EP1553970A1 - Treatment of allergic conditions by use of il 21 - Google Patents
Treatment of allergic conditions by use of il 21Info
- Publication number
- EP1553970A1 EP1553970A1 EP03757715A EP03757715A EP1553970A1 EP 1553970 A1 EP1553970 A1 EP 1553970A1 EP 03757715 A EP03757715 A EP 03757715A EP 03757715 A EP03757715 A EP 03757715A EP 1553970 A1 EP1553970 A1 EP 1553970A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- allergic
- seq
- polypeptide
- eosinophils
- diseases
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 206010027654 Allergic conditions Diseases 0.000 title claims abstract description 36
- 238000011282 treatment Methods 0.000 title claims abstract description 17
- 108010074108 interleukin-21 Proteins 0.000 claims abstract description 153
- 210000003979 eosinophil Anatomy 0.000 claims abstract description 49
- 208000026935 allergic disease Diseases 0.000 claims abstract description 30
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 26
- 201000010099 disease Diseases 0.000 claims abstract description 22
- 230000001681 protective effect Effects 0.000 claims abstract description 13
- 230000004044 response Effects 0.000 claims abstract description 10
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 31
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 29
- 229920001184 polypeptide Polymers 0.000 claims description 28
- 208000006673 asthma Diseases 0.000 claims description 23
- 239000003814 drug Substances 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 9
- 206010061201 Helminthic infection Diseases 0.000 claims description 6
- 208000030852 Parasitic disease Diseases 0.000 claims description 6
- 206010039085 Rhinitis allergic Diseases 0.000 claims description 4
- 201000010105 allergic rhinitis Diseases 0.000 claims description 4
- 206010020751 Hypersensitivity Diseases 0.000 abstract description 28
- 244000045947 parasite Species 0.000 abstract description 2
- 230000006806 disease prevention Effects 0.000 abstract 1
- 102100030704 Interleukin-21 Human genes 0.000 description 120
- 238000000034 method Methods 0.000 description 23
- 108020004999 messenger RNA Proteins 0.000 description 19
- 150000001875 compounds Chemical class 0.000 description 17
- 239000000203 mixture Substances 0.000 description 17
- -1 IL- 9 Proteins 0.000 description 16
- 102000004169 proteins and genes Human genes 0.000 description 15
- 108090000623 proteins and genes Proteins 0.000 description 15
- 150000003839 salts Chemical class 0.000 description 12
- 239000000725 suspension Substances 0.000 description 12
- 102000004127 Cytokines Human genes 0.000 description 11
- 108090000695 Cytokines Proteins 0.000 description 11
- 208000017604 Hodgkin disease Diseases 0.000 description 11
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 11
- 230000002327 eosinophilic effect Effects 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 241000699670 Mus sp. Species 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 10
- 239000008194 pharmaceutical composition Substances 0.000 description 10
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 9
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 9
- 239000000546 pharmaceutical excipient Substances 0.000 description 9
- 108010058846 Ovalbumin Proteins 0.000 description 8
- 125000003275 alpha amino acid group Chemical group 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- 229940092253 ovalbumin Drugs 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 230000004071 biological effect Effects 0.000 description 7
- 235000014113 dietary fatty acids Nutrition 0.000 description 7
- 239000000839 emulsion Substances 0.000 description 7
- 239000000194 fatty acid Substances 0.000 description 7
- 229930195729 fatty acid Natural products 0.000 description 7
- 238000007901 in situ hybridization Methods 0.000 description 7
- 239000007787 solid Substances 0.000 description 7
- 239000003826 tablet Substances 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- 239000001828 Gelatine Substances 0.000 description 6
- 239000002775 capsule Substances 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 150000004665 fatty acids Chemical class 0.000 description 6
- 239000000796 flavoring agent Substances 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 229920000159 gelatin Polymers 0.000 description 6
- 235000019322 gelatine Nutrition 0.000 description 6
- 210000004698 lymphocyte Anatomy 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 239000003765 sweetening agent Substances 0.000 description 6
- 239000002253 acid Substances 0.000 description 5
- 208000010668 atopic eczema Diseases 0.000 description 5
- 239000007859 condensation product Substances 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 150000002148 esters Chemical class 0.000 description 5
- 235000003599 food sweetener Nutrition 0.000 description 5
- 230000008595 infiltration Effects 0.000 description 5
- 238000001764 infiltration Methods 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 125000001424 substituent group Chemical group 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 4
- IZHVBANLECCAGF-UHFFFAOYSA-N 2-hydroxy-3-(octadecanoyloxy)propyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)COC(=O)CCCCCCCCCCCCCCCCC IZHVBANLECCAGF-UHFFFAOYSA-N 0.000 description 4
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 4
- 239000004150 EU approved colour Substances 0.000 description 4
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 4
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 4
- 241000282414 Homo sapiens Species 0.000 description 4
- 101001010621 Homo sapiens Interleukin-21 Proteins 0.000 description 4
- 108010002616 Interleukin-5 Proteins 0.000 description 4
- 102000000743 Interleukin-5 Human genes 0.000 description 4
- 239000007864 aqueous solution Substances 0.000 description 4
- 239000007900 aqueous suspension Substances 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 239000002270 dispersing agent Substances 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 210000000222 eosinocyte Anatomy 0.000 description 4
- 235000013355 food flavoring agent Nutrition 0.000 description 4
- 239000008187 granular material Substances 0.000 description 4
- 230000000527 lymphocytic effect Effects 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 4
- 239000003921 oil Substances 0.000 description 4
- 239000004006 olive oil Substances 0.000 description 4
- 235000008390 olive oil Nutrition 0.000 description 4
- 229940006093 opthalmologic coloring agent diagnostic Drugs 0.000 description 4
- 239000003755 preservative agent Substances 0.000 description 4
- 210000001350 reed-sternberg cell Anatomy 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 239000000375 suspending agent Substances 0.000 description 4
- 239000006188 syrup Substances 0.000 description 4
- 235000020357 syrup Nutrition 0.000 description 4
- 239000000080 wetting agent Substances 0.000 description 4
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 3
- 102000019034 Chemokines Human genes 0.000 description 3
- 108010012236 Chemokines Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 102100023688 Eotaxin Human genes 0.000 description 3
- 101710139422 Eotaxin Proteins 0.000 description 3
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102000004388 Interleukin-4 Human genes 0.000 description 3
- 108090000978 Interleukin-4 Proteins 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 235000019483 Peanut oil Nutrition 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- 230000000172 allergic effect Effects 0.000 description 3
- 208000030961 allergic reaction Diseases 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 239000012458 free base Substances 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 235000010445 lecithin Nutrition 0.000 description 3
- 239000000787 lecithin Substances 0.000 description 3
- 229940067606 lecithin Drugs 0.000 description 3
- 229940057995 liquid paraffin Drugs 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 238000010172 mouse model Methods 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 239000000312 peanut oil Substances 0.000 description 3
- 230000004043 responsiveness Effects 0.000 description 3
- 230000000717 retained effect Effects 0.000 description 3
- 238000003757 reverse transcription PCR Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 230000000699 topical effect Effects 0.000 description 3
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 2
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 2
- 244000215068 Acacia senegal Species 0.000 description 2
- 235000006491 Acacia senegal Nutrition 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 206010002198 Anaphylactic reaction Diseases 0.000 description 2
- 235000003911 Arachis Nutrition 0.000 description 2
- 244000105624 Arachis hypogaea Species 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000416162 Astragalus gummifer Species 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Chemical compound CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 2
- 206010010744 Conjunctivitis allergic Diseases 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- 206010012438 Dermatitis atopic Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 101000658547 Escherichia coli (strain K12) Type I restriction enzyme EcoKI endonuclease subunit Proteins 0.000 description 2
- 101000658543 Escherichia coli Type I restriction enzyme EcoAI endonuclease subunit Proteins 0.000 description 2
- 101000658546 Escherichia coli Type I restriction enzyme EcoEI endonuclease subunit Proteins 0.000 description 2
- 101000658530 Escherichia coli Type I restriction enzyme EcoR124II endonuclease subunit Proteins 0.000 description 2
- 101000658540 Escherichia coli Type I restriction enzyme EcoprrI endonuclease subunit Proteins 0.000 description 2
- 208000004262 Food Hypersensitivity Diseases 0.000 description 2
- 206010016946 Food allergy Diseases 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 229920000084 Gum arabic Polymers 0.000 description 2
- 101000658545 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Type I restriction enyme HindI endonuclease subunit Proteins 0.000 description 2
- 102100037850 Interferon gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102000004527 Interleukin-21 Receptors Human genes 0.000 description 2
- 108010017411 Interleukin-21 Receptors Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 101000658548 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Putative type I restriction enzyme MjaIXP endonuclease subunit Proteins 0.000 description 2
- 101000658542 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Putative type I restriction enzyme MjaVIIIP endonuclease subunit Proteins 0.000 description 2
- 101000658529 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Putative type I restriction enzyme MjaVIIP endonuclease subunit Proteins 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108010038807 Oligopeptides Proteins 0.000 description 2
- 102000015636 Oligopeptides Human genes 0.000 description 2
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 101001042773 Staphylococcus aureus (strain COL) Type I restriction enzyme SauCOLORF180P endonuclease subunit Proteins 0.000 description 2
- 101000838760 Staphylococcus aureus (strain MRSA252) Type I restriction enzyme SauMRSORF196P endonuclease subunit Proteins 0.000 description 2
- 101000838761 Staphylococcus aureus (strain MSSA476) Type I restriction enzyme SauMSSORF170P endonuclease subunit Proteins 0.000 description 2
- 101000838758 Staphylococcus aureus (strain MW2) Type I restriction enzyme SauMW2ORF169P endonuclease subunit Proteins 0.000 description 2
- 101001042566 Staphylococcus aureus (strain Mu50 / ATCC 700699) Type I restriction enzyme SauMu50ORF195P endonuclease subunit Proteins 0.000 description 2
- 101000838763 Staphylococcus aureus (strain N315) Type I restriction enzyme SauN315I endonuclease subunit Proteins 0.000 description 2
- 101000838759 Staphylococcus epidermidis (strain ATCC 35984 / RP62A) Type I restriction enzyme SepRPIP endonuclease subunit Proteins 0.000 description 2
- 101000838756 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) Type I restriction enzyme SsaAORF53P endonuclease subunit Proteins 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 229920001615 Tragacanth Polymers 0.000 description 2
- 208000024780 Urticaria Diseases 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 235000010489 acacia gum Nutrition 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 208000002205 allergic conjunctivitis Diseases 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000036783 anaphylactic response Effects 0.000 description 2
- 208000003455 anaphylaxis Diseases 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 208000024998 atopic conjunctivitis Diseases 0.000 description 2
- 201000008937 atopic dermatitis Diseases 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 229910000019 calcium carbonate Inorganic materials 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 125000000837 carbohydrate group Chemical group 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 235000020932 food allergy Nutrition 0.000 description 2
- 229940074045 glyceryl distearate Drugs 0.000 description 2
- 229940075507 glyceryl monostearate Drugs 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 239000002919 insect venom Substances 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000007937 lozenge Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 238000007726 management method Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 239000003960 organic solvent Substances 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 2
- 239000008159 sesame oil Substances 0.000 description 2
- 235000011803 sesame oil Nutrition 0.000 description 2
- 239000012453 solvate Substances 0.000 description 2
- 235000011069 sorbitan monooleate Nutrition 0.000 description 2
- 239000001593 sorbitan monooleate Substances 0.000 description 2
- 229940035049 sorbitan monooleate Drugs 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 235000012222 talc Nutrition 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000002691 unilamellar liposome Substances 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 231100000611 venom Toxicity 0.000 description 2
- 208000034280 venom allergy Diseases 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 208000029147 Collagen-vascular disease Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 206010014952 Eosinophilia myalgia syndrome Diseases 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 206010048643 Hypereosinophilic syndrome Diseases 0.000 description 1
- 208000019468 Iatrogenic Disease Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 201000009324 Loeffler syndrome Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 244000000231 Sesamum indicum Species 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- WERKSKAQRVDLDW-ANOHMWSOSA-N [(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl] (z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO WERKSKAQRVDLDW-ANOHMWSOSA-N 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 150000005215 alkyl ethers Chemical class 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 235000013871 bee wax Nutrition 0.000 description 1
- 239000012166 beeswax Substances 0.000 description 1
- 229940124748 beta 2 agonist Drugs 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 235000019437 butane-1,3-diol Nutrition 0.000 description 1
- 235000010216 calcium carbonate Nutrition 0.000 description 1
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000003240 coconut oil Substances 0.000 description 1
- 235000019864 coconut oil Nutrition 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 229960000265 cromoglicic acid Drugs 0.000 description 1
- 239000007933 dermal patch Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- VLARUOGDXDTHEH-UHFFFAOYSA-L disodium cromoglycate Chemical compound [Na+].[Na+].O1C(C([O-])=O)=CC(=O)C2=C1C=CC=C2OCC(O)COC1=CC=CC2=C1C(=O)C=C(C([O-])=O)O2 VLARUOGDXDTHEH-UHFFFAOYSA-L 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003974 emollient agent Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 238000009505 enteric coating Methods 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000007902 hard capsule Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- FBPFZTCFMRRESA-UHFFFAOYSA-N hexane-1,2,3,4,5,6-hexol Chemical compound OCC(O)C(O)C(O)C(O)CO FBPFZTCFMRRESA-UHFFFAOYSA-N 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 230000004047 hyperresponsiveness Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 229940102213 injectable suspension Drugs 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 235000015110 jellies Nutrition 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 229940065725 leukotriene receptor antagonists for obstructive airway diseases Drugs 0.000 description 1
- 239000003199 leukotriene receptor blocking agent Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 231100000344 non-irritating Toxicity 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 208000016021 phenotype Diseases 0.000 description 1
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 1
- 239000002644 phorbol ester Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008105 phosphatidylcholines Chemical class 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000011514 reflex Effects 0.000 description 1
- 210000001533 respiratory mucosa Anatomy 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 235000015424 sodium Nutrition 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 229910001467 sodium calcium phosphate Inorganic materials 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 201000000498 stomach carcinoma Diseases 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/02—Nasal agents, e.g. decongestants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
Definitions
- the invention relates to management, treatment and prevention of allergic reactions, allergic diseases and allergic conditions by administation of IL-21. Further, the invention relates to treatment of parasitic diseases by administering IL-21 to patients infected with parasites.
- IL-21 which has also been termed Zalpha11 , is a cyto ine, which was shown to be produced by activated CD4+ T lymphocytes after stimulation with anti-CD3, phorbol ester plus ionomycin (Parrish-Novak et al., Nature 408, 57 - 63 (2000)).
- Eosinophils play a central in the development of asthma and other allergic diseases (reviewed in Foster et al., TRENDS in Molecular Medicine 8, 162 - 167 (2002)).
- Eosinophils are produced from stem cells in the bone marrow ('eosinopoiesis') in response to IL-5 and eotaxin, and the eosinophils migrate via the blood to the lungs where they are activated.
- Such activated eosinophils release proinflammatory molecules and granular proteins, which can damage the lung tissue and induce airways hyperresponsiveness.
- T helper 2 lymphocytes in the lungs orchestrate most cellular reactions via their release of T H 2 cytokines' (i.e. IL-4, IL-5, IL- 9, IL-10 and IL-13).
- T H 2 cytokines' i.e. IL-4, IL-5, IL- 9, IL-10 and IL-13.
- eosinophils and basophils act as effector cells only (reviewed in Wills-Karp et al. Annu. Rev. Immunol. 17, 255 (1999)).
- IL-21 is produced by, stored in and released by human eosinophilic granulocytes (hereinafter 'eosinophils').
- IL-21 has been shown to act as a co- stimulatory cytokine for proliferation of T and B lymphocytes (Parrish-Novak et al., supra).
- eosinophils may in addition to their role as primary effector cells, which damage the respiratory epithelium, also play another - to this point unrecognized - protective effect by releasing IL-21.
- Released IL-21 from eosinophils (hereinafter 'eosinophilic IL-21 ') may in turn either directly, or in concert with other cytokines, prevent differentiation and activation of cells involved in allergic reactions and thereby contribute to a less severe allergic reaction. According to this view, eosinophils may play a dual role in allergic reactions.
- allergic conditions or diseases include asthma, anaphylaxis, drug reactions, food allergy, insect venom allergy, allergic rhinitis, urticaria, eczema, atopic dermatitis, allergic contact allergy, allergic conjunctivitis.
- allergic reaction, allergic diseases or allergic conditions may be managed, treated or prevented by administering IL-21.
- Eosinophils are further important for combating parasitic diseases including but not limited to helminthic infections.
- the present invention relates to a method for treating, preventing and/or managing allergic diseases or conditions by administration of IL-2 .
- Eosinophils may be involved in the protective response to allergic reactions, diseases and conditions.
- the invention relates to managing, treating and preventing allergic reactions, conditions and diseases by administration of IL-21.
- polypeptide is a polymer of amino acid residues linked by peptide bonds, and may be produced naturally or synthetically. Polypeptides of less than about 10 amino acid residues are commonly referred to as “peptides”.
- a “protein” is a macromolecule comprising one or more polypeptide chains, which may be produced naturally or synthetically.
- a protein may also comprise non-peptidic components, such as carbohydrate groups or other non-peptidic substituents. Carbohydrates and other non-peptidic substituents may be added to a protein by the cell in which the protein is produced, and will vary with the type of cell. Carbohydrates and other non-peptidic substituents may also be added synthetically after the cell-based production of the protein.
- Proteins are defined herein in terms of their amino acid backbone structures; substituents such as carbohydrate groups or other non-peptidic substituents are generally not specified, but may be present nonetheless.
- the present invention also contemplates the use of IL-21 polypeptides which as used herein should be taken to mean polypeptides with a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs comprising at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%.
- the present invention also includes the use of polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. Methods for determining percent identity are described below.
- the IL-21 polypeptides of the present invention have retained all or some of the biological activity of IL-21 which makes IL-21 useful for treating allergic reactions, allergic diseases and allergic conditions. Some of the polypeptides may also have a biological activity which is higher than the biological activity of IL-21.
- Eosinophilic cells eosinophilic granulocytes
- eosinophils eosinophils
- leukocytes that contain red-staining eosinophil granules (e.g. with Wright's or Hematoxylin & Eosin stain). Eosinophils are involved both in normal physiological reactions and in disease processes.
- eosinophils in the bone marrow include (i) eosinophils in the bone marrow, (ii) eosinophils circulating in peripheral blood, (Hi) eosinophils involved allergic reactions (including but not limited to asthma, anaphylaxis, drug reactions, food allergy, insect venom allergy, allergic rhinitis, urticaria, eczema, atopic dermatitis, allergic contact allergy, allergic conjunctivitis), (iv) eosinophils involved in malignant diseases (with Hodgkin's lymphoma, mycosis fungoides, chronic myelogenous leukemia, and cancer of the lung, stomach, pancreas, ovary or uterus as non-limiting examples), (v) eosinophils involved in autoimmune reactions, (vi) eosinophils involved in collagen vascular diseases (with rheumatoid arthritis and periarteritis as non-limiting
- Eosinophilic IL-21 should be taken to mean IL-21 that is produced by, stored in and/or secreted by eosinophilic granulocytes.
- treatment means the management and care of a patient for the purpose of combating a condition, such as a disease or a disorder.
- the term is intended to include the full spectrum of treatments for a given condition from which the patient is suffering, such as prevention of the condition, the delaying of the progression of the disease, disorder or condition, the alleviation or relief of symptoms and complications, and/or the cure or elimination of the disease, disorder or condition.
- the patient to be treated is preferably a mammal, in particular a human being.
- SEQ ID NO. 1 DNA sequence encoding IL-21.
- SEQ ID NO. 2 amino acid sequence of IL-21.
- Eosinophils synthesize, store and/or secrete IL-21. Eosinophils may be involved in the protective response to allergic reactions, diseases and conditions.
- the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of IL-21 to a subject in need thereof. In one embodiment, the invention relates to treating allergic reactions, conditions and diseases by administration of IL-21 to a subject in need thereof.
- the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of IL-21 polypeptides that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%.
- the present invention also includes the use of polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. Methods for determining percent identity are described below.
- polypeptides of the present invention having a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs as described above have retained all or some of the biological activity of IL-21 which makes IL-21 useful for treating allergic reactions, allergic diseases and allergic conditions.
- the invention relates to treating allergic reactions, conditions and diseases by administration of IL-21 polypeptides that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%.
- the present invention also includes the use of polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. Methods for determining percent identity are described below.
- the polypeptides of the present invention having a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs as described above have retained all or some of the biological activity of IL-21 which makes IL-21 useful for treating allergic reactions, allergic diseases and allergic conditions.
- the invention relates to treating diseases or conditions where eosinophils are involved, including but not limited to allergic reactions or conditions, by administration of an IL-21 mimetic, that is a compound which is not an IL-21 polypeptide as described above, but which has the biological activity of IL-21.
- An IL-21 mimetic may be a peptide, such as a polypeptide or an oligopeptide or may be non-proteins, such as a smaller organic molecule.
- the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of an IL-21 mimetic, that is a compound which is not an IL-21 polypeptide as described above, but which has the biological activity of IL-21.
- An IL-21 mimetic may be a peptide, such as a polypeptide or an oligopeptide or may be non- proteins, such as a smaller organic molecule.
- the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of a polynucleotide encoding IL-21 or a IL-21 polypeptide that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs, of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%.
- the present invention relates to managing, treating and preventing allergic reactions, conditions and diseases by administration of a polynucleotide encoding polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2.
- a polynucleotide encoding polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2.
- SEQ ID No. 1 coding for a polypeptide with a sequence as shown in SEQ ID No. 2.
- the invention relates to treating allergic reactions, conditions and diseases by administration of a polynucleotide encoding IL-21 or a IL-21 polypeptide that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs, of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%.
- the present invention relates to managing, treating and preventing allergic reactions, conditions and diseases by administration of a polynucleotide encoding polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2.
- Percentage sequence identity between two amino acid sequences is determined by a Needelman-Wunsch alignment, useful for both protein and DNA alignments.
- the default scoring matrix used is BLOSUM50, and the penalty for the first residue in a gap is -12, while the penalty for additional residues in a gap is -2.
- the alignment may be made with the Align software from the FASTA package version v20u6 (W.R. Pearson and D.J. Lipman (1988), "Improved Tools for Biological Sequence Analysis", PNAS 85:2444- 2448; and W.R. Pearson (1990) "Rapid and Sensitive Sequence Comparison with FASTP and FASTA", Methods in Enzymology, 183:63-98).
- IL-21 or other IL-21 polypeptides for use in treating asthma or other allergic conditions according to the present invention may be administered alone or in combination with other established therapies such as ⁇ 2-agonists, cromolyn, leukotriene receptor antagonists, corticosteroidcytokines, cytokine antagonists, interleukins and interleukin antagonists, which are only provided as non-limiting examples.
- therapies such as ⁇ 2-agonists, cromolyn, leukotriene receptor antagonists, corticosteroidcytokines, cytokine antagonists, interleukins and interleukin antagonists, which are only provided as non-limiting examples.
- IL-21 or other IL-21 polypeptides for use in treating asthma or other allergic conditions according to the present invention may be administered alone or in combination with pharmaceutically acceptable carriers or excipients, in either single or multiple doses.
- the pharmaceutical compositions comprising IL-21 or other IL-21 polypeptides for use in treating asthma or other allergic conditions according to the present invention may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in Remington: The Science and Practice of Pharmacy, 19 th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995.
- the compositions may appear in conventional forms, for example capsules, tablets, aerosols, solutions or suspensions
- compositions may be specifically formulated for administration by any suitable route such as the oral, rectal, nasal, pulmonary, topical (including buccal and sublingual), transdermal, intracisternal, intraperitoneal, vaginal and parenteral (including subcutaneous, intramuscular, intrathecal, intravenous and intradermal) route.
- suitable route such as the oral, rectal, nasal, pulmonary, topical (including buccal and sublingual), transdermal, intracisternal, intraperitoneal, vaginal and parenteral (including subcutaneous, intramuscular, intrathecal, intravenous and intradermal) route.
- the route of administration may be any route, which effectively transports the active compound to the appropriate or desired site of action.
- compositions for oral administration include solid dosage forms such as hard or soft capsules, tablets, troches, dragees, pills, lozenges, powders and granules. Where appropriate, they can be prepared with coatings such as enteric coatings or they can be formulated so as to provide controlled release of the active ingredient such as sustained or prolonged release according to methods well known in the art.
- Liquid dosage forms for oral administration include solutions, emulsions, aqueous or oily suspensions, syrups and elixirs.
- Pharmaceutical compositions for parenteral administration include sterile aqueous ' and non-aqueous injectable solutions, dispersions, suspensions or emulsions as well as sterile powders to be reconstituted in sterile injectable solutions or dispersions prior to use. Depot injectable formulations are also contemplated as being within the scope of the present invention.
- Other suitable administration forms include suppositories, sprays, ointments, cre es, gels, inhalants, dermal patches, implants etc.
- a typical oral dosage is in the range of from about 0.001 to about 100 mg/kg body weight per day, such as from about 0.01 to about 50 mg/kg body weight per day, for example from about 0.05 to about 10 mg/kg body weight per day administered in one or more dosages such as 1 to 3 dosages.
- the exact dosage will depend upon the nature of the IL-21 polypeptide chosen, the frequency and mode of administration, the sex, age, weight and general condition of the subject treated, the nature and severity of the condition treated and any concomitant diseases to be treated and other factors evident to those skilled in the art.
- the formulations may conveniently be presented in unit dosage form by methods known to those skilled in the art.
- a typical unit dosage form for oral administration one or more times per day such as 1 to 3 times per day may contain from 0.05 to about 1000 mg, for example from about 0.1 to about 500 mg, such as from about 0.5 mg to about 200 mg.
- parenteral routes such as intravenous, intrathecal, intramuscular and similar administration, typically doses are in the order of about half the dose employed for oral administration. '
- Non-protein IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention are generally utilized as the free substance or as a pharmaceutically acceptable salt thereof.
- examples are an acid addition salt of a compound having the utility of a free base and a base addition salt of a compound having the utility of a free acid.
- pharmaceutically acceptable salts refers to non-toxic salts of such compounds which are generally prepared by reacting the free base with a suitable organic or inorganic acid or by reacting the acid with a suitable organic or inorganic base. When such a compound contains a free base such salts are prepared in a conventional manner by treating a solution or suspension of the compound with a chemical equivalent of a pharmaceutically acceptable acid.
- salts are prepared in a conventional manner by treating a solution or suspension of the compound with a chemical equivalent of a pharmaceutically acceptable base.
- Physiologically acceptable salts of a compound with a hydroxy group include the anion of said compound in combination with a suitable cation such as sodium or ammonium ion.
- Other salts which are not pharmaceutically acceptable may be useful in the preparation of compounds of the invention and these form a further aspect of the invention.
- Salts of IL-21 polypeptides are especially relevant when the protein is in solid or crystalline form
- solutions of the IL-21 polypeptides or IL-21 mimetics in sterile aqueous solution, aqueous propylene glycol or sesame or peanut oil may be employed.
- aqueous solutions should be suitably buffered if necessary and the liquid diluent first rendered isotonic with, sufficient saline or glucose.
- the aqueous solutions are particularly suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- the sterile aqueous media employed are all readily available by standard techniques known to those skilled in the art.
- Suitable pharmaceutical carriers include inert solid diluents or fillers, sterile aqueous solution and various organic solvents.
- solid carriers are lactose, terra alba, sucrose, cyclodextrin, talc, gelatine, agar, pectin, acacia, magnesium stearate, stearic acid and lower alkyl ethers of cellulose.
- liquid carriers are syrup, peanut oil, olive oil, phospholipids, fatty acids, fatty acid amines, polyoxyethylene and water.
- the carrier or diluent may include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
- compositions formed by combining a IL-21 polypeptide or IL-21 mimetic for use in treating asthma or other allergic conditions according to the present invention and the pharmaceutically acceptable carriers are then readily administered in a variety of dosage forms suitable for the disclosed routes of administration.
- the formulations may conveniently be presented in unit dosage form by methods known in the art of pharmacy.
- the preparation may contain a IL-21 polypeptide or IL-21 mimetic dissolved or suspended in a liquid carrier, in particular an aqueous carrier, for aerosol application.
- a liquid carrier in particular an aqueous carrier
- the carrier may contain additives such as solubilizing agents, e.g. propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabenes.
- Formulations of IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention suitable for oral administration may be presented as discrete units such as capsules or tablets, each containing a predetermined amount of the active ingredient, and which may include a suitable excipient.
- the orally available formulations may be in the form of a powder or granules, a solution or suspension in an aqueous or non-aqueous liquid, or an oil-in-water or water-in-oil liquid emulsion.
- compositions intended for oral use may be prepared according to any known method, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavouring agents, colouring agents, and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
- Tablets may contain the active ingredient in admixture with non-toxic pharmaceutically-acceptable excipients which are suitable for the manufacture of tablets.
- excipients may be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example corn starch or alginic acid; binding agents, for example, starch, gelatine or acacia; and lubricating agents, for example magnesium stearate, stearic acid or talc.
- the tablets may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
- a time delay material such as glyceryl monostearate or glyceryl distearate may be employed. They may also be coated by the techniques described in U.S. Patent Nos. 4,356,108; 4,166,452; and 4,265,874, incorporated herein by reference, to form osmotic therapeutic tablets for controlled release.
- Formulations for oral use may also be presented as hard gelatine capsules where the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or a soft gelatine capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin, or olive oil.
- Aqueous suspensions may contain the IL-21 polypeptides or IL-21 mimetics in admixture with excipients suitable for the manufacture of aqueous suspensions.
- excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents may be a naturally-occurring phosphatide such as lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example, heptadecaethyl-eneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbitan monooleate.
- the aqueous suspensions may also contain one or more colouring agents, one or more flavouring agents,
- Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as a liquid paraffin.
- the oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol.
- Sweetening agents such as those set forth above, and flavouring agents may be added to provide a palatable oral preparation.
- These compositions may be preserved by the addition of an anti-oxidant such as ascorbic acid.
- Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active compound in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified by those already mentioned above. Additional excipients, for example, sweetening, flavouring, and colouring agents may also be present.
- compositions of IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions may also be in the form of oil-in-water emulsions.
- the oily phase may be a vegetable oil, for example, olive oil or arachis oil, or a mineral oil, for example a liquid paraffin, or a mixture thereof.
- Suitable emulsifying agents may be naturally-occurring gums, for example gum acacia or gum tragacanth, naturally-occurring phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol anhydrides, for example sorbitan monooleate, and condensation products of said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate.
- the emulsions may also contain sweetening and flavouring agents.
- Syrups and elixirs may be formulated with sweetening agents, for example glycerol, propylene glycol, sorbitol or sucrose. Such formulations may also contain a demulcent, preservatives and flavouring and colouring agents.
- the pharmaceutical compositions may be in the form of a sterile injectible aqueous or oleaginous suspension. This suspension may be formulated according to the known methods using suitable dispersing or wetting agents and suspending agents described above.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1 ,3-butanediol.
- Suitable vehicles and solvents that may be employed are water, Ringer's solution, and isotonic sodium chloride solution.
- sterile, fixed oils are conveniently employed as solvent or suspending medium.
- any bland fixed oil may be employed using synthetic mono- or diglycerides.
- fatty acids such as oleic acid find use in the preparation of injectables.
- compositions may also be in the form of suppositories for rectal administration of the compounds of the invention.
- These compositions can be prepared by mixing the drug with a suitable non-irritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will thus melt in the rectum to release the drug.
- suitable non-irritating excipient include cocoa butter and polyethylene glycols, for example.
- topical applications For topical use, creams, ointments, jellies, solutions of suspensions, etc., containing the compounds of the invention are contemplated.
- topical applications shall include mouth washes and gargles.
- IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention may also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles, and multilamellar vesicles.
- liposomes may be formed from a variety of phospholipids, such as cholesterol, stearylamine, or phosphatidylcholines.
- IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions may form solvates with water or common organic solvents. Such solvates are also encompassed within the scope of the invention.
- a solid carrier is used for oral administration, the preparation may be tabletted, placed in a hard gelatine capsule in powder or pellet form or it can be in the form of a troche or lozenge. The amount of solid carrier will vary widely but will usually be from about 25 mg to about 1 g. If a liquid carrier is used, the preparation may be in the form of a syrup, emulsion, soft gelatine capsule or sterile injectable liquid such as an aqueous or non-aqueous liquid suspension or solution.
- the IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic, conditions according to the present invention may be administered to a mammal, especially a human, in need of such treatment.
- mammals include also animals, both domestic animals, e.g. household pets, and non-domestic animals such as wildlife.
- Pharmaceutical compositions containing a compound according to the invention may be administered one or more times per day or week, conveniently administered at mealtimes.
- An effective amount of such a pharmaceutical composition is the amount that provides a clinically significant effect. Such amounts will depend, in part, on the particular condition to be treated, age, weight, and general health of the patient, and other factors evident to those skilled in the art.
- DAKO tumor multislide DAKO cat. No. T1064
- IL-21 and IL-21 R mRNA are expressed in Hodgkin Lymphoma specimens.
- the signal is seen in several specimens of Hodgkins disease derived from different patients. All other types of cancers that are represented on the multislide (approximately 20 different types) show no expression of IL-21 or IL-21 R mRNA.
- Probe preparation In situ hybridization is performed with a probe generated by in vitro transcription from a plasmid containing the following cDNA fragment: A PCR fragment of human IL-21 containing basepair 344 to basepair 833 (acc.no.: AF254069 (se Table'A)) containing a single mismatch compared to the published sequence was cloned into the transcription vector pCRBIunt II (Invitrogen).
- the specific activity of the S-35 labelled probe was 80000 cpm/ml in the final hybridization mixture (consisting of 10 x SALTS, deionised Formamid, 50% dextransulphate, t-RNA (10 mg/ml), 1.0 M DTT). The sections were hybridized overnight at 47°C.
- Tris (pH 6.8), 10 mM NaPO 4 , 5 mM EDTA, 0.02% Ficoll 400, 0.02% polyvinylpyrolidone, and 0.02% BSA) and 10 mM dithiothreitiol for 1 hour at 57°C and 1 hour at 62°C.
- RNAse A treatment (20 ⁇ g/ml RNase A) in 0.5 M NaCI, 10 mM Tris-CI (pH 7.2), 1 mM EDTA) at 37°C for 30 min.
- the sections were washed for 30 min. in 0.1 x SSC at room temperature. The sections were dipped in autoradiographic emulsion and exposed for 21 days.
- IL-21 mRNA is expressed predominantly in eosinophilic granulocytes ( Figure 1a). Following in situ hybridization the sections are counterstained with hematoxylin and eosin (H&E) whereby it is possible to morphologically identify the IL-21 mRNA positive cells as eosinophils (arrows in figure 1b). In specimens with lymphocytic predominance expression of IL-21 mRNA is found in small clusters of lymphocytes surrounding Reed-Stemberg cells (figure 2)
- IL-21 R mRNA is diffusely expressed in lymphocytes in both the eosinophilic and lymphocytic types of histopathology (figure 3)
- IL-21 in eosinophils may indicate that said eosinophilic IL-21 exerts a protective role.
- eosinophilic infiltration or increased number of eosinophils in body fluids and/or tissues in certain disorders or disease states or conditions may indicate that said eosinophils play a protective role by releasing IL-21 , which in turn reduces an allergic reaction or allergic disease.
- diseases where eosinophils are involved in a protective role including but not limited to allergic diseases may be treated by administration of IL-21 polypeptides or IL-21 mimetics.
- IL-21 and the IL-21 receptor may play a role in the patho-physiology of Hodgkin's Lymphoma, and IL-21 signalling may therefore be a target for pharmacological intervention in Hodgkin's disease.
- IL-21 in lymphocytes immediately surrounding the malignant Reed-Sternberg cells indicate that the IL-21 mRNA expression is involved in a cross-talk between Reed-Sternberg cells and surrounding lymphocytes and the IL-21 expression may even be induced by the Reed-Sternberg cells.
- HI-60 cells are cultured in the presence of butyric acid to induce an eosinophil-like pheno- type, and are subsequently cultured with cytokines or growth factors, non limiting examples are GM-CSF, eotaxin, IL-4, IL-5 and IFN- ⁇ , and harvested after 1-72 hrs culture and analysed for IL-21 and IL-21 R mRNA expression by RT-PCR and for IL-21 protein expression by ELISA and IL-21 and IL-21 R protein expression by flow cytometry
- Eosinophils are isolated from human blood and cultured with cytokines or growth factors as described in Woerly et al., J.Leukoc.Biol.
- non limiting examples are GM-CSF, eotaxin, IL-4, IL-5 and IFN- ⁇ , and harvested after 1-72 hrs culture and analysed for IL-21 and IL-21 R mRNA expression by RT-PCR and for IL-21 protein expression by ELISA and IL-21 and IL-21 R protein expression by flow cy- tometry.
- Eosinophils are isolated from the blood from patients with allergic diseases and from healthy donors and analysed directly ex vivo for IL-21 and IL-21 R expression by RT-PCR, ELISA or flow cytometry, or stimulated with growth factors or cytokines before analysis of IL-21 and IL-21 R expression as described above.
- a method to demonstrate abnormal expression of IL-21 and IL-21 R in eosinophils from patients with allergic diseases Biopsies from patients with allergic diseases and from healthy donors challenged with relevant antigens are sectioned are stained by immunohistochemistry for IL-21 and IL-21 R expression together with a relevant marker to define the cell-type, for example EG-2 as an eosinophil marker.
- IL-21 deficient and wild type mice are immunized with ovalbumin and subsequently challenged by intranasal instillation of ovalbumin, and the airway respon- siveness, the cellular composition of the bronchoalveolar lavage, and cytokine, chemokine and IgE levels are measured as described in Hogan et al., J Immunol 171:2644-2651 (2003) or Medoff et al., J Immunol 168:5278-5286, 2002 or Denzler et al., J Immunol 65:5509-5517 (2000) or Ishimitsu et al., J Immunol 166:1991-2001 (2001). .
- An increased disease severity in IL-21 deficient mice indicates that IL-21 may be useful to treat asthma.
- mice are immunized with ovalbumin and subsequently challenged by intranasal instillation of ovalbumin. Before, after or together with ovalbumin challenge, the mice are treated with neutralizing IL-21 antibody. The airway responsiveness, the cellular composition of the bronchoalveolar lavage, and cytokine, chemokine and IgE levels are measured as described in Hogan et al.
- mice are immunized with ovalbumin and subsequently challenged by intranasal instillation of ovalbumin. Before, after or together with ovalbumin challenge, the mice are treated with IL-21 protein, a plasmid encoding IL-21 or buffer or control plasmid.
- IL-21 deficient and wild type mice are immunized with killed (frozen) microfilariae followed by i.v. injection with live microfilariae, and the allergic response is measured as described above and in Hall et al., Infect.lmmun. 66:4425-4430 (1998)
- mice are immunized with killed (frozen) microfilariae followed by i.v. injection with live microfilariae. Be- fore, after or together with injection of live microfilariae, the mice are treated with IL-21 protein, a plasmid encoding IL-21 or buffer or control plasmid.
- the allergic response is measured as described above and in Hall et al. as above.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Pulmonology (AREA)
- Immunology (AREA)
- Dermatology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Otolaryngology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to the administration of IL-21 for management, treatment and prevention of diseases or conditions where eosinophils are involved in a protective response e.g. allergic reactions, allergic diseases, allergic conditions and parasites diseases.
Description
TREATMENT OF ALLERGIC CONDITIONS BY USE OF IL 21
FIELD OF THE INVENTION
The invention relates to management, treatment and prevention of allergic reactions, allergic diseases and allergic conditions by administation of IL-21. Further, the invention relates to treatment of parasitic diseases by administering IL-21 to patients infected with parasites.
BACKGROUND OF THE INVENTION
IL-21, which has also been termed Zalpha11 , is a cyto ine, which was shown to be produced by activated CD4+ T lymphocytes after stimulation with anti-CD3, phorbol ester plus ionomycin (Parrish-Novak et al., Nature 408, 57 - 63 (2000)).
Numerous studies have shown that eosinophils play a central in the development of asthma and other allergic diseases (reviewed in Foster et al., TRENDS in Molecular Medicine 8, 162 - 167 (2002)). Eosinophils are produced from stem cells in the bone marrow ('eosinopoiesis') in response to IL-5 and eotaxin, and the eosinophils migrate via the blood to the lungs where they are activated. Such activated eosinophils release proinflammatory molecules and granular proteins, which can damage the lung tissue and induce airways hyperresponsiveness. It is widely held that so-called T helper 2 (TH2') lymphocytes in the lungs orchestrate most cellular reactions via their release of TH2 cytokines' (i.e. IL-4, IL-5, IL- 9, IL-10 and IL-13). According to this view, eosinophils and basophils act as effector cells only (reviewed in Wills-Karp et al. Annu. Rev. Immunol. 17, 255 (1999)). Surprisingly, we have now discovered that IL-21 is produced by, stored in and released by human eosinophilic granulocytes (hereinafter 'eosinophils'). IL-21 has been shown to act as a co- stimulatory cytokine for proliferation of T and B lymphocytes (Parrish-Novak et al., supra). Thus, eosinophils may in addition to their role as primary effector cells, which damage the respiratory epithelium, also play another - to this point unrecognized - protective effect by releasing IL-21. Released IL-21 from eosinophils (hereinafter 'eosinophilic IL-21 ') may in turn either directly, or in concert with other cytokines, prevent differentiation and activation of cells involved in allergic reactions and thereby contribute to a less severe allergic reaction. According to this view, eosinophils may play a dual role in allergic reactions. On one hand the release granular proteins from eosinophils can damage tissues, but on the other hand release of eosinophilic IL-21 may reduce the allergic reactions via an effect on other cells. Asthma has been increasing in prevalence, morbidity, and mortality over the last two
decades, and there is a strong need for improved treatment of asthma and other allergic diseases.
The above brief description of the central role of eosinophils in asthma is believed to apply to allergic reactions in general. A list of allergic conditions or diseases, which is not intended in anyway to limit the scope of the invention, include asthma, anaphylaxis, drug reactions, food allergy, insect venom allergy, allergic rhinitis, urticaria, eczema, atopic dermatitis, allergic contact allergy, allergic conjunctivitis. Such allergic reaction, allergic diseases or allergic conditions may be managed, treated or prevented by administering IL-21. Eosinophils are further important for combating parasitic diseases including but not limited to helminthic infections.
The present invention relates to a method for treating, preventing and/or managing allergic diseases or conditions by administration of IL-2 .
SUMMARY OF THE INVENTION It has been found that eosinophils synthesize, store and/or secrete IL-21.
Eosinophils may be involved in the protective response to allergic reactions, diseases and conditions. The invention relates to managing, treating and preventing allergic reactions, conditions and diseases by administration of IL-21.
, DEFINITIONS A "polypeptide" is a polymer of amino acid residues linked by peptide bonds, and may be produced naturally or synthetically. Polypeptides of less than about 10 amino acid residues are commonly referred to as "peptides".
A "protein" is a macromolecule comprising one or more polypeptide chains, which may be produced naturally or synthetically. A protein may also comprise non-peptidic components, such as carbohydrate groups or other non-peptidic substituents. Carbohydrates and other non-peptidic substituents may be added to a protein by the cell in which the protein is produced, and will vary with the type of cell. Carbohydrates and other non-peptidic substituents may also be added synthetically after the cell-based production of the protein.
Proteins are defined herein in terms of their amino acid backbone structures; substituents such as carbohydrate groups or other non-peptidic substituents are generally not specified, but may be present nonetheless.
International Patent Application No. PCT/US06067, publication no. WO 00/53761, published September 14, 2000, which is hereby incorporated in this application in its entirety,
discloses IL-21 (as "cytokine zalpha11 ligand") as SEQ ID No. 2, which is hereby incorporated in this application in its entirety, and which is also shown as SEQ ID No. 2 in this application, as well as methods for producing it and antibodies thereto and a polynucleotide sequence encoding IL-21 as SEQ ID No. 1. The present invention also contemplates the use of IL-21 polypeptides which as used herein should be taken to mean polypeptides with a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs comprising at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%. The present invention also includes the use of polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. Methods for determining percent identity are described below. The IL-21 polypeptides of the present invention have retained all or some of the biological activity of IL-21 which makes IL-21 useful for treating allergic reactions, allergic diseases and allergic conditions. Some of the polypeptides may also have a biological activity which is higher than the biological activity of IL-21.
"Eosinophilic cells", "eosinophilic granulocytes" or "eosinophils" are defined as leukocytes that contain red-staining eosinophil granules (e.g. with Wright's or Hematoxylin & Eosin stain). Eosinophils are involved both in normal physiological reactions and in disease processes. Included in the definition, but not limited to this definition, are (i) eosinophils in the bone marrow, (ii) eosinophils circulating in peripheral blood, (Hi) eosinophils involved allergic reactions (including but not limited to asthma, anaphylaxis, drug reactions, food allergy, insect venom allergy, allergic rhinitis, urticaria, eczema, atopic dermatitis, allergic contact allergy, allergic conjunctivitis), (iv) eosinophils involved in malignant diseases (with Hodgkin's lymphoma, mycosis fungoides, chronic myelogenous leukemia, and cancer of the lung, stomach, pancreas, ovary or uterus as non-limiting examples), (v) eosinophils involved in autoimmune reactions, (vi) eosinophils involved in collagen vascular diseases (with rheumatoid arthritis and periarteritis as non-limiting examples), (vii) eosinophils involved in helminthic infections, and/or (vii) eosinophils involved in iatrogenic disorders. Also included are eosinophils in Loeffler's syndrome, eosinophilia-myalgia syndrome and idiopathic hypereosinophilic syndromes.
"Eosinophilic IL-21", as used herein, should be taken to mean IL-21 that is produced by, stored in and/or secreted by eosinophilic granulocytes.
The term "treatment" and "treating" as used herein means the management and care of a patient for the purpose of combating a condition, such as a disease or a disorder. The term is intended to include the full spectrum of treatments for a given condition from
which the patient is suffering, such as prevention of the condition, the delaying of the progression of the disease, disorder or condition, the alleviation or relief of symptoms and complications, and/or the cure or elimination of the disease, disorder or condition. The patient to be treated is preferably a mammal, in particular a human being.
DESCRIPTION OF THE DRAWINGS
Figure 1a
In situ hybridization showing expression of IL-21 mRNA in a specimen of Hodgkin's Lymphoma with eosinophilic infiltration. Images of the same field are shown as brightfield in the left panels and as darkfield in the right panels. The signal for IL-21 mRNA is seen as bright spots in the darkfield images.
Figure 1b
In situ hybridization showing expression of IL-21 mRNA in eosinophils in a specimen of Hodgkin's Lymphoma with eosinophilic infiltration. In the high magnification picture at right the signal for IL-21 mRNA is visible as black silver grains over eosinophils (arrows).
Figure 2
In situ hybridization showing expression of IL-21 mRNA in a specimen of Hodgkin's Lymphoma with lymphocytic predominance. Images of the same field are shown as brightfield in the left panel and as darkfield in the right panel. The signal for IL-21 mRNA is seen over lymphocytes as bright spots surrounding the Reed-Sternberg cell (arrow) in the darkfield image.
Figure 3
In situ hybridization showing weak expression of IL-21 receptor mRNA in specimens of Hodgkin's Lymphoma with eosinophilic infiltration (upper panels) or with lymphocytic predominance (lower panels). Images of the same field are shown as brightfield in the left panels and as darkfield in the right panels. The weak signal for IL-21 R mRNA is seen diffusely all over the tissue as bright spots in the darkfield images.
Figure 4
SEQ ID NO. 1: DNA sequence encoding IL-21.
Figure 5
SEQ ID NO. 2: amino acid sequence of IL-21.
DESCRIPTION OF THE INVENTION
It has been found that eosinophils synthesize, store and/or secrete IL-21. Eosinophils may be involved in the protective response to allergic reactions, diseases and conditions.
In one embodiment, the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of IL-21 to a subject in need thereof. In one embodiment, the invention relates to treating allergic reactions, conditions and diseases by administration of IL-21 to a subject in need thereof.
In one embodiment, the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of IL-21 polypeptides that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%. The present invention also includes the use of polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. Methods for determining percent identity are described below. The polypeptides of the present invention having a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs as described above have retained all or some of the biological activity of IL-21 which makes IL-21 useful for treating allergic reactions, allergic diseases and allergic conditions.
In one embodiment, the invention relates to treating allergic reactions, conditions and diseases by administration of IL-21 polypeptides that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%. The present invention also includes the use of polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. Methods for determining percent identity are described below. The polypeptides of the present invention having a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs as described above have retained all or some of the biological activity of IL-21 which makes IL-21 useful for treating allergic reactions, allergic diseases and allergic conditions.
In one embodiment, the invention relates to treating diseases or conditions where eosinophils are involved, including but not limited to allergic reactions or conditions, by administration of an IL-21 mimetic, that is a compound which is not an IL-21 polypeptide as described above, but which has the biological activity of IL-21. An IL-21 mimetic may be a peptide, such as a polypeptide or an oligopeptide or may be non-proteins, such as a smaller organic molecule.
In one embodiment, the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of an IL-21 mimetic, that is a compound which is not an IL-21 polypeptide as described above, but which has the biological activity of IL-21. An IL-21 mimetic may be a peptide, such as a polypeptide or an oligopeptide or may be non- proteins, such as a smaller organic molecule.
In one embodiment, the invention relates to treating diseases or conditions where eosinophils are involved in a protective response, including but not limited to allergic reactions or conditions, by administration of a polynucleotide encoding IL-21 or a IL-21 polypeptide that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs, of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%. In a further embodiment, the present invention relates to managing, treating and preventing allergic reactions, conditions and diseases by administration of a polynucleotide encoding polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2. An example of such a polynucleotide is shown as SEQ ID No. 1 coding for a polypeptide with a sequence as shown in SEQ ID No. 2. In one embodiment, the invention relates to treating allergic reactions, conditions and diseases by administration of a polynucleotide encoding IL-21 or a IL-21 polypeptide that have a sequence identity to the polypeptide of SEQ ID No: 2, or their orthologs, of at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95%. In a further embodiment, the present invention relates to managing, treating and preventing allergic reactions, conditions and diseases by administration of a polynucleotide encoding polypeptides that comprise an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% or greater than 95% sequence identity to the sequence of amino acid residues 1 to 162, residues 30 to 162, or residues 33 to 162 of SEQ ID No: 2.
Percentage sequence identity between two amino acid sequences is determined by a Needelman-Wunsch alignment, useful for both protein and DNA alignments. For protein
alignments the default scoring matrix used is BLOSUM50, and the penalty for the first residue in a gap is -12, while the penalty for additional residues in a gap is -2. The alignment may be made with the Align software from the FASTA package version v20u6 (W.R. Pearson and D.J. Lipman (1988), "Improved Tools for Biological Sequence Analysis", PNAS 85:2444- 2448; and W.R. Pearson (1990) "Rapid and Sensitive Sequence Comparison with FASTP and FASTA", Methods in Enzymology, 183:63-98).
IL-21 or other IL-21 polypeptides for use in treating asthma or other allergic conditions according to the present invention may be administered alone or in combination with other established therapies such as β2-agonists, cromolyn, leukotriene receptor antagonists, corticosteroidcytokines, cytokine antagonists, interleukins and interleukin antagonists, which are only provided as non-limiting examples.
PHARMACEUTICAL COMPOSITIONS
IL-21 or other IL-21 polypeptides for use in treating asthma or other allergic conditions according to the present invention may be administered alone or in combination with pharmaceutically acceptable carriers or excipients, in either single or multiple doses. The pharmaceutical compositions comprising IL-21 or other IL-21 polypeptides for use in treating asthma or other allergic conditions according to the present invention may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in Remington: The Science and Practice of Pharmacy, 19th Edition, Gennaro, Ed., Mack Publishing Co., Easton, PA, 1995. The compositions may appear in conventional forms, for example capsules, tablets, aerosols, solutions or suspensions
The pharmaceutical compositions may be specifically formulated for administration by any suitable route such as the oral, rectal, nasal, pulmonary, topical (including buccal and sublingual), transdermal, intracisternal, intraperitoneal, vaginal and parenteral (including subcutaneous, intramuscular, intrathecal, intravenous and intradermal) route. It will be appreciated that the preferred route will depend on the general condition and age of the subject to be treated, the nature of the condition to be treated and the active ingredient chosen. The route of administration may be any route, which effectively transports the active compound to the appropriate or desired site of action.
Pharmaceutical compositions for oral administration include solid dosage forms such as hard or soft capsules, tablets, troches, dragees, pills, lozenges, powders and granules. Where appropriate, they can be prepared with coatings such as enteric coatings or
they can be formulated so as to provide controlled release of the active ingredient such as sustained or prolonged release according to methods well known in the art.
Liquid dosage forms for oral administration include solutions, emulsions, aqueous or oily suspensions, syrups and elixirs. * Pharmaceutical compositions for parenteral administration include sterile aqueous ' and non-aqueous injectable solutions, dispersions, suspensions or emulsions as well as sterile powders to be reconstituted in sterile injectable solutions or dispersions prior to use. Depot injectable formulations are also contemplated as being within the scope of the present invention. Other suitable administration forms include suppositories, sprays, ointments, cre es, gels, inhalants, dermal patches, implants etc.
A typical oral dosage is in the range of from about 0.001 to about 100 mg/kg body weight per day, such as from about 0.01 to about 50 mg/kg body weight per day, for example from about 0.05 to about 10 mg/kg body weight per day administered in one or more dosages such as 1 to 3 dosages. The exact dosage will depend upon the nature of the IL-21 polypeptide chosen, the frequency and mode of administration, the sex, age, weight and general condition of the subject treated, the nature and severity of the condition treated and any concomitant diseases to be treated and other factors evident to those skilled in the art. The formulations may conveniently be presented in unit dosage form by methods known to those skilled in the art. A typical unit dosage form for oral administration one or more times per day such as 1 to 3 times per day may contain from 0.05 to about 1000 mg, for example from about 0.1 to about 500 mg, such as from about 0.5 mg to about 200 mg. For parenteral routes such as intravenous, intrathecal, intramuscular and similar administration, typically doses are in the order of about half the dose employed for oral administration. '
Non-protein IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention are generally utilized as the free substance or as a pharmaceutically acceptable salt thereof. Examples are an acid addition salt of a compound having the utility of a free base and a base addition salt of a compound having the utility of a free acid. The term "pharmaceutically acceptable salts" refers to non-toxic salts of such compounds which are generally prepared by reacting the free base with a suitable organic or inorganic acid or by reacting the acid with a suitable organic or inorganic base. When such a compound contains a free base such salts are prepared in a conventional manner by treating a solution or suspension of the compound with a chemical equivalent of a pharmaceutically acceptable acid. When such a compound contains a free acid such salts are prepared in a
conventional manner by treating a solution or suspension of the compound with a chemical equivalent of a pharmaceutically acceptable base. Physiologically acceptable salts of a compound with a hydroxy group include the anion of said compound in combination with a suitable cation such as sodium or ammonium ion. Other salts which are not pharmaceutically acceptable may be useful in the preparation of compounds of the invention and these form a further aspect of the invention.
Salts of IL-21 polypeptides are especially relevant when the protein is in solid or crystalline form
For parenteral administration, solutions of the IL-21 polypeptides or IL-21 mimetics in sterile aqueous solution, aqueous propylene glycol or sesame or peanut oil may be employed. Such aqueous solutions should be suitably buffered if necessary and the liquid diluent first rendered isotonic with, sufficient saline or glucose. The aqueous solutions are particularly suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration. The sterile aqueous media employed are all readily available by standard techniques known to those skilled in the art.
Suitable pharmaceutical carriers include inert solid diluents or fillers, sterile aqueous solution and various organic solvents. Examples of solid carriers are lactose, terra alba, sucrose, cyclodextrin, talc, gelatine, agar, pectin, acacia, magnesium stearate, stearic acid and lower alkyl ethers of cellulose. Examples of liquid carriers are syrup, peanut oil, olive oil, phospholipids, fatty acids, fatty acid amines, polyoxyethylene and water. Similarly, the carrier or diluent may include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax. The pharmaceutical compositions formed by combining a IL-21 polypeptide or IL-21 mimetic for use in treating asthma or other allergic conditions according to the present invention and the pharmaceutically acceptable carriers are then readily administered in a variety of dosage forms suitable for the disclosed routes of administration. The formulations may conveniently be presented in unit dosage form by methods known in the art of pharmacy.
For nasal administration, the preparation may contain a IL-21 polypeptide or IL-21 mimetic dissolved or suspended in a liquid carrier, in particular an aqueous carrier, for aerosol application. The carrier may contain additives such as solubilizing agents, e.g. propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabenes.
Formulations of IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention suitable for oral administration may be presented as discrete units such as capsules or tablets, each containing a
predetermined amount of the active ingredient, and which may include a suitable excipient. Furthermore, the orally available formulations may be in the form of a powder or granules, a solution or suspension in an aqueous or non-aqueous liquid, or an oil-in-water or water-in-oil liquid emulsion. Compositions intended for oral use may be prepared according to any known method, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavouring agents, colouring agents, and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets may contain the active ingredient in admixture with non-toxic pharmaceutically-acceptable excipients which are suitable for the manufacture of tablets. These excipients may be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example corn starch or alginic acid; binding agents, for example, starch, gelatine or acacia; and lubricating agents, for example magnesium stearate, stearic acid or talc. The tablets may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate may be employed. They may also be coated by the techniques described in U.S. Patent Nos. 4,356,108; 4,166,452; and 4,265,874, incorporated herein by reference, to form osmotic therapeutic tablets for controlled release.
Formulations for oral use may also be presented as hard gelatine capsules where the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or a soft gelatine capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin, or olive oil. Aqueous suspensions may contain the IL-21 polypeptides or IL-21 mimetics in admixture with excipients suitable for the manufacture of aqueous suspensions. Such excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents may be a naturally-occurring phosphatide such as lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example, heptadecaethyl-eneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbitan
monooleate. The aqueous suspensions may also contain one or more colouring agents, one or more flavouring agents, and one or more sweetening agents, such as sucrose or saccharin.
Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as a liquid paraffin. The oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. Sweetening agents such as those set forth above, and flavouring agents may be added to provide a palatable oral preparation. These compositions may be preserved by the addition of an anti-oxidant such as ascorbic acid. Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active compound in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified by those already mentioned above. Additional excipients, for example, sweetening, flavouring, and colouring agents may also be present.
The pharmaceutical compositions of IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention may also be in the form of oil-in-water emulsions. The oily phase may be a vegetable oil, for example, olive oil or arachis oil, or a mineral oil, for example a liquid paraffin, or a mixture thereof. Suitable emulsifying agents may be naturally-occurring gums, for example gum acacia or gum tragacanth, naturally-occurring phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol anhydrides, for example sorbitan monooleate, and condensation products of said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate. The emulsions may also contain sweetening and flavouring agents.
Syrups and elixirs may be formulated with sweetening agents, for example glycerol, propylene glycol, sorbitol or sucrose. Such formulations may also contain a demulcent, preservatives and flavouring and colouring agents. The pharmaceutical compositions may be in the form of a sterile injectible aqueous or oleaginous suspension. This suspension may be formulated according to the known methods using suitable dispersing or wetting agents and suspending agents described above. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1 ,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, and isotonic sodium chloride solution. In addition, sterile, fixed oils are conveniently employed as solvent or suspending medium. For
this purpose, any bland fixed oil may be employed using synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables.
The compositions may also be in the form of suppositories for rectal administration of the compounds of the invention. These compositions can be prepared by mixing the drug with a suitable non-irritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will thus melt in the rectum to release the drug. Such materials include cocoa butter and polyethylene glycols, for example.
For topical use, creams, ointments, jellies, solutions of suspensions, etc., containing the compounds of the invention are contemplated. For the purpose of this application, topical applications shall include mouth washes and gargles.
The IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention may also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles, and multilamellar vesicles. Liposomes may be formed from a variety of phospholipids, such as cholesterol, stearylamine, or phosphatidylcholines.
In addition, some of the IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic conditions according to the present invention may form solvates with water or common organic solvents. Such solvates are also encompassed within the scope of the invention. If a solid carrier is used for oral administration, the preparation may be tabletted, placed in a hard gelatine capsule in powder or pellet form or it can be in the form of a troche or lozenge. The amount of solid carrier will vary widely but will usually be from about 25 mg to about 1 g. If a liquid carrier is used, the preparation may be in the form of a syrup, emulsion, soft gelatine capsule or sterile injectable liquid such as an aqueous or non-aqueous liquid suspension or solution.
The IL-21 polypeptides or IL-21 mimetics for use in treating asthma or other allergic, conditions according to the present invention may be administered to a mammal, especially a human, in need of such treatment. Such mammals include also animals, both domestic animals, e.g. household pets, and non-domestic animals such as wildlife. Pharmaceutical compositions containing a compound according to the invention may be administered one or more times per day or week, conveniently administered at mealtimes. An effective amount of such a pharmaceutical composition is the amount that provides a clinically significant effect. Such amounts will depend, in part, on the particular condition to be treated, age, weight, and general health of the patient, and other factors evident to those skilled in the art.
EXAMPLES
Expression of IL-21 and IL-21 R mRNA in Hodgkin Lymphoma
In situ hybridization analysis of tissue micro array slides (DAKO tumor multislide, DAKO cat. No. T1064) has revealed that IL-21 and IL-21 R mRNA are expressed in Hodgkin Lymphoma specimens. The signal is seen in several specimens of Hodgkins disease derived from different patients. All other types of cancers that are represented on the multislide (approximately 20 different types) show no expression of IL-21 or IL-21 R mRNA.
Probe preparation, hybridization conditions and Stringency washing:
Probe preparation: In situ hybridization is performed with a probe generated by in vitro transcription from a plasmid containing the following cDNA fragment: A PCR fragment of human IL-21 containing basepair 344 to basepair 833 (acc.no.: AF254069 (se Table'A)) containing a single mismatch compared to the published sequence was cloned into the transcription vector pCRBIunt II (Invitrogen). Hybridization:
The specific activity of the S-35 labelled probe was 80000 cpm/ml in the final hybridization mixture (consisting of 10 x SALTS, deionised Formamid, 50% dextransulphate, t-RNA (10 mg/ml), 1.0 M DTT). The sections were hybridized overnight at 47°C.
Stringency wash: The sections were washed in 50% formamide, 1x SALTS (300 mM NaCI, 10 mM
Tris (pH 6.8), 10 mM NaPO4, 5 mM EDTA, 0.02% Ficoll 400, 0.02% polyvinylpyrolidone, and 0.02% BSA) and 10 mM dithiothreitiol for 1 hour at 57°C and 1 hour at 62°C. After RNAse A treatment (20 μg/ml RNase A) in 0.5 M NaCI, 10 mM Tris-CI (pH 7.2), 1 mM EDTA) at 37°C for 30 min., the sections were washed for 30 min. in 0.1 x SSC at room temperature. The sections were dipped in autoradiographic emulsion and exposed for 21 days.
Results:
In the specimens belonging to the histomorphological defined subgroup of Hodgkins lymphoma with eosinophilic infiltration, IL-21 mRNA is expressed predominantly in eosinophilic granulocytes (Figure 1a). Following in situ hybridization the sections are counterstained with hematoxylin and eosin (H&E) whereby it is possible to morphologically
identify the IL-21 mRNA positive cells as eosinophils (arrows in figure 1b). In specimens with lymphocytic predominance expression of IL-21 mRNA is found in small clusters of lymphocytes surrounding Reed-Stemberg cells (figure 2)
IL-21 R mRNA is diffusely expressed in lymphocytes in both the eosinophilic and lymphocytic types of histopathology (figure 3)
Conclusion:
The expression of IL-21 in eosinophils may indicate that said eosinophilic IL-21 exerts a protective role. According to this view, eosinophilic infiltration or increased number of eosinophils in body fluids and/or tissues in certain disorders or disease states or conditions may indicate that said eosinophils play a protective role by releasing IL-21 , which in turn reduces an allergic reaction or allergic disease. Thus, diseases where eosinophils are involved in a protective role, including but not limited to allergic diseases may be treated by administration of IL-21 polypeptides or IL-21 mimetics.
IL-21 and the IL-21 receptor may play a role in the patho-physiology of Hodgkin's Lymphoma, and IL-21 signalling may therefore be a target for pharmacological intervention in Hodgkin's disease.
Particularly the distinct expression of IL-21 in lymphocytes immediately surrounding the malignant Reed-Sternberg cells indicate that the IL-21 mRNA expression is involved in a cross-talk between Reed-Sternberg cells and surrounding lymphocytes and the IL-21 expression may even be induced by the Reed-Sternberg cells.
A method to demonstrate IL-21 and IL-21 R expression in an eosinophil-like cell-line, HL-60: HI-60 cells are cultured in the presence of butyric acid to induce an eosinophil-like pheno- type, and are subsequently cultured with cytokines or growth factors, non limiting examples are GM-CSF, eotaxin, IL-4, IL-5 and IFN-γ, and harvested after 1-72 hrs culture and analysed for IL-21 and IL-21 R mRNA expression by RT-PCR and for IL-21 protein expression by ELISA and IL-21 and IL-21 R protein expression by flow cytometry
A method to demonstrate IL-21 and IL-21 R expression in eosinophils: Eosinophils are isolated from human blood and cultured with cytokines or growth factors as described in Woerly et al., J.Leukoc.Biol. 72:769-779, 2002; Schmid-Grendelmeier et al., J Immunol 169:1021- 1027, 2002, non limiting examples are GM-CSF, eotaxin, IL-4, IL-5 and IFN-γ, and harvested
after 1-72 hrs culture and analysed for IL-21 and IL-21 R mRNA expression by RT-PCR and for IL-21 protein expression by ELISA and IL-21 and IL-21 R protein expression by flow cy- tometry.
A method to demonstrate abnormal expression of IL-21 and IL-21 R in eosinophils from patients with allergic diseases: Eosinophils are isolated from the blood from patients with allergic diseases and from healthy donors and analysed directly ex vivo for IL-21 and IL-21 R expression by RT-PCR, ELISA or flow cytometry, or stimulated with growth factors or cytokines before analysis of IL-21 and IL-21 R expression as described above.
A method to demonstrate abnormal expression of IL-21 and IL-21 R in eosinophils from patients with allergic diseases: Biopsies from patients with allergic diseases and from healthy donors challenged with relevant antigens are sectioned are stained by immunohistochemistry for IL-21 and IL-21 R expression together with a relevant marker to define the cell-type, for example EG-2 as an eosinophil marker.
A method to demonstrate that absence of IL-21 leads to increased disease severity in a mouse model of asthma: IL-21 deficient and wild type mice are immunized with ovalbumin and subsequently challenged by intranasal instillation of ovalbumin, and the airway respon- siveness, the cellular composition of the bronchoalveolar lavage, and cytokine, chemokine and IgE levels are measured as described in Hogan et al., J Immunol 171:2644-2651 (2003) or Medoff et al., J Immunol 168:5278-5286, 2002 or Denzler et al., J Immunol 65:5509-5517 (2000) or Ishimitsu et al., J Immunol 166:1991-2001 (2001). . An increased disease severity in IL-21 deficient mice indicates that IL-21 may be useful to treat asthma.
A method to demonstrate that neutralization of IL-21 leads to increased disease severity in a mouse model of asthma: Mice are immunized with ovalbumin and subsequently challenged by intranasal instillation of ovalbumin. Before, after or together with ovalbumin challenge, the mice are treated with neutralizing IL-21 antibody. The airway responsiveness, the cellular composition of the bronchoalveolar lavage, and cytokine, chemokine and IgE levels are measured as described in Hogan et al. J Immunol 171 :2644-2651 (2003) or Medoff et al., J Immunol 168:5278-5286 (2002) or Denzler et al., J Immunol 165:5509-5517 (2000) or Ishi-
mitsu et al., J Immunol 166:1991-2001 (2001). An increased disease severity in mice treated with neutralizing IL-21 antibody indicates that IL-21 may be useful to treat asthma.
A method to demonstrate that IL-21 treatment leads to diminished disease severity in a mouse model of asthma: Mice are immunized with ovalbumin and subsequently challenged by intranasal instillation of ovalbumin. Before, after or together with ovalbumin challenge, the mice are treated with IL-21 protein, a plasmid encoding IL-21 or buffer or control plasmid. The airway responsiveness, the cellular composition of the bronchoalveolar lavage, and cytokine, chemokine and IgE levels are measured as described in Hogan et al., J Immunol 171 :2644-2651 (2003) or Medoff et al., J Immunol 168:5278-5286 (2002) or Denzler et al., J Immunol 165:5509-5517 (2000) or Ishimitsu et al., J Immunol 166:1991-2001 (2001).
A method to demonstrate that absence of IL-21 leads to increased disease severity in helminthic infections: IL-21 deficient and wild type mice are immunized with killed (frozen) microfilariae followed by i.v. injection with live microfilariae, and the allergic response is measured as described above and in Hall et al., Infect.lmmun. 66:4425-4430 (1998)
A method to demonstrate that IL-21 may be used to treat helminthic infections: mice are immunized with killed (frozen) microfilariae followed by i.v. injection with live microfilariae. Be- fore, after or together with injection of live microfilariae, the mice are treated with IL-21 protein, a plasmid encoding IL-21 or buffer or control plasmid. The allergic response is measured as described above and in Hall et al. as above.
Table A
Human IL-21 cDNA fragment generation:
Interleukin 21 (IL-21) protein accession no. Q9HBE4. Interleukin 21 (IL-21) original DNA accession no. AF254069. Probe seguence 489 bp:
ATGAGATCCAGTCCTGGCAACATGGAGAGGATTGTCATCTGTCTGATGGTCATCTTCTT GGGGACACTGGTCCACAAATCAAGCTCCCAAGGTCAAGATCGCCACATGATTAGAATGC GTCAACTTATAGATATTGTTGATCAGCTGAAAAATTATGTGAATGACTTGGTCCCTGAATT TCTACCAGCTCCAGAAGATGTAGAGACA CTGTGAGTGGTCAGCTTTTTCCTGTTTTCA GAAGGCCCAACTAAAGTCAGCAAATACAGGAAACAATGAAAGGATAATCAATGTATCAAT TAAAAAGCTGAAGAGGAAACCACCTTCCACAAATGCAGGGAGAAGACAGAAACACAGAC TAACATGCCCTTCATGTGATTCTTATGAGAAAAAACCACCCAAAGAATTCCTAGAAAGAT TCAAATCACTTCTCCAAAAGATGATTCATCAGCATCTGTCCTCTAGAACACACGGAAGTG AAGATTCCTGA
embl|af254069 |af254069 Homo sapiens interleukin 21 (IL-21) mRNA, complete cds. Lengt = 642 Score = 961 bits (4S5) , Expect = 0.0 Identities = 4SS/489 (99%) Strand = Plus / Plus
Query: 1 atgagatccagtcctggcaacatggagaggattgtcatctgtctgatggtcatcttcttg 60
Sbjct: 47 altlglalglaltlclcMagMtcIcItIgIgIcIaIaIcIaItIgIgIaIgIaIgIgIaItItIgItIcIaItIcltlgltlcltlglaltlglgltlclaltlcltltlcitntgi 106 Query: 61 gggacactggtccaσaaatcaagctcccaaggtcaagatcgccacatgattagaatgcgt 120
Sbjct: 107 g igigiaicMacmtggitMcciaicmaaamtcaiaigiciticiciciaiaigigiticiaiaigiaiticigmccaiciaitigiaitmtagiaiaitigicigiti 166
Query: 121 caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggtccctgaattt 180 111111111111111111111 I I 111111111111111111111111 I II 1111111111
Sbjct: 167 caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggtccctgaattt 226
Query: 181 ctaccagctccagaagatgtagagacaaactgtgagtggtcagctttttcctgttttcag 240 Sbjct: _27 c itigc icmagciticiciaigiamagamtgtiamgagiaiciamaacitMgtigiaigitigigitmcagMctititmttcmctgmtttitmcagi 286 Query: 241 aaggcccaactaaagtcagcaaatacaggaaacaatgaaaggataatcaatgtatcaatt 300
Sbjct: 287 a iaigigiciciciaiaicitiaiaiaigiticiaigicmaaamtaciaigigiamaacmaatmgaaiaigigiamtaaiticiaiaitigitiaiticiaiaititi 346
Query: 301 aaaaagctgaagaggaaaccaccttccacaaatgcagggagaagacagaaacacagacta 360
Sbjct: 347 a iaiamaagicitigiaiaigiaigigiaiaMaciciaicicititmccaicmaaamtgcmaggigmagaiaigiaiciaugaiamacamcagiaicitiai 406 Query: 361 acatgcccttcatgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc 420
Sbjct: 407 a icmatgicicicititiciaitigitigiaititMctitiaitigiaigmaaaiaiamacciaicicicmaaaigiamattmcctiamgaaiaigMatitici 466
Query: 421 aaatcacttctccaaaagatgattcatcagcatctgtcctctagaacacacggaagtgaa 480 I I I I I I I I I I I I I I I I I I 11 I I I I I I I I I I I I I I I I 11 I I I I I I I I I I 11 I I I 11 I I I I I
Sbjct: 467 aaatcacttctccaaaagatgattcatcagcatctgtcctctagaacacacggaagtgaa 526 Query: 481 gattcctga 489 Sbjct : 527 g iaititmcctmga 535
TABLE B
Human IL-21 amino acid seguence protein accession no. Q9HBE4. also shown as SEQ ID No. 2, including the signal peptide comprising residues 1 to 29:
1...MRSSPGNMERIVICL^ IFLGTL HKSSSQGQDRHMIRMRQLIDIVDQLK...50 51..NYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNERIINVSI...100 101.KKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQK IHQ...150 151 HLSSRTHGSEDS
Claims
1. Use of IL-21 for the manufacture of a medicament for the treatment of diseases or conditions where eosinophils are involved in a protective response in a subject in need thereof.
2. Use of IL-21 for the manufacture of a medicament for the treatment of allergic conditions in a subject in need thereof.
3. Use according to claim 1 and claim 2 wherein the allergic condition are asthma, allergic rhinitis or allergic diseases in the skin.
4. Use of IL-21 for the manufacture of a medicament for the treatment of parasitic diseases in a subject in need thereof.
5. Use according to claim 4, where the parasitic disease is a helminthic infection.
6. Use of an IL-21 polypeptide having a sequence identity to the polypeptide of SEQ ID No: 2, or to residues 30 to 162 of SEQ ID No: 2, of at least 70% for the manufacture of a medicament for the treatment of diseases or conditions where eosinophils are involved in a protective response in a subject in need thereof.
7. Use of an IL-21 polypeptide having a sequence identity to the polypeptide of SEQ ID No: 2, or to residues 30 to 162 of SEQ ID No: 2, of at least 70% for the manufacture of a medicament for the treatment of allergic conditions in a subject in need thereof.
8. Use according to claim 7 wherein the allergic conditions are asthma, allergic rhinitis or allergic diseases in the skin.
9. Use of an IL-21 polypeptide having a sequence identity to the polypeptide of SEQ ID No: 2, or to residues 30 to 162 of SEQ ID No: 2, of at least 70% for the manufacture of a medicament for the treatment of parasitic diseases in a subject in need thereof.
10. Use according to claim 9, where the parasitic disease is a helminthic infection.
11. Use according to any of claims 6 to 10, wherein the IL-21 polypeptide has a sequence identity to the polypeptide of SEQ ID No: 2, or to residues 30 to 162 of SEQ ID No: 2, of at least 80%.
12. Use according to claim 11 , wherein the IL-21 polypeptide has a sequence identity to the polypeptide of SEQ ID No: 2, or to residues 30 to 162 of SEQ ID No: 2, of at least 90%.
13. Use according to claim 12, wherein the IL-21 polypeptide has a sequence identity to the polypeptide of SEQ ID No: 2, or to residues 30 to 162 of SEQ ID No: 2, of at least 95%.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP06112312A EP1731163A2 (en) | 2002-10-11 | 2003-10-13 | Treatment of allergic conditions by use of IL 21 |
| EP06122242A EP1782823A3 (en) | 2002-10-11 | 2003-10-13 | IL-21 peptides and nucleic acids |
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK200201546 | 2002-10-11 | ||
| DKPA200201546 | 2002-10-11 | ||
| DKPA200201587 | 2002-10-16 | ||
| DK200201587 | 2002-10-16 | ||
| US41922502P | 2002-10-17 | 2002-10-17 | |
| US419225 | 2002-10-17 | ||
| PCT/DK2003/000691 WO2004032953A1 (en) | 2002-10-11 | 2003-10-13 | Treatment of allergic conditions by use of il 21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1553970A1 true EP1553970A1 (en) | 2005-07-20 |
Family
ID=32096538
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP03757715A Withdrawn EP1553970A1 (en) | 2002-10-11 | 2003-10-13 | Treatment of allergic conditions by use of il 21 |
Country Status (8)
| Country | Link |
|---|---|
| EP (1) | EP1553970A1 (en) |
| JP (1) | JP2006525223A (en) |
| AU (1) | AU2003273758A1 (en) |
| BR (1) | BR0315134A (en) |
| CA (1) | CA2501807A1 (en) |
| MX (1) | MXPA05003729A (en) |
| PL (1) | PL376118A1 (en) |
| WO (1) | WO2004032953A1 (en) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1573006B1 (en) | 2002-12-13 | 2009-11-11 | ZymoGenetics, Inc. | Il-21 production in prokaryotic hosts |
| EP1753458A4 (en) * | 2004-05-19 | 2009-07-22 | Wyeth Corp | Modulation of immunoglobulin production and atopic disorders |
| EP2311995A1 (en) * | 2005-09-22 | 2011-04-20 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods of using IL-21 |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1082433A4 (en) * | 1998-05-29 | 2003-01-02 | Human Genome Sciences Inc | INTERLEUKINE 21 AND 22 |
| KR100743640B1 (en) * | 1999-03-09 | 2007-07-27 | 지모제넥틱스, 인코포레이티드 | New Cytokine JALLPHAA Ligand |
| ES2349312T3 (en) * | 2000-07-27 | 2010-12-29 | Wyeth Llc | USE OF IL-10 RECEIVER ANTAGONIST ANTIBODIES TO INHIBIT THE INDUCTION BY IL-TIF / IL-21 OF ACUTE PHASE PROTEINS. |
| ES2629395T3 (en) * | 2001-10-04 | 2017-08-09 | Genetics Institute, Llc | Methods and compositions to modulate the activity of interleukin-21 |
| WO2003087320A2 (en) * | 2002-04-09 | 2003-10-23 | Beth Israel Deaconess Medical Center, Inc. | Antagonists of il-21 and modulation of il-21-mediated t cell responses |
-
2003
- 2003-10-13 JP JP2004542219A patent/JP2006525223A/en not_active Withdrawn
- 2003-10-13 MX MXPA05003729A patent/MXPA05003729A/en not_active Application Discontinuation
- 2003-10-13 BR BR0315134-4A patent/BR0315134A/en not_active Application Discontinuation
- 2003-10-13 EP EP03757715A patent/EP1553970A1/en not_active Withdrawn
- 2003-10-13 CA CA002501807A patent/CA2501807A1/en not_active Abandoned
- 2003-10-13 PL PL03376118A patent/PL376118A1/en unknown
- 2003-10-13 AU AU2003273758A patent/AU2003273758A1/en not_active Abandoned
- 2003-10-13 WO PCT/DK2003/000691 patent/WO2004032953A1/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2004032953A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| MXPA05003729A (en) | 2005-06-17 |
| JP2006525223A (en) | 2006-11-09 |
| CA2501807A1 (en) | 2004-04-22 |
| PL376118A1 (en) | 2005-12-12 |
| WO2004032953A1 (en) | 2004-04-22 |
| BR0315134A (en) | 2005-08-16 |
| AU2003273758A1 (en) | 2004-05-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7175334B2 (en) | Cancer treatment with immunostimulants | |
| US8178308B2 (en) | Use of IL-27 agonists to increase interferon-gamma production | |
| EP2684569A1 (en) | A composition for treatment of advanced prostate cancer | |
| EP1680138B1 (en) | Combination therapy | |
| US20130071351A1 (en) | Combination therapy | |
| CN1845757B (en) | Use of cytokine mixture in preparation of medicine due to presensitization of cancer and pharmaceutical composition for treating cancer | |
| EP1553970A1 (en) | Treatment of allergic conditions by use of il 21 | |
| EP1731163A2 (en) | Treatment of allergic conditions by use of IL 21 | |
| ZA200502301B (en) | Treatment of allergic conditions by use of il21. | |
| JPH09510737A (en) | Use of IL-4 to enhance chemotherapeutic agents | |
| HK40062636A (en) | Treatment of cancer with immune stimulator alpha thymosin peptide | |
| WO2007041279A2 (en) | Methods to treat t-cell disorders using tisf | |
| HK1193755A (en) | A composition for treatment of advanced prostate cancer | |
| HK1236437B (en) | Treatment of cancer with immune stimulators | |
| HK1236437A1 (en) | Treatment of cancer with immune stimulators |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20050511 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20060421 |