. The aliquots were then purified by HPLC and the various absorbent peaks at 495nm were analyzed by ESI-TOF. Example 3: Construction and anti-inflammatory production NTAl-C.
Deux constructions sont proposées qui correspondent l'une à la version longue de NTAl nommé NTAIl, selon la séquence S7 (Seq ID 33) et l'autre à la version courte, nommé NTAIc, selon la séquence S8 (Seq ID 35).Two constructions are proposed, one corresponding to the long version of NTAl named NTAIl, according to the sequence S7 (Seq ID 33) and the other to the short version, named NTAIc, according to the sequence S8 (Seq ID 35).
NTAIc + :NTAIc +:
5 ' P-CGAAAACGAAGAACΆGGAATACGTTCAGACCGTTAAATCTTCTAAAGGTGGTCCGG-S ' (SEQ ID No 45)5 'P-CGAAAACGAAGAACΆGGAATACGTTCAGACCGTTAAATCTTCTAAAGGTGGTCCGG-S' (SEQ ID No 45)
N TAIc - :N TAIc -:
5 ' P-GATCCCGGACCACCTTTAGAAGATTTAACGGTCTGAACGTATTCCTGTTCTTCGTTTTCGGGCC- 3 '5 'P-GATCCCGGACCACCTTTAGAAGATTTAACGGTCTGAACGTATTCCTGTTCTTCGTTTTCGGGCC- 3'
(SEQ ID No 46)(SEQ ID No 46)
N TAIl + :N TAIl +:
5 ' P-5 'P-
CGCTATGGTTTCTGAATTCCTGAAACAGGCTTGGTTCATCGAAAACGAAGAACAGGAATACGTTCAGAC CGTTAAATCTTCTAAAGGTGGTCCGG-3' (SEQ IDNo 47) N TAIl - :CGCTATGGTTTCTGAATTCCTGAAACAGGCTTGGTTCATCGAAAACGAAGAACAGGAATACGTTCAGAC CGTTAAATCTTCTAAAGGTGGTCCGG-3 '(SEQ IDNo 47) N TAILLE -:
5'P-5'P-
GATCCCGGACCACCTTTAGAAGATTTAACGGTCTGAACGTATTCCTGTTCTTCGTTTTCGATGAACCAA GCCTGTTTCAGGAATTCAGAAACCATAGCGGGCC-3'GATCCCGGACCACCTTTAGAAGATTTAACGGTCTGAACGTATTCCTGTTCTTCGTTTTCGATGAACCAA GCCTGTTTCAGGAATTCAGAAACCATAGCGGGCC-3 '
(SEQ ID No 48) Ban 11 + :(SEQ ID No 48) Ban 11 +:
5 ' -GCGCTGTTAGCGGGTCCATTAAGTTCTGTC-3 ' (SEQ ID No 49) Ban II - :5 '-GCGCTGTTAGCGGGTCCATTAAGTTCTGTC-3' (SEQ ID No 49) Ban II -:
5 ' -GACAGAACTTAATGGACCCGCTAACAGCGC-3 '5 '-GACAGAACTTAATGGACCCGCTAACAGCGC-3'
(SEQ ID No 50)(SEQ ID No 50)
Les plasmides pGEX 6Pl utilisés sont commerciaux (Amersham biosciences) ainsi que les enzymes (Biolabs) utilisés : BamH I, EcoR I, Ban II, T4 DNA Ligase, CIP, T4 kinase.The pGEX 6Pl plasmids used are commercial (Amersham biosciences) as well as the enzymes (Biolabs) used: BamH I, EcoR I, Ban II, T4 DNA Ligase, CIP, T4 kinase.
Construction de NTAIc-C et NTAIl-C dans pGEX 6PConstruction of NTAIc-C and NTAIl-C in pGEX 6P
Le vecteur d'expression utilisé est le vecteur pGEX 6Pl (Amersham-Biosciences). Ce vecteur permet l'expression de la protéine d'intérêt fusionnée à la GST à son extrémité Nter. La protéine d'intérêt est récupérée sans protéine de fusion après digestion par la PreScission. La séquence codante du segment C (provenant du vecteur pGEX2T, construit
au laboratoire) sera insérée dans ce vecteur entre les sites BamH I et EcoR I. Le segment NTAIl ou NTAIc sera ensuite inséré sous forme de cassettes dans le vecteur pGEX 6P contenant la séquence codante du segment C entre les sites Ban II et BamH I.The expression vector used is the vector pGEX 6Pl (Amersham-Biosciences). This vector allows the expression of the protein of interest fused to the GST at its Nter end. The protein of interest is recovered without fusion protein after digestion by the PreScission. The coding sequence of segment C (from the vector pGEX2T, constructed in the laboratory) will be inserted into this vector between the BamH I and EcoR I sites. The NTAII or NTAIc segment will then be inserted in the form of cassettes in the vector pGEX 6P containing the coding sequence of the C segment between the Ban II and BamH I sites.
Le vecteur pGEX 6P possède deux sites Ban IL La première étape consiste donc à rendre ce site unique afin de l'utiliser comme site de clonage du segment NTAl. Le site Ban II situé en position 3890 est enlevé par une étape de mutagenèse dirigée silencieuse (kit Quick Change, Stratagène, oligos Ban II + et Ban II -) en suivant les recommandations du fournisseur. Le plasmide « pGEX-6P-mut » est alors obtenu.The vector pGEX 6P has two Ban IL sites. The first step therefore consists in making this site unique in order to use it as a cloning site for the NTA1 segment. The Ban II site located at position 3890 is removed by a silent directed mutagenesis step (Quick Change kit, Stratagene, Ban II + and Ban II - oligos) following the supplier's recommendations. The plasmid "pGEX-6P-mut" is then obtained.
La séquence codante du segment C est extraite du plasmide pGEX2T par digestion enzymatique à l'aide des enzymes de restriction BamH I et EcoR I (Biolabs). Brièvement, 20 μg d'ADN est digéré séquentiellement par 200 U d'enzyme, à 37°C pendant la nuit. Après chaque digestion, l'ADN est purifié après migration sur gel d'agarose à l'aide du kit « GFX PCR DNA and Gel Band Purification kit » (Amersham-Biosciences). 20 μg de plasmide « pGEX-6P-mut » est également digéré dans les mêmes conditions par BamH I et EcoR I afin d'obtenir le vecteur dans lequel les séquences codantes seront insérées. Afin d'éviter une recircularisation du vecteur, celui-ci est déphosphorylé par une incubation de 2h à 370C en présence de 2 U de CIP (Biolabs). Le vecteur « pGEX-6P-mut », ouvert en BamH I / EcoR I et déphosphorylé, est ensuite purifié à l'aide du kit Amersham. La ligation de la séquence codante du segment C (10 moles d'insert pour 1 mole de vecteur) dans le vecteur « pGEX-6P-mut » est ensuite réalisée par incubation de 2h à température ambiante en présence de 400 U de T4 DNA ligase (Biolabs). Les plasmides pGEX-6P-mut contenant la séquence codante du segment C sont alors obtenus.The coding sequence of segment C is extracted from the plasmid pGEX2T by enzymatic digestion using the restriction enzymes BamH I and EcoR I (Biolabs). Briefly, 20 μg of DNA is digested sequentially with 200 U of enzyme, at 37 ° C. overnight. After each digestion, the DNA is purified after migration on agarose gel using the “GFX PCR DNA and Gel Band Purification kit” (Amersham-Biosciences) kit. 20 μg of plasmid "pGEX-6P-mut" is also digested under the same conditions with BamH I and EcoR I in order to obtain the vector in which the coding sequences will be inserted. In order to avoid recircularization of the vector, the latter is dephosphorylated by an incubation of 2 h at 37 ° C. in the presence of 2 U of CIP (Biolabs). The vector “pGEX-6P-mut”, opened in BamH I / EcoR I and dephosphorylated, is then purified using the Amersham kit. Ligation of the coding sequence of segment C (10 moles of insert for 1 mole of vector) in the vector “pGEX-6P-mut” is then carried out by incubation for 2 h at room temperature in the presence of 400 U of T4 DNA ligase (Biolabs). The pGEX-6P-mut plasmids containing the C segment coding sequence are then obtained.
Les cassettes «NTA11 » et «NTAlc » sont obtenues par hybridation de 100 pmol des oligos complémentaires (NTAlc + / NTAlc - et NTAIl + / NTAIl -) à 95°C pendant 5 min dans un tampon Tris HCl 20 mM ρH7,5 ; NaCl 300 mM ; EDTA 1 mM. Les extrémités 5' des cassettes sont ensuite phosphorylées par une incubation à 37°C pendant 2h en présence de 50 U de T4 polynucléotide kinase (Biolabs). L'enzyme est inactivée par incubation à 65°C pendant 20 min.The “NTA11” and “NTAlc” cassettes are obtained by hybridization of 100 pmol of the complementary oligos (NTAlc + / NTAlc - and NTAIl + / NTAIl -) at 95 ° C for 5 min in a 20 mM Tris HCl buffer ρH7.5; 300 mM NaCl; 1 mM EDTA. The 5 ′ ends of the cassettes are then phosphorylated by an incubation at 37 ° C. for 2 h in the presence of 50 U of T4 polynucleotide kinase (Biolabs). The enzyme is inactivated by incubation at 65 ° C for 20 min.
La dernière étape consiste à digérer les plasmides pGEX-6P-mut la séquence codante du segment C par Ban II et BamH I afin d'insérer les cassettes. 20 μg d'ADN est digéré
séquentiellement par 50 U de Ban II et 100 U de BamH I, à 37°C pendant la nuit. Après chaque digestion, l'ADN est purifié après migration sur gel d'agarose à l'aide du kit Amersham. La déphosphorylation des vecteurs est réalisée par incubation à 37°C pendant Ih en présence de 10 U de CIP, afin d'éviter leur recircularisation lors de l'étape de ligation. La ligation des cassettes dans les vecteurs est réalisée comme décrite précédemment. On obtient donc les séquences NTAIc-C et NTAIl-C clonées dans le vecteur pGEX-6P-mut.The last step consists in digesting the plasmids pGEX-6P-mut the coding sequence of segment C by Ban II and BamH I in order to insert the cassettes. 20 μg of DNA is digested sequentially with 50 U of Ban II and 100 U of BamH I, at 37 ° C. overnight. After each digestion, the DNA is purified after migration on agarose gel using the Amersham kit. The dephosphorylation of the vectors is carried out by incubation at 37 ° C for 1 hour in the presence of 10 U of CIP, in order to avoid their recircularization during the ligation step. The ligation of the cassettes in the vectors is carried out as described above. The NTAIc-C and NTAII-C sequences cloned in the vector pGEX-6P-mut are therefore obtained.
Après chaque construction les séquences d'ADN sont vérifiées avec le kit de séquençage Big Dye Terminator, Perkin-Elmer Applied Biosystems, sur un séquenceur Perkin-Elmer Abiprism 310, selon le protocole du fournisseur.After each construction, the DNA sequences are checked with the Big Dye Terminator sequencing kit, Perkin-Elmer Applied Biosystems, on a Perkin-Elmer Abiprism 310 sequencer, according to the supplier's protocol.
Expression de NTAIc-C et NTAIl-C chez E. coliExpression of NTAIc-C and NTAIl-C in E. coli
L'expression est réalisée chez une souche d'E. coli BL21 gold (Stratagène) à 30°C. Les bactéries sont mises en culture dans un milieu Luria Berthani (Gibco) contenant 150 mg/L d'ampicilline. Lorsque la turbidité des cultures atteint une densité optique à 600 nmThe expression is carried out in a strain of E. coli BL21 gold (Stratagene) at 30 ° C. The bacteria are cultured in a Luria Berthani medium (Gibco) containing 150 mg / L of ampicillin. When the turbidity of the cultures reaches an optical density at 600 nm
(DO6O0) de 0,6, l'expression des protéines est induite par l'ajout de 1 mM IPTG (Sigma) et maintenue pendant 4h. Les bactéries sont alors centrifugées à 5,000 rpm (centrifugeuse(DO 6O0 ) of 0.6, protein expression is induced by the addition of 1 mM IPTG (Sigma) and maintained for 4 h. The bacteria are then centrifuged at 5,000 rpm (centrifuge
JLAl.8000, Beckman) pour 10 min à 4°C et re-suspendues dans 20 mL de tampon S complet (20 mM Tris-HCl pH 7,6 ; 500 mM NaCl ; 1 mM EDTA ; 2% glycérol (v/v) ; 1% triton XlOO (v/v)) supplémenté avec 0,1 mM de PMSF (Sigma) en éthanol ; 0,5 mM deJLAl.8000, Beckman) for 10 min at 4 ° C and resuspended in 20 mL of complete S buffer (20 mM Tris-HCl pH 7.6; 500 mM NaCl; 1 mM EDTA; 2% glycerol (v / v ); 1% triton X100 (v / v)) supplemented with 0.1 mM PMSF (Sigma) in ethanol; 0.5 mM
DTT (Sigma) et 50 mg de lysozyme (Sigma). Après une incubation d'ih à 4°C, les extraits sont homogénéisés par 10 sonications de 1 min (amplitude 65%, 1 sec sonication, 1 sec repos) avec un repos d'1 min entre chaque sonication. Les protéines présentes dans la fraction soluble (surnageant) sont alors récupérées par centrifugation à 20,000 g, pendantDTT (Sigma) and 50 mg lysozyme (Sigma). After an incubation of ih at 4 ° C., the extracts are homogenized by 10 sonications of 1 min (amplitude 65%, 1 sec sonication, 1 sec rest) with a rest of 1 min between each sonication. The proteins present in the soluble fraction (supernatant) are then recovered by centrifugation at 20,000 g, for
45 min à 4°C.45 min at 4 ° C.
Purification de NTAIc-C et NTAH-C sur colonne GSTrapPurification of NTAIc-C and NTAH-C on a GSTrap column
10 mL de la fraction soluble est prélevée et diluée dans 20 mL de tampon de liaison (50 mM Tris-HCl pH7,5 ; 150 mM NaCl). Les protéines sont alors purifiées par chromatographie d'affinité sur colonne GSTrap Fast Flow (Amersham-Biosciences). Une colonne de 5 mL est préparée suivant les instructions du fabricant. L'échantillon protéique (30 mL) est chargé sur la colonne et cette dernière est lavée avec 10 volumes de tampon de liaison. Après un lavage supplémentaire avec 10 volumes de tampon de coupure (50 mM
Tris-HCl pH7,5 ; 150 mM NaCl ; 1 mM EDTA ; 1 mM DTT), la protéine est incubée directement sur la colonne avec 100 U de PreScission (Amersham-Biosciences) à 4°C pendant 2Oh. La protéine d'intérêt sans partenaire de fusion est ensuite récupérée par lavage avec 15 mL de tampon de coupure.10 mL of the soluble fraction is taken and diluted in 20 mL of binding buffer (50 mM Tris-HCl pH 7.5; 150 mM NaCl). The proteins are then purified by affinity chromatography on a GSTrap Fast Flow column (Amersham-Biosciences). A 5 mL column is prepared according to the manufacturer's instructions. The protein sample (30 mL) is loaded onto the column and the column is washed with 10 volumes of binding buffer. After additional washing with 10 volumes of cut buffer (50 mM Tris-HCl pH7.5; 150 mM NaCl; 1 mM EDTA; 1 mM DTT), the protein is incubated directly on the column with 100 U of PreScission (Amersham-Biosciences) at 4 ° C for 2 h. The protein of interest without a fusion partner is then recovered by washing with 15 ml of cleavage buffer.
Purification de NTAIc-C et NTAIl-C par gel filtrationPurification of NTAIc-C and NTAIl-C by gel filtration
Une colonne HiLoad 26/60 Superdex 75 (300 mL) (Amersham-Biosciences) est équilibrée à l'aide de 2 volumes de tampon A (bicarbonate d'ammonium 150 mM pH 7,9). La protéine issue de la purification par GSTrap est alors injectée, et son élution est réalisée avec 2 volumes de tampon A. La protéine ainsi purifiée est aliquotée, lyophilisée et conservée à 20°C.A HiLoad 26/60 Superdex 75 column (300 mL) (Amersham-Biosciences) is balanced using 2 volumes of buffer A (150 mM ammonium bicarbonate pH 7.9). The protein resulting from the purification by GSTrap is then injected, and its elution is carried out with 2 volumes of buffer A. The protein thus purified is aliquoted, lyophilized and stored at 20 ° C.
Figures Figure 1 : Synthèse de la prodrogue avec AAn = Gly-Ser-Gly-Val-Leu comme substrat pour la MMP2, MMP3 et MMP9 et la N-maleoyl-beta-alanine comme segment réactif de liaison.Figures Figure 1: Synthesis of the prodrug with AA n = Gly-Ser-Gly-Val-Leu as substrate for MMP2, MMP3 and MMP9 and N-maleoyl-beta-alanine as reactive binding segment.
Figure 2 : Synthèse du lien non-peptidique long en remplacement du lien court de la N- maleoyl-beta-alanine utilisé dans le protocole précédent. Synthèse à partir de la 2-(2- aminoethoxy)-éthanol (8) (m=l, n=2, o=l)Figure 2: Synthesis of the long non-peptide link to replace the short link of N-maleoyl-beta-alanine used in the previous protocol. Synthesis from 2- (2- aminoethoxy) -ethanol (8) (m = l, n = 2, o = l)
Abbreviations : AcOH : acide acétique ; DCCI : N,N'-Dicyclohexylcarbodiimide ; DCE : 1,2 Dichloroéthane ; DCM : Dichlorométhane ; DIEA : Diisopropylsilane ; DMA : Diméthylacétamide ; DMAP : 4-Diméthylaminopyridine ; HBTU : 2-(lH-Benzotriazole-l- yl)-l,l,3,3-tétraméthyluronium hexafluorophosphate ; TFA : acid trifluoroacetique
Abbreviations: AcOH: acetic acid; DCCI: N, N'-Dicyclohexylcarbodiimide; DCE: 1.2 Dichloroethane; DCM: Dichloromethane; DIEA: Diisopropylsilane; DMA: Dimethylacetamide; DMAP: 4-Dimethylaminopyridine; HBTU: 2- (1H-Benzotriazole-1-yl) -1,1,3,3-tetramethyluronium hexafluorophosphate; TFA: trifluoroacetic acid
Claims
REVENDICATIONS
1- Molécule comprenant trois segments :1- Molecule comprising three segments:
- un segment de ciblage C capable de se lier aux membranes de cellules engagées dans un processus d'apoptose ;- a targeting segment C capable of binding to the membranes of cells engaged in a process of apoptosis;
- un segment thérapeutique A comprenant un composé biologiquement actif ; et un segment de liaison L entre le segment de ciblage et le segment thérapeutique, ladite liaison étant clivable in vivo dans l'environnement d'un tissu ou d'une cellule en apoptose.- a therapeutic segment A comprising a biologically active compound; and a linkage segment L between the targeting segment and the therapeutic segment, said linkage being cleavable in vivo in the environment of an apoptotic tissue or cell.
2- Molécule selon la revendication 1, caractérisée en ce que ledit segment de liaison L comprend une fonction chimique reconnue et clivée par une enzyme ou un ensemble d'enzymes spécifiques de l'environnement des cellules ciblées.2- A molecule according to claim 1, characterized in that said linking segment L comprises a recognized chemical function and cleaved by an enzyme or a set of enzymes specific to the environment of the targeted cells.
3- Molécule selon la revendication 1 ou 2, caractérisée en ce que ledit segment de liaison L comprend une séquence reconnue et clivée par une protéase majoritairement présente dans le tissu ciblé, plus particulièrement choisie parmi une métallo-protéase de la matrice extra- cellulaire, une urokinase, et une protéase spécifique du clivage du segment extracellulaire des cytokines membranaires ou de leurs récepteurs.3- Molecule according to claim 1 or 2, characterized in that said linking segment L comprises a sequence recognized and cleaved by a protease mainly present in the targeted tissue, more particularly chosen from a metallo-protease of the extracellular matrix, urokinase, and a protease specific for cleavage of the extracellular segment of membrane cytokines or their receptors.
4- Molécule selon l'une des revendications 1 à 3, caractérisée en ce que ledit segment de liaison L comprend une séquence sélectionnée en ce qu'elle contient au moins un couple de résidus B1-B2 donné dans le tableau suivant :4- Molecule according to one of claims 1 to 3, characterized in that said linking segment L comprises a sequence selected in that it contains at least one pair of residues B1-B2 given in the following table:
où X est résidu aminoacide quelconque naturel ou non.where X is any natural or unnatural amino acid residue.
5- Molécule selon l'une des revendications précédentes, caractérisée en ce que ledit segment de ciblage C est capable de se lier aux membranes comportant des lipides dont la charge électrostatique totale est négative, notamment la phosphatidylsérine.5- Molecule according to one of the preceding claims, characterized in that said targeting segment C is capable of binding to membranes comprising lipids whose total electrostatic charge is negative, in particular phosphatidylserine.
6- Molécule selon l'une des revendications précédentes, caractérisée en ce que ledit segment de ciblage comprend la séquence peptidique suivante : J^^-J^J^-U8-!^6- Molecule according to one of the preceding claims, characterized in that said targeting segment comprises the following peptide sequence: J ^^ - J ^ J ^ -U 8 -! ^
J28.u29.J30_j31_R_J33_J34_J35_J36_B37.J38_J39_u40_J41_J42_J43_u44_J45.J46_J47_J48_J49_R_j5l_u52^ J53.J54_D_U56_K_S.Z59_L_J61_J62_J63_J64_Z65_J66_J67_U68_J69_J7O_J71_U72_J73_J74_J75_J76 J 28. u 29. J 30_j31_ R _ J 33_ J 34_ J 35_ J 36_ B 37. J 38_ J 39_ u 4 0 _ J 41_ J 42_ J 43_ u 44_ J 45. J 46_ J 47_ J 48_ J 49_ R _ j5 l_ u 52 ^ J53.J54_ D _ U 56_ K _ S. Z 59_ L _ J 61_ J 62_ J 63_ J 64_ Z 65_ J 66_ J 67_ U 68_ J 69_J7O_J71_ U 72_ J 73_ J 74_ J 75_ J 76
(Sl) dans laquelle J, Z, U, X, et B représentent des acides aminés tels que : - les acides aminés J sont choisis indépendamment les uns des autres parmi les acides aminés naturels, ou des dérivés de ceux-ci, de telle manière qu'au moins 50 % d'entre eux sont des résidus polaires choisis parmi R, N, D, C, Q, E, G, H, K, Orn, P, S, T et Y,(Sl) in which J, Z, U, X, and B represent amino acids such that: - the amino acids J are chosen independently of each other from natural amino acids, or derivatives thereof, such so that at least 50% of them are polar residues chosen from R, N, D, C, Q, E, G, H, K, Orn, P, S, T and Y,
- les acides aminés U sont choisis parmi A, C, G, I, L, M, F, W, Y, et V,- the amino acids U are chosen from A, C, G, I, L, M, F, W, Y, and V,
- l'acide aminé X18 est choisi indépendamment des autres acides aminés de la séquence parmi A, N, C, Q, G, H, I, L5 M, F, S, T, W, Y et V,the amino acid X 18 is chosen independently of the other amino acids of the sequence from A, N, C, Q, G, H, I, L 5 M, F, S, T, W, Y and V,
- l'acide aminé B37 est choisi indépendamment des autres acides aminés de la séquence parmi R, A, C, G, I, L, M, F, W, Y, et V,amino acid B 37 is chosen independently of the other amino acids of the sequence from R, A, C, G, I, L, M, F, W, Y, and V,
- l'acide aminé Z7 est choisi indépendamment des autres acides aminés de la séquence parmi D et E, - les acides aminés Z59 et Z65 sont choisis indépendamment parmi E, D, K, et R, les exposants indiquant la position des acides aminés dans la séquence.- the amino acid Z 7 is chosen independently of the other amino acids of the sequence from D and E, - the amino acids Z 59 and Z 65 are chosen independently from E, D, K, and R, the exponents indicating the position of the amino acids in the sequence.
7- Molécule selon la revendication 6, caractérisée en ce que les acides aminés U et B sont choisis suivant un des exemples exposés ci-dessous :
7- Molecule according to claim 6, characterized in that the amino acids U and B are chosen according to one of the examples set out below:
8- Molécule selon l'une des revendications précédentes, caractérisée en ce que ledit segment de ciblage C comprend une séquence sélectionnée parmi le groupe constitué des séquence SEQ ID Nos 23-32.8- Molecule according to one of the preceding claims, characterized in that said targeting segment C comprises a sequence selected from the group consisting of sequences SEQ ID Nos 23-32.
9- Molécule selon l'une des revendications 1-5, caractérisée en ce que ledit segment de ciblage C comprend la séquence de tout ou partie d'une annexine, d'un domaine de type Cl ou C2 des facteurs de coagulation sanguine, d'un domaine V d'une protéine de la famille des 2-Glycoprotéines-I, d'un domaine de type FYVE, d'un domaine de type PH, ou un fragment ou un dérivé présentant au moins 50 % d'identité.9- Molecule according to one of claims 1-5, characterized in that said targeting segment C comprises the sequence of all or part of an annexin, of a Cl or C2 type domain of blood coagulation factors, d a V domain of a protein of the 2-Glycoproteins-I family, a FYVE type domain, a PH type domain, or a fragment or derivative having at least 50% identity.
10- Molécule selon la revendication 9, caractérisée en ce que ledit segment de ciblage C comprend une séquence sélectionnée parmi les séquences SEQ ID Nos 1-16 et 17-22, de préférence SEQ ID Nos 2-4, 6-8, 10-12, 14-16 et 19-22 ou un fragment de celle-ci.10- Molecule according to claim 9, characterized in that said targeting segment C comprises a sequence selected from the sequences SEQ ID Nos 1-16 and 17-22, preferably SEQ ID Nos 2-4, 6-8, 10- 12, 14-16 and 19-22 or a fragment thereof.
11- Molécule selon l'une des revendications précédentes, caractérisée en ce que ledit segment thérapeutique A présente une activité anti-tumorale.11- Molecule according to one of the preceding claims, characterized in that said therapeutic segment A has anti-tumor activity.
12- Molécule selon la revendication 11, caractérisée en ce que ledit segment thérapeutique A est sélectionné parmi le groupe constitué d'une molécule de la famille des TNFα ou dérivés de ceux-ci (TRAIL-Do), d'une molécule d'IL4 humaine ou de l'une de ses
isoformes, d'une molécule de la famille des anthracyclines ou l'un de ces dérivés actifs, de préférence la doxorubicine, d'une molécule de taxane comme le paclitaxel ou le docetaxel ou l'un de ces dérivés actifs, d'une molécule de méthotrexate ou l'un de ces dérivés actifs, du 2-méthoxyestradiol ou l'un de ces dérivés actifs, de molécules de la famille des 5 antipyrimidines comme la cytosine arabinoside ou la difluoro-déoxy-cytidine ou l'un de ces dérivés actifs, de molécules de la famille des agents alkylants dérivés des moutardes à l'azote comme la phénylalanine-moutarde (Melphalan) ou d'un dérivé comme le Chlorambucyl.12- Molecule according to claim 11, characterized in that said therapeutic segment A is selected from the group consisting of a molecule of the family of TNFα or derivatives thereof (TRAIL-Do), of an IL4 molecule human or one of its isoforms, of a molecule of the anthracycline family or one of these active derivatives, preferably doxorubicin, of a taxane molecule such as paclitaxel or docetaxel or one of these active derivatives, of a molecule of methotrexate or one of these active derivatives, of 2-methoxyestradiol or one of these active derivatives, of molecules of the family of 5 antipyrimidines such as cytosine arabinoside or difluoro-deoxy-cytidine or one of these derivatives active, molecules of the family of alkylating agents derived from nitrogen mustards such as phenylalanine-mustard (Melphalan) or a derivative such as Chlorambucyl.
10 13- Molécule selon l'une des revendications 1-10, caractérisée en ce que ledit segment thérapeutique A présente une activité anti-inflammatoire.13- Molecule according to one of claims 1-10, characterized in that said therapeutic segment A has anti-inflammatory activity.
14- Molécule selon la revendication 13, caractérisée en ce que ledit segment thérapeutique A est sélectionnée parmi le groupe constitué par un segment N-terminal de l'annexine I14- Molecule according to claim 13, characterized in that said therapeutic segment A is selected from the group consisting of an N-terminal segment of annexin I
15 humaine, en particulier NTAl, les cytokines anti-inflammatoires, et en particulier HLlO et PILl 3 ou l'un de leurs mutants appropriés, les inhibiteurs non activants des récepteurs membranaires des cytokines pro-inflammatoires comme en particulier l'inhibiteur du récepteur de FILl ou un mutant approprié de cet inhibiteur, les glucocorticoïdes, les antiinflammatoires non stéroïdiens ou de leurs dérivés considérés comme des inhibiteurs des15 human, in particular NTAl, anti-inflammatory cytokines, and in particular HL10 and PILl 3 or one of their appropriate mutants, non-activating inhibitors of membrane receptors of pro-inflammatory cytokines such as in particular the inhibitor of the receptor of IDF1 or an appropriate mutant of this inhibitor, glucocorticoids, non-steroidal anti-inflammatory drugs or their derivatives considered to be inhibitors of
20 enzymes cylo-oxygénase 1 et 2, et le Méthotrexate, un inhibiteur des récepteurs membranaires de la famille des TNFR, en particulier des peptides contenant ou moins le domaine extracellulaire CRDl correspondant.20 enzymes cylo-oxygenase 1 and 2, and Methotrexate, an inhibitor of membrane receptors of the TNFR family, in particular peptides containing at least the corresponding extracellular domain CRDl.
15- Composition pharmaceutique comprenant une molécule selon l'une des revendications 25 précédentes.15. Pharmaceutical composition comprising a molecule according to one of the preceding claims.
16- Utilisation d'une molécule selon l'une des revendications 1-14 pour la fabrication d'un médicament.16- Use of a molecule according to one of claims 1-14 for the manufacture of a medicament.
30 17- Utilisation d'une molécule selon la revendication 11 ou 12 pour la fabrication d'un médicament destiné au traitement du cancer.17. Use of a molecule according to claim 11 or 12 for the manufacture of a medicament intended for the treatment of cancer.
18- Utilisation d'une molécule selon la revendication 13 ou 14 pour la fabrication d'un médicament destiné au traitement d'une maladie inflammatoire.18. Use of a molecule according to claim 13 or 14 for the manufacture of a medicament intended for the treatment of an inflammatory disease.
35
35
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR0306944A FR2856069A1 (en) | 2003-06-10 | 2003-06-10 | New targeted therapeutic agent, useful for treating cancer and inflammation, comprises targeting, therapeutic and linker segments, cleaved specifically by enzymes at the target site |
| PCT/FR2004/001435 WO2004111090A2 (en) | 2003-06-10 | 2004-06-09 | Molecules for targeting and releasing therapeutic compounds, and the use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1631592A2 true EP1631592A2 (en) | 2006-03-08 |
Family
ID=33484306
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP04767301A Withdrawn EP1631592A2 (en) | 2003-06-10 | 2004-06-09 | Molecules for targeting and releasing therapeutic compounds, and the use thereof |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20060154854A1 (en) |
| EP (1) | EP1631592A2 (en) |
| CA (1) | CA2528186A1 (en) |
| FR (1) | FR2856069A1 (en) |
| WO (1) | WO2004111090A2 (en) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8461311B2 (en) | 2010-06-08 | 2013-06-11 | Washington University | TRAIL trimers, methods and uses therefor |
| CA2853100A1 (en) * | 2011-10-24 | 2013-05-02 | Intellect Neurosciences, Inc. | Compositions and methods for treatment of proteinopathies |
| US9498540B2 (en) | 2013-03-15 | 2016-11-22 | Novartis Ag | Cell proliferation inhibitors and conjugates thereof |
| EP3445402A4 (en) * | 2016-04-21 | 2019-12-11 | The Board Of Regents Of The University Of Texas System | METHODS AND COMPOSITIONS FOR DETECTING ANEVRISMS |
| WO2017196891A1 (en) * | 2016-05-09 | 2017-11-16 | Biodesy, Inc. | Methods and devices for detection of peripheral membrane protein interactions using nonlinear optical techniques |
| CA3249181A1 (en) * | 2022-02-23 | 2023-08-31 | Resother Pharma A/S | Annexin a1-derived polypeptide analogues |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5225537A (en) * | 1989-12-29 | 1993-07-06 | Zymogenetics, Inc. | Methods for producing hybrid phospholipid-binding proteins |
| JPH05508664A (en) * | 1991-05-09 | 1993-12-02 | ボード・オブ・リージェンツ・オブ・ザ・ユニヴァーシティ・オブ・ワシントン | Phospholipid-targeted thrombolytic agent |
| US6511829B1 (en) * | 1997-10-09 | 2003-01-28 | The Regents Of The University Of California | GFP-annexin fusion proteins |
| GB9810999D0 (en) * | 1998-05-21 | 1998-07-22 | Goken Joop | Materials and methods relating to the expression of genes |
| FR2784106B1 (en) * | 1998-10-02 | 2002-04-19 | Commissariat Energie Atomique | CHEMICAL STRUCTURE HAVING AFFINITY FOR A PHOSPHOLIPID, AND MARKING COMPOUND, DIAGNOSTIC KIT, AND MEDICINE COMPRISING THE SAME |
| US20030059432A1 (en) * | 2000-02-11 | 2003-03-27 | Dillon Davin C. | Lipophilin complexes for use in cancer diagnosis and therapy |
| CN1188522C (en) * | 2001-07-20 | 2005-02-09 | 健力福生化技术(上海)有限公司 | Target thrombolytic protein expressing plasmid and its construction |
| FR2841558B1 (en) * | 2002-07-01 | 2004-08-13 | Commissariat Energie Atomique | BRAND PEPTIDES HAVING AFFINITY FOR PHOSPHOLIPID AND USES |
-
2003
- 2003-06-10 FR FR0306944A patent/FR2856069A1/en active Pending
-
2004
- 2004-06-09 US US10/560,025 patent/US20060154854A1/en not_active Abandoned
- 2004-06-09 CA CA002528186A patent/CA2528186A1/en not_active Abandoned
- 2004-06-09 EP EP04767301A patent/EP1631592A2/en not_active Withdrawn
- 2004-06-09 WO PCT/FR2004/001435 patent/WO2004111090A2/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2004111090A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2004111090A3 (en) | 2005-09-09 |
| WO2004111090A2 (en) | 2004-12-23 |
| US20060154854A1 (en) | 2006-07-13 |
| CA2528186A1 (en) | 2004-12-23 |
| FR2856069A1 (en) | 2004-12-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7224352B2 (en) | Exosomes for target-specific delivery and methods for producing and delivering the same | |
| EP0797589B1 (en) | Peptides usable as vectors for the intracellular addressing of active molecules | |
| EP2013232B1 (en) | Use of multivalent synthetic ligands of surface nucleolin for treating cancer or inflammation | |
| CN115103688A (en) | Triacetic n-acetylgalamine-modified hydroxypolyaminoamine triplomers and methods of use thereof | |
| EP1631592A2 (en) | Molecules for targeting and releasing therapeutic compounds, and the use thereof | |
| EP0837699A1 (en) | Immunovectors for the intracellular and intranuclear transport | |
| WO2013007933A1 (en) | Antagonist peptide of the bond between cd47 and a protein belonging to the thrombospondin family | |
| JP2007501014A (en) | Targeted carrier fusion for delivery of chemotherapeutic agents | |
| CA2125877A1 (en) | Polypeptides derived from human aiv apolipoprotein, preparation and use thereof | |
| JP2023525758A (en) | AKT3 modulators and methods of use thereof | |
| WO2002039947A2 (en) | Carrier vectors through an epithelium with tight junctions | |
| EP4536284A1 (en) | Lipid microbubbles for the targeted delivery of active agents | |
| FR2856070A1 (en) | New targeted therapeutic agent, useful for treatment of tumors and inflammation, comprises targeting, therapeutic and oligomerization segments, where oligomerization is essential for activity | |
| JP3819712B2 (en) | Synthetic peptides that disrupt intracellular signaling | |
| JP2003534387A (en) | Tumor activating prodrug compounds and methods for their production and use | |
| WO2002035242A1 (en) | Method for identifying novel molecules binding with lox receptor | |
| WO2025243932A1 (en) | Polyion complex and pharmaceutical composition | |
| CA2289110A1 (en) | Peptide analogues, and their uses in particular in pharmaceutical compositions and for diagnosis | |
| TW202535921A (en) | Agents and methods for targeted delivery of immune effector cells | |
| TW202523699A (en) | Agents and methods for targeted delivery of immune effector cells | |
| FR3147292A1 (en) | GENETICALLY MODIFIED CELLS INTO WHICH A NUCLEIC ACID ENCODING VARIANTS OF THE STEFINE A PROTEIN THAT BINDS SPECIFICALLY TO TNFR2 OR A FUSION PROTEIN COMPRISING THE SAME HAS BEEN INTRODUCED, AND USES THEREOF | |
| FR3147278A1 (en) | TNFR2-BINDING POLYPEPTIDES AND METHODS OF USE | |
| FR2893619A1 (en) | LECTINE-DEFENSINE CHIMERIC PROTEIN | |
| WO2023247889A1 (en) | Compositions and methods comprising penetrating peptides | |
| HK40084846A (en) | Akt3 modulators and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20051116 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL HR LT LV MK |
|
| DAX | Request for extension of the european patent (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20060824 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20070104 |