EP1539985A2 - Therapeutic polypeptides, nucleic acids encoding same, and methods of use - Google Patents

Therapeutic polypeptides, nucleic acids encoding same, and methods of use

Info

Publication number
EP1539985A2
EP1539985A2 EP02793885A EP02793885A EP1539985A2 EP 1539985 A2 EP1539985 A2 EP 1539985A2 EP 02793885 A EP02793885 A EP 02793885A EP 02793885 A EP02793885 A EP 02793885A EP 1539985 A2 EP1539985 A2 EP 1539985A2
Authority
EP
European Patent Office
Prior art keywords
novx
polypeptide
nucleic acid
cell
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP02793885A
Other languages
German (de)
French (fr)
Other versions
EP1539985A4 (en
Inventor
John P. Ii Alsobrook
Enrique Alvarez
David W. Anderson
Melanie Baron
Ferenc L. Boldog
Catherine E. Burgess
Stacie J. Casman
Andrei Chapoval
Mohanraj Dhanabal
Shlomit R. Edinger
Andrew Eisen
Karen Ellerman
Seth Ettenberg
Esha A. Gangolli
Valerie L. Gerlach
Linda Gorman
William M. Grosse
Xiaojia Guo
Craig Hackett
Weizhen Ji
Ramesh Kekuda
Nikolai V. Kharamtsov
Denise M. Lepley
Li Li
Uriel M. Malyankar
Ann Mazur
Kelly Mcqueeney
Peter S. Mezes
Charles E. Miller
Isabelle Millet
Vishnzu S. Mishra
Muralidhara Padigaru
Meera Patturajan
Carol E.A. Pena
John A. Peyman
Luca Rastelli
Daniel K. Rieger
Suresh G. Shenoy
Richard A. Shimkets
Glennda Smithson
Gary Starling
Kimberley A. Spytek
David J. Stone
Velizar T. Tchernev
Nancy Twomlow
Corine A.M. Vernet
Bryan D. Zerhuse
Mei Zhong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
CuraGen Corp
Original Assignee
CuraGen Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by CuraGen Corp filed Critical CuraGen Corp
Priority claimed from US10/287,971 external-priority patent/US20040067882A1/en
Publication of EP1539985A2 publication Critical patent/EP1539985A2/en
Publication of EP1539985A4 publication Critical patent/EP1539985A4/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy

Definitions

  • the present invention relates to novel polypeptides, and the nucleic acids encoding them, having properties related to stimulation of biochemical or physiological responses in a cell, a tissue, an organ or an organism. More particularly, the novel polypeptides are gene products of novel genes, or are specified biologically active fragments or derivatives thereof. Methods of use encompass diagnostic and prognostic assay procedures as well as methods of treating diverse pathological conditions.
  • Eu aryotic cells are characterized by biochemical and physiological processes which under normal conditions are extremely highly balanced to achieve the preservation and propagation of the cells.
  • the regulation of the biochemical and physiological processes involves intricate signaling pathways.
  • signaling pathways involve extracellular signaling proteins, cellular receptors that bind the signaling proteins, and signal transducing components located within the cells.
  • Signaling proteins may be classified as endocrine effectors, paracrine effectors or autocrine effectors.
  • Endocrine effectors are signaling molecules secreted by a given organ into the circulatory system, which are then transported to a distant target organ or tissue.
  • the target cells include the receptors for the endocrine effector, and when the endocrine effector binds, a signaling cascade is induced.
  • Paracrine effectors involve secreting cells and receptor cells in close proximity to each other, for example two different classes of cells in the same tissue or organ. One class of cells secretes the paracrine effector, which then reaches the second class of cells, for example by diffusion through the extracellular fluid.
  • the second class of cells contains the receptors for the paracrine effector; binding of the effector results in induction of the signaling cascade that elicits the corresponding biochemical or physiological effect.
  • Autocrine effectors are highly analogous to paracrine effectors, except that the same cell type that secretes the autocrine effector also contains the receptor. Thus the autocrine effector binds to receptors on the same cell, or on identical neighboring cells. The binding process then elicits the characteristic biochemical or physiological effect.
  • Signaling processes may elicit a variety of effects on cells and tissues including by way of nonhmiting example induction of cell or tissue proliferation, suppression of growth or proliferation, induction of differentiation or maturation of a cell or tissue, and suppression of differentiation or maturation of a cell or tissue.
  • pathological conditions involve dysregulation of expression of important effector proteins.
  • the dysregulation is manifested as diminished or suppressed level of synthesis and secretion of protein effectors.
  • the dysregulation is manifested as increased or up-regulated level of synthesis and secretion of protein effectors.
  • a subject may be suspected of suffering from a condition brought on by altered or mis-regulated levels of a protein effector of interest. Therefore there is a need to assay for the level of the protein effector of interest in a biological sample from such a subject, and to compare the level with that characteristic of a nonpathological condition. There also is a need to provide the protein effector as a product of manufacture.
  • Antibodies are multichain proteins that bind specifically to a given antigen, and bind poorly, or not at all, to substances deemed not to be cognate antigens. Antibodies are comprised of two short chains termed light chains and two long chains termed heavy chains.
  • immunoglobulin domains of which generally there are two classes: one variable domain per chain, one constant domain in light chains, and three or more constant domains in heavy chains.
  • the antigen-specific portion of the immunoglobulin molecules resides in the variable domains; the variable domains of one light chain and one heavy chain associate with each other to generate the antigen-biniding moiety.
  • Antibodies that bind immunospecifically to a cognate or target antigen bind with high affinities. Accordingly, they are useful in assaying specifically for the presence of the antigen in a sample. In addition, they have the potential of inactivating the activity of the antigen.
  • the invention is based in part upon the discovery of isolated polypeptides including amino acid sequences selected from mature forms of the amino acid sequences selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • novel nucleic acids and polypeptides are referred to herein as NOVX, or NONl, ⁇ OV2, NON3, etc., nucleic acids and polypeptides.
  • NOVX nucleic acids and polypeptides
  • ⁇ OVX nucleic acid or polypeptide sequences.
  • the invention also is based in part upon variants of a mature form of the amino acid sequence selected from the group consisting of SEQ ID ⁇ O:2n, wherein n is an integer between 1 and 141, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed.
  • the invention includes the amino acid sequences selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • the invention also comprises variants of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed.
  • the invention also involves fragments of any of the mature forms of the amino acid sequences selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, or any other amino acid sequence selected from this group.
  • the invention also comprises fragments from these groups in which up to 15% of the residues are changed.
  • the invention encompasses polypeptides that are naturally occurring allelic variants of the sequence selected from the group consisting of SEQ ID NO: 1
  • allelic variants include amino acid sequences that are the translations of nucleic acid sequences differing by a single nucleotide from nucleic acid sequences selected from the group consisting of SEQ ID NOS: 2n-l, wherein n is an integer between 1 and 141.
  • the invention comprises a pharmaceutical composition involving a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 and a pharmaceutically acceptable carrier.
  • the invention involves a kit, including, in one or more containers, this pharmaceutical composition.
  • the invention includes the use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease being selected from a pathology associated with a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein said therapeutic is the polypeptide selected from this group.
  • the invention comprises a method for determining the presence or amount of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherem n is an integer between 1 and 141 in a sample, the method involving providing the sample; introducing the sample to an antibody that binds immunospecifically to the polypeptide; and determining the presence or amount of antibody bound to the polypeptide, thereby determining the presence or amount of polypeptide in the sample.
  • the invention includes a method for determining the presence of or predisposition to a disease associated with altered levels of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 in a first mammalian subject, the method involving measuring the level of expression of the polypeptide in a sample from the first mammalian subject; and comparing the amount of the polypeptide in this sample to the amount of the polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, the disease, wherein an alteration in the expression level of the polypeptide in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
  • the invention involves a method of identifying an agent that binds to a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 , the method including introducing the polypeptide to the agent; and determining whether the agent binds to the polypeptide.
  • the agent could be a cellular receptor or a downstream effector.
  • the invention involves a method for identifying a potential therapeutic agent for use in treatment of a pathology, wherein the pathology is related to aberrant expression or aberrant physiological interactions of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, the method including providing a cell expressing the polypeptide of the invention and having a property or function ascribable to the polypeptide; contacting the cell with a composition comprising a candidate substance; and determining whether the substance alters the property or function ascribable to the polypeptide; whereby, if an alteration observed in the presence of the substance is not observed when the cell is contacted with a composition devoid of the substance, the substance is identified as a potential therapeutic agent.
  • the invention involves a method for screening for a modulator of activity or of latency or predisposition to a pathology associated with a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, the method including administering a test compound to a test animal at increased risk for a pathology associated with the polypeptide of the invention, wherein the test animal recombinantly expresses the polypeptide of the invention; measuring the activity of the polypeptide in the test animal after administering the test compound; and comparing the activity of the protein in the test animal with the activity of the polypeptide in a control animal not administered the polypeptide, wherein a change in the activity of the polypeptide in the test animal relative to the control animal indicates the test compound is a modulator of latency of, or predisposition to, a pathology associated with the polypeptide of the invention.
  • the recombinant test animal could express a test protein transgene or express the transgene under the control of a promoter at an increased level relative to a wild-type test animal
  • the promoter may or may not b the native gene promoter of the transgene.
  • the invention involves a method for modulating the activity of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, the method including introducing a cell sample expressing the polypeptide with a compound that binds to the polypeptide in an amount sufficient to modulate the activity of the polypeptide.
  • the invention involves a method of treating or preventing a pathology associated with a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 , the method including administering the polypeptide to a subject in which such treatment or prevention is desired in an amount sufficient to treat or prevent the pathology in the subject.
  • the subject could be human.
  • the invention involves a method of treating a pathological state in a mammal, the method including administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 or a biologically active fragment thereof.
  • the invention involves an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide having an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141; a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 ; a variant of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherem n is an integer between 1 and 141, in which any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of
  • the invention comprises an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule comprises the nucleotide sequence of a naturally occurring allelic nucleic acid variant.
  • the invention involves an isolated nucleic acid molecule including a nucleic acid sequence encoding a polypeptide having an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141 that encodes a variant polypeptide, wherein the variant polypeptide has the polypeptide sequence of a naturally occurring polypeptide variant.
  • the invention comprises an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule differs by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NOS: 2n-l, wherein n is an integer between 1 and 141.
  • the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein ri is an integer between 1 and 141, wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141; a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO:2
  • the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule hybridizes under stringent conditions to the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l , wherein n is an integer between 1 and 141, or a complement of the nucleotide sequence.
  • the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule has a nucleotide sequence in which any nucleotide specified in the coding sequence of the chosen nucleotide sequence is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides in the chosen coding sequence are so changed, an isolated second polynucleotide that is a complement of the first polynucleotide, or a fragment of any of them.
  • the invention includes a vector involving the nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • This vector can have a promoter operably linked to the nucleic acid molecule. This vector can be located within a cell.
  • the invention involves a method for determining the presence or amount of a nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141 in a sample, the method including providing the sample; introducing the sample to a probe that binds to the nucleic acid molecule; and determining the presence or amount of the probe bound to the nucleic acid molecule, thereby determining the presence or amount of the nucleic acid molecule in the sample.
  • the presence or amount of the nucleic acid molecule is used as a marker for cell or tissue type.
  • the cell type can be cancerous.
  • the invention involves a method for determining the presence of or predisposition for a disease associated with altered levels of a nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141 in a first mammalian subject, the method including measuring the amount of the nucleic acid in a sample from the first mammalian subject; and comparing the amount of the nucleic acid in the sample of step (a) to the amount of the nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease; wherein an alteration in the level of the nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
  • the invention further provides an antibody that binds immunospecifically to a NONX polypeptide.
  • the ⁇ ONX antibody may be monoclonal, humanized, or a fully human antibody.
  • the antibody has a dissociation constant for the binding of the ⁇ OVX polypeptide to the antibody less than 1 x 10 "9 M. More preferably, the ⁇ ONX antibody neutralizes the activity of the ⁇ OVX polypeptide.
  • the invention provides for the use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, associated with a ⁇ OVX polypeptide.
  • a therapeutic is a ⁇ OVX antibody.
  • the invention provides a method of treating or preventing a ⁇ OVX-associated disorder, a method of treating a pathological state in a mammal, and a method of treating or preventing a pathology associated with a polypeptide by administering a ⁇ OVX antibody to a subject in an amount sufficient to treat or prevent the disorder.
  • the present invention provides novel nucleotides and polypeptides encoded thereby. Included in the invention are the novel nucleic acid sequences, their encoded polypeptides, antibodies, and other related compounds.
  • the sequences are collectively referred to herein as "NOVX nucleic acids” or “NOVX polynucleotides” and the corresponding encoded polypeptides are referred to as “NOVX polypeptides” or “NOVX proteins.” Unless indicated otherwise, “NOVX” is meant to refer to any of the novel sequences disclosed herein.
  • Table A provides a summary of the NOVX nucleic acids and their encoded polypeptides. TABLE A. Sequences and Corresponding SEQ ID Numbers
  • Table A indicates the homology of NOVX polypeptides to known protein families.
  • nucleic acids and polypeptides, antibodies and related compounds according to the invention corresponding to a NOVX as identified in column 1 of Table A will be useful in therapeutic and diagnostic applications implicated in, for example, pathologies and disorders associated with the known protein families identified in column 5 of Table A.
  • Pathologies, diseases, disorders and condition and the like that are associated with NOVX sequences include, but are not limited to: ]e, ⁇ 5 card ⁇ omyopathy, atherosclerosis ⁇ . hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventriculaj: (AN) canal defeet duetus arterio is, puhnonajy stenosis, subaortic sfe»osjs » ventricular septa ⁇ defect (VSD), valve diseases, tober ⁇ us sclerosis; obesity, ⁇ etabolic disturbances associated with obesity, trapsplan t m,, adten leukody$to ⁇ hy ?
  • NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts.
  • the various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.
  • NOVX polypeptides of the present invention show homology to, and contain domains that are characteristic of, other members of such protein families. Details of the sequence relatedness and domain analysis for each NOVX are presented in Example A.
  • the NOVX nucleic acids and polypeptides can also be used to screen for molecules, which inhibit or enhance NOVX activity or function.
  • the nucleic acids and polypeptides according to the invention may be used as targets for the identification of small molecules that modulate or inhibit diseases associated with the protein families listed in Table A.
  • NOVX nucleic acids and polypeptides are also useful for detecting specific cell types. Details of the expression analysis for each NOVX are presented in Example C. Accordingly, the NOVX nucleic acids, polypeptides, antibodies and related compounds according to the invention will have diagnostic and therapeutic applications in the detection of a variety of diseases with differential expression in normal vs. diseased tissues, e.g. detection of a variety of cancers.
  • NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts.
  • the various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.
  • the NOVX genes and their corresponding encoded proteins are useful for preventing, treating or ameliorating medical conditions, e.g., by protein or gene therapy. Pathological conditions can be diagnosed by determining the amount of the new protein in a sample or by determining the presence of mutations in the new genes. Specific uses are described for each of the NOVX genes, based on the tissues in which they are most highly expressed. Uses include developing products for the diagnosis or treatment of a variety of diseases and disorders.
  • the NOVX nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) a biological defense weapon.
  • the invention includes an isolated polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherem n is an integer between 1 and 141; (b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherem n is an integer between 1 and 141, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; (c) an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141; (d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residue
  • the invention includes an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a mature form of the ammo acid sequence given SEQ ID NO: 2n, wherein n is an mteger between 1 and 141; (b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; (c) the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141; (d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherem n is an integer between 1 and 141, in which any amino acid specified
  • the invention includes an isolated nucleic acid molecule, wherein said nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of: (a) the nucleotide sequence selected from the group consisting of SEQ ED NO: 2n-l, wherein n is an integer between 1 and 141; (b) a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 141 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; (c) a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO: 2n-l, wherem n is an mteger between 1 and 141; and (d) a nucleic acid fragment wherein one or more nucleotides in the nucle
  • NOVX Nucleic Acids and Polypeptides
  • One aspect of the invention pertains to isolated nucleic acid molecules that encode
  • nucleic acid fragments sufficient for use as hybridization probes to identify NOVX-encoding nucleic acids (e.g., NOVX mRNAs) and fragments for use as PCR primers for the amplification and/or mutation of NOVX nucleic acid molecules.
  • nucleic acid molecule is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., RNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof.
  • the nucleic acid molecule may be single-stranded or double-stranded, but preferably is comprised double-stranded DNA.
  • a NOVX nucleic acid can encode a mature NOVX polypeptide.
  • a "mature" form of a polypeptide or protein disclosed in the present invention is the product of a naturally occurring polypeptide or precursor form or proprotein.
  • the naturally occurring polypeptide, precursor or proprotein includes, by way of nonhmiting example, the full-length gene product encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an ORF described herein.
  • the product "mature" form arises, by way of nonhmiting example, as a result of one or more naturally occurring processing steps that may take place within the cell (e.g., host cell) in which the gene product arises.
  • Examples of such processing steps leading to a "mature" form of a polypeptide or protein include the cleavage of the N-terminal methionine residue encoded by the initiation codon of an ORF, or the proteolytic cleavage of a signal peptide or leader sequence.
  • a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine would have residues 2 through N remaining after removal of the N-terminal methionine.
  • a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+l to residue N remaining.
  • a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristylation or phosphorylation.
  • a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.
  • probe refers to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), about 100 nt, or as many as approximately, e.g., 6,000 nt, depending upon the specific use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences. Longer length probes are generally obtained from a natural or recombinant source, are highly specific, and much slower to hybridize than shorter-length oligo er probes. Probes may be single- stranded or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.
  • isolated nucleic acid molecule is a nucleic acid that is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid.
  • an “isolated” nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5'- and 3'-termini of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived.
  • the isolated NOVX nucleic acid molecules can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell/tissue from which the nucleic acid is derived (e.g., brain, heart, liver, spleen, etc.).
  • an "isolated" nucleic acid molecule such as a cDNA molecule, can be substantially free of other cellular material, or culture medium, or of chemical precursors or other chemicals.
  • a nucleic acid molecule of the invention e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NO:2ra-l, wherein n is an integer between 1 and 141, or a complement of this nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein.
  • NOVX molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, et al., (eds.), MOLECULAR CLONING: A LABORATORY MANUAL 2 nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel, et al, (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993.)
  • a nucleic acid of the invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template with appropriate oligonucleotide primers according to standard PCR amplification techniques.
  • nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis.
  • oligonucleotides corresponding to NOVX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
  • oligonucleotide refers to a series of linked nucleotide residues.
  • a short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue.
  • Oligonucleotides comprise a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length.
  • an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at least 6 contiguous nucleotides of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, or a complement thereof. Oligonucleotides may be chemically synthesized and may also be used as probes.
  • an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule that is a complement of the nucleotide sequence shown in SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, or a portion of this nucleotide sequence (e.g. , a fragment that can be used as a probe or primer or a fragment encoding a biologically-active portion of a NOVX polypeptide).
  • a nucleic acid molecule that is complementary to the nucleotide sequence of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, is one that is sufficiently complementary to the nucleotide sequence of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, that it can hydrogen bond with few or no mismatches to the nucleotide sequence shown in SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, thereby forming a stable duplex.
  • binding means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like.
  • a physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
  • a “fragment” provided herein is defined as a sequence of at least 6 (contiguous) nucleic acids or at least 4 (contiguous) amino acids, a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, and is at most some portion less than a full length sequence. Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice.
  • a full-length NOVX clone is identified as containing an ATG translation start codon and an in-frame stop codon.
  • Any disclosed NOVX nucleotide sequence lacking an ATG start codon therefore encodes a truncated C-terminal fragment of the respective NOVX polypeptide, and requires that the corresponding full-length cDNA extend in the 5' direction of the disclosed sequence.
  • Any disclosed NOVX nucleotide sequence lacking an in-frame stop codon similarly encodes a truncated N-terminal fragment of the respective NOVX polypeptide, and requires that the corresponding full-length cDNA extend in the 3' direction of the disclosed sequence.
  • a “derivative” is a nucleic acid sequence or amino acid sequence formed from the native compounds either directly, by modification or partial substitution.
  • An “analog” is a nucleic acid sequence or amino acid sequence that has a structure similar to, but not identical to, the native compound, e.g. they differs from it in respect to certain components or side chains. Analogs may be synthetic or derived from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type.
  • a “homolog” is a nucleic acid sequence or amino acid sequence of a particular gene that is derived from different species. Derivatives and analogs may be full length or other than full length.
  • nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, or 95% identity (with a preferred identity of 80-95%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the proteins under stringent, moderately stringent, or low stringent conditions. See e.g.
  • homologous nucleic acid sequence or “homologous amino acid sequence,” or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above.
  • homologous nucleotide sequences include those sequences coding for isoforms of NOVX polypeptides. Isoforms can be expressed in different tissues of the same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes.
  • homologous nucleotide sequences include nucleotide sequences encoding for a NOVX polypeptide of species other than humans, including, but not limited to: vertebrates, and thus can include, e.g., frog, mouse, rat, rabbit, dog, cat cow, horse, and other organisms.
  • homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations of the nucleotide sequences set forth herein.
  • a homologous nucleotide sequence does not, however, include the exact nucleotide sequence encoding human NOVX protein.
  • Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) in SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, as well as a polypeptide possessing NOVX biological activity. Various biological activities of the NOVX proteins are described below.
  • a NOVX polypeptide is encoded by the open reading frame ("ORF") of a NOVX nucleic acid.
  • An ORF corresponds to a nucleotide sequence that could potentially be translated into a polypeptide.
  • a stretch of nucleic acids comprising an ORF is unmterrupted by a stop codon.
  • An ORF that represents the coding sequence for a full protein begins with an ATG "start” codon and terminates with one of the three “stop” codons, namely, TAA, TAG, or TGA.
  • an ORF may be any part of a coding sequence, with or without a start codon, a stop codon, or both.
  • a minimum size requirement is often set, e.g., a stretch of DNA that would encode a protein of 50 amino acids or more.
  • the nucleotide sequences determined from the cloning of the human NOVX genes allows for the generation of probes and primers designed for use in identifying and/or cloning NOVX homologues in other cell types, e.g. from other tissues, as well as NOVX homologues from other vertebrates.
  • the probe/primer typically comprises substantially purified oligonucleotide.
  • the oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 consecutive sense strand nucleotide sequence of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141; or an anti-sense strand nucleotide sequence of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141; or of a naturally occurring mutant of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141.
  • Probes based on the human NOVX nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins.
  • the probe has a detectable label attached, e.g. the label can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor.
  • Such probes can be used as a part of a diagnostic test kit for identifying cells or tissues which mis-express a NOVX protein, such as by measuring a level of a NOVX-encoding nucleic acid in a sample of cells from a subject e.g., detecting NOVX mRNA levels or determining whether a genomic NOVX gene has been mutated or deleted.
  • a polypeptide having a biologically-active portion of a NOVX polypeptide refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide of the invention, including mature forms, as measured in a particular biological assay, with or without dose dependency.
  • a nucleic acid fragment encoding a "biologically-active portion of NOVX” can be prepared by isolating a portion of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, that encodes a polypeptide having a NOVX biological activity (the biological activities of the NOVX proteins are described below), expressing the encoded portion of NOVX protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of NOVX.
  • the invention further encompasses nucleic acid molecules that differ from the nucleotide sequences of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, due to degeneracy of the genetic code and thus encode the same NOVX proteins as that encoded by the nucleotide sequences of SEQ ED NO:2 «-l, wherein n is an integer between 1 and 141.
  • an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence of SEQ ID NO:2ra, wherein n is an integer between 1 and 141.
  • NOVX nucleotide sequences of SEQ ID NO:2 «-l , wherein n is an mteger between 1 and 141
  • DNA sequence polymorphisms that lead to changes in the amino acid sequences of the NOVX polypeptides may exist within a population (e.g. , the human population).
  • Such genetic polymorphism in the NOVX genes may exist among individuals within a population due to natural allelic variation.
  • the terms "gene” and “recombinant gene” refer to nucleic acid molecules comprising an open reading frame (ORF) encoding a NOVX protein, preferably a vertebrate NOVX protein.
  • ORF open reading frame
  • Such natural allelic variations can typically result in 1-5%) variance in the nucleotide sequence of the NOVX genes. Any and all such nucleotide variations.and resulting amino acid polymorphisms in the NOVX polypeptides, which are the result of natural allelic variation and that do not alter the functional activity of the NOVX polypeptides, are intended to be within the scope of the invention.
  • nucleic acid molecules encoding NOVX proteins from other species and thus that have a nucleotide sequence that differs from a human SEQ ID NO:2w-l, wherein n is an integer between 1 and 141, are intended to be within the scope of the invention.
  • Nucleic acid molecules corresponding to natural allelic variants and homologues of the NOVX cDNAs of the invention can be isolated based on their homology to the human NOVX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
  • an isolated nucleic acid molecule of the invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:2?z-l, wherein n is an integer between 1 and l41.
  • the nucleic acid is at least 10, 25, 50, 100, 250, 500, 750, 1000, 1500, or 2000 or more nucleotides in length.
  • an isolated nucleic acid molecule of the invention hybridizes to the coding region.
  • the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least about 65% homologous to each other typically remain hybridized to each other.
  • Homologs i.e., nucleic acids encoding NOVX proteins derived from species other than human
  • other related sequences e.g., paralogs
  • stringent hybridization conditions refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences.
  • stringent conditions are selected to be about 5 °C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH.
  • Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50%) of the probes are occupied at equilibrium.
  • stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30 °C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60 °C for longer probes, primers and oligonucleotides.
  • Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.
  • Stringent conditions are known to those skilled in the art and can be found in Ausubel, et al., (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, N. Y. (1989), 6.3.1-6.3.6.
  • the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other.
  • a non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02%) PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65°C, followed by one or more washes in 0.2X SSC, 0.01% BSA at 50°C.
  • a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g. , encodes a natural protein).
  • a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided.
  • moderate stringency hybridization conditions are hybridization in 6X SSC, 5X Reinhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55 °C, followed by one or more washes in IX SSC, 0.1% SDS at 37 °C.
  • Other conditions of moderate stringency that may be used are well-known within the art.
  • a nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequences of SEQ ID NO:2n-l, wherem n is an integer between 1 and 141, or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided.
  • low stringency hybridization conditions are hybridization in 35% formamide, 5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.02% PVP, 0.02%o Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10% (wt vol) dextran sulfate at 40°C, followed by one or more washes in 2X SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS at 50°C.
  • Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations).
  • nucleotide sequences of SEQ ID NO:2ra-l wherein n is an integer between 1 and 141, thereby leading to changes in the amino acid sequences of the encoded NOVX protein, without altering the functional ability of that NOVX protein.
  • nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • non-essential amino acid residue is a residue that can be altered from the wild-type sequences of the NOVX proteins without altering their biological activity, whereas an "essential" amino acid residue is required for such biological activity.
  • amino acid residues that are conserved among the NOVX proteins of the invention are predicted to be particularly non-amenable to alteration. Amino acids for which conservative substitutions can be made are well-known within the art.
  • nucleic acid molecules encoding NOVX proteins that contain changes in amino acid residues that are not essential for activity. Such NOVX proteins differ in amino acid sequence from SEQ ID NO:2H-1, wherein n is an mteger between l and 141, yet retain biological activity.
  • the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherem the protein comprises an ammo acid sequence at least about 40% homologous to the amino acid sequences of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • the protein encoded by the nucleic acid molecule is at least about 60% homologous to SEQ ID NO:2 ⁇ , wherein n is an integer between 1 and 141; more preferably at least about 70%> homologous to SEQ ID NO:2n, wherein n is an mteger between 1 and 141; still more preferably at least about 80% homologous to SEQ ID NO:2 «, wherein n is an integer between 1 and 141; even more preferably at least about 90% homologous to SEQ ID NO:2n, wherein n is an integer between 1 and 141; and most preferably at least about 95% homologous to SEQ ID NO:2», wherein n is an integer between 1 and 141.
  • An isolated nucleic acid molecule encoding a NOVX protein homologous to the protein of SEQ ID NO:2 «, wherein n is an integer between 1 and 141 can be created by introducing one or more nucleotide substimtions, additions or deletions into the nucleotide sequence of SEQ ID NO:2ra-l, wherein n is an integer between 1 and 141, such that one or more amino acid substimtions, additions or deletions are introduced into the encoded protein. Mutations can be introduced any one of SEQ ED NO:2«-l, wherein n is an integer between 1 and 141, by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
  • conservative amino acid substimtions are made at one or more predicted, non-essential amino acid residues.
  • a "conservative amino acid substimtion” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined within the art. These families include amino acids with basic side chains (e.g.
  • lysine, arginine, histidine acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • acidic side chains e.g., aspartic acid, glutamic acid
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • a predicted non-essential amino acid residue in me NOVX protein is replaced with another amino acid residue from the same side chain family.
  • mutations can be introduced randomly along all or part of a NOVX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for NOVX biological activity to identify mutants that retain activity.
  • the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined.
  • amino acid families may also be determined based on side chain interactions.
  • Substituted amino acids may be fully conserved "strong” residues or fully conserved “weak” residues.
  • the "strong” group of conserved amino acid residues may be any one of the following groups: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW, wherein the single letter amino acid codes are grouped by those amino acids that may be substituted for each other.
  • the "weak" group of conserved residues may be any one of the following: CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, NDEQHK, NEQHRK, HFY, wherein the letters within each group represent the single letter amino acid code.
  • a mutant NOVX protein can be assayed for (i) the ability to form protein-protein interactions with other NOVX proteins, other cell-surface proteins, or biologically-active portions thereof, (ii) complex formation between a mutant NOVX protein and a NOVX ligand; or (iii) the ability of a mutant NOVX protein to bind to an intracellular target protein or biologically-active portion thereof; (e.g. avidin proteins).
  • a mutant NOVX protein in yet another embodiment, can be assayed for the ability to regulate a specific biological function (e.g., regulation of insulin release).
  • NOVX gene expression can be attenuated by RNA interference.
  • RNA interference One approach well-known in the art is short interfering RNA (siRNA) mediated gene silencing where expression products of a NOVX gene are targeted by specific double stranded NOVX derived siRNA nucleotide sequences that are complementary to at least a 19- 25 nt long segment of the NOVX gene transcript, including the 5 ' untranslated (UT) region, the ORF, or the 3' UT region.
  • siRNA short interfering RNA
  • Targeted genes can be a NOVX gene, or an upstream or downstream modulator of the NOVX gene.
  • Nonhmiting examples of upstream or downstream modulators of a NOVX gene include, e.g., a transcription factor that binds the NOVX gene promoter, a kinase or phosphatase that interacts with a NOVX polypeptide, and polypeptides involved in a NOVX regulatory pathway.
  • NOVX gene expression is silenced using short interfering RNA.
  • a NOVX polynucleotide according to the invention includes a siRNA polynucleotide.
  • a NOVX siRNA can be obtained using a NOVX polynucleotide sequence, for example, by processing the NOVX ribopolynucleotide sequence in a cell-free system, such as but not limited to a Drosophila extract, or by transcription of recombinant double stranded NOVX RNA or by chemical synthesis of nucleotide sequences homologous to a NOVX sequence.
  • siRNA duplexes composed of a 21-nt sense strand and a 21-nt antisense strand, paired in a manner to have a 2-nt 3' overhang.
  • sequence of the 2-nt 3' overhang makes an additional small contribution to the specificity of siRNA target recognition.
  • the nucleotides in the 3' overhang are ribonucleotides.
  • the nucleotides in the 3' overhang are deoxyribonucleotides. Using 2'-deoxyribonucleotides in the 3' overhangs is as efficient as using ribonucleotides, but deoxyribonucleotides are often cheaper to synthesize and are most likely more nuclease resistant.
  • a contemplated recombinant expression vector of the invention comprises a NOVX
  • DNA molecule cloned into an expression vector comprising operatively-linked regulatory sequences flanking the NOVX sequence in a manner that allows for expression (by transcription of the DNA molecule) of both strands.
  • An RNA molecule that is antisense to NOVX mRNA is transcribed by a first promoter (e.g., a promoter sequence 3' of the cloned DNA) and an RNA molecule that is the sense strand for the NOVX mRNA is transcribed by a second promoter (e.g., a promoter sequence 5' of the cloned DNA).
  • the sense and antisense strands may hybridize in vivo to generate siRNA constructs for silencing of the NOVX gene.
  • cloned DNA can encode a construct having secondary structure, wherein a single transcript has both the sense and complementary antisense sequences from the target gene or genes.
  • a hairpin RNAi product is homologous to all or a portion of the target gene.
  • a hairpin RNAi product is a siRNA.
  • the regulatory sequences flanking the NOVX sequence may be identical or may be different, such that their expression may be modulated independently, or in a temporal or spatial manner.
  • siRNAs are transcribed intracellularly by cloning the NOVX gene templates into a vector containing, e.g., a RNA pol III transcription unit from the smaller nuclear RNA (snRNA) U6 or the human RNase P RNA HI .
  • a vector system is the GeneSuppressorTM RNA Interference kit (commercially available from Imgenex).
  • the U6 and HI promoters are members of the type III class of Pol in promoters.
  • the +1 nucleotide of the U6-like promoters is always guanosine, whereas the +1 for HI promoters is adenosine.
  • the termination signal for these promoters is defined by five consecutive thymidines.
  • the transcript is typically cleaved after the second uridine. Cleavage at this position generates a 3' UU overhang in the expressed siRNA, which is similar to the 3' overhangs of synthetic siRNAs. Any sequence less than 400 nucleotides in length can be transcribed by these promoter, therefore they are ideally suited for the expression of around 21 -nucleotide siRNAs in, e.g., an approximately 50-nucleotide RNA stem-loop transcript.
  • a siRNA vector appears to have an advantage over synthetic siRNAs where long term knock-down of expression is desired. Cells transfected with a siRNA expression vector would experience steady, long-term mRNA inhibition. In contrast, cells transfected with exogenous synthetic siRNAs typically recover from mRNA suppression within seven days or ten rounds of cell division. The long-term gene silencing ability of siRNA expression vectors may provide for applications in gene therapy.
  • siRNAs are chopped from longer dsRNA by an ATP-dependent ribonuclease called DICER.
  • DICER is a member of the RNase III family of double-stranded RNA-specific endonucleases. The siRNAs assemble with cellular proteins into an endonuclease complex.
  • siRNAs/protein complex siRNAs/protein complex (si NP) is then transferred to a second enzyme complex, called an RNA-induced silencing complex (RISC), which contains an endoribonuclease that is distinct from DICER.
  • RISC uses the sequence encoded by the antisense siRNA strand to find and destroy mRNAs of complementary sequence.
  • siRNA thus acts as a guide, restricting the ribonuclease to cleave only mRNAs complementary to one of the two siRNA strands.
  • a NOVX mRNA region to be targeted by siRNA is generally selected from a desired
  • a complete NOVX siRNA experiment includes the proper negative control.
  • a negative control siRNA generally has the same nucleotide composition as the NOVX siRNA but lack significant sequence homology to the genome. Typically, one would scramble the nucleotide sequence of the NOVX siRNA and do a homology search to make sure it lacks homology to any other gene.
  • Two independent NOVX siRNA duplexes can be used to knock-down a target NOVX gene. This helps to control for specificity of the silencing effect.
  • expression of two independent genes can be simultaneously knocked down by using equal concentrations of different NOVX siRNA duplexes, e.g., a NOVX siRNA and an siRNA for a regulator of a NOVX gene or polypeptide.
  • NOVX siRNA duplexes e.g., a NOVX siRNA and an siRNA for a regulator of a NOVX gene or polypeptide.
  • Availability of siRNA-associating proteins is believed to be more limiting than target mRNA accessibility.
  • a targeted NOVX region is typically a sequence of two adenines (AA) and two thymidines (TT) divided by a spacer region of nineteen (N19) residues (e.g., AA(N19)TT).
  • a desirable spacer region has a G/C-content of approximately 30%> to 70%, and more preferably of about 50%. If the sequence AA(N19)TT is not present in the target sequence, an alternative target region would be AA(N21).
  • the sequence of the NOVX sense siRNA corresponds to (Nl 9)TT or N21 , respectively. In me latter case, conversion of the 3' end of the sense siRNA to TT can be performed if such a sequence does not naturally occur in the NOVX polynucleotide. The rationale for this sequence conversion is to generate a symmetric duplex with respect to the sequence composition of the sense and antisense 3' overhangs. Symmetric 3' overhangs may help to ensure that the siRNPs are formed with approximately equal ratios of sense and antisense target RNA-cleaving siRNPs. See, e.g., Elbashir,
  • Transfection of NOVX siRNA duplexes can be achieved using standard nucleic acid transfection methods, for example, OLIGOFECTAMINE Reagent (commercially available from Invitrogen).
  • An assay for NOVX gene silencing is generally performed approximately 2 days after transfection. No NOVX gene silencing has been observed in the absence of transfection reagent, allowing for a comparative analysis of the wild-type and silenced NOVX phenotypes.
  • approximately 0.84 ⁇ g of the siRNA duplex is generally sufficient. Cells are typically seeded the previous day, and are transfected at about 50%> confluence.
  • the choice of cell culture media and conditions are routine to those of skill in the art, and will vary with the choice of cell type.
  • the efficiency of transfection may depend on the cell type, but also on the passage number and the confluency of the cells.
  • the time and the manner of formation of siRNA-liposome complexes are also critical. Low transfection efficiencies are the most frequent cause of unsuccessful NOVX silencing.
  • the efficiency of transfection needs to be carefully examined for each new cell line to be used.
  • Preferred cell are derived from a mammal, more preferably from a rodent such as a rat or mouse, and most preferably from a human. Where used for therapeutic treatment, the cells are preferentially autologous, although non-autologous cell sources are also contemplated as within the scope of the present invention.
  • transfection of 0.84 ⁇ g single-stranded sense NOVX siRNA will have no effect on NOVX silencing, and 0.84 ⁇ g antisense siRNA has a weak silencing effect when compared to 0.84 ⁇ g of duplex siRNAs.
  • Control experiments again allow for a comparative analysis of the wild-type and silenced NOVX phenotypes.
  • targeting of common proteins is typically performed, for example targeting of lamin A/C or transfection of a CMV-driven EGFP-expression plasmid (e.g. commercially available from Clontech).
  • a determination of the fraction of lamin A/C knockdown in cells is determined the next day by such techniques as immunofluorescence, Western blot, Northern blot or other similar assays for protein expression or gene expression.
  • Lamin A/C monoclonal antibodies may be obtained from Santa Cruz Biotechnology.
  • a knock-down phenotype may become apparent after 1 to 3 days, or even later.
  • depletion of the NOVX polynucleotide may be observed by immunofluorescence or Western blotting. If the NOVX polynucleotide is still abundant after 3 days, cells need to be split and transferred to a fresh 24-well plate for re-transfection. If no knock-down of the targeted protein is observed, it may be desirable to analyze whether the target mRNA (NOVX or a NOVX upstream or downstream gene) was effectively destroyed by the transfected siRNA duplex.
  • RNA is prepared, reverse transcribed using a target-specific primer, and PCR-amplified with a primer pair covering at least one exon-exon junction in order to control for amplification of pre-mRNAs.
  • RT/PCR of a non-targeted mRNA is also needed as control. Effective depletion of the mRNA yet undetectable reduction of target protein may indicate that a large reservoir of stable NOVX protein may exist in the cell. Multiple transfection in sufficiently long intervals may be necessary until the target protein is finally depleted to a point where a phenotype may become apparent. If multiple transfection steps are required, cells are split 2 to 3 days after transfection. The cells may be transfected immediately after splitting.
  • An inventive therapeutic method of the invention contemplates administering a NOVX siRNA construct as therapy to compensate for increased or aberrant NOVX expression or activity.
  • the NOVX ribopolynucleotide is obtained and processed into siRNA fragments, or a NOVX siRNA is synthesized, as described above.
  • the NOVX siRNA is administered to cells or tissues using known nucleic acid transfection techniques, as described above.
  • a NOVX siRNA specific for a NOVX gene will decrease or knockdown NOVX transcription products, which will lead to reduced NOVX polypeptide production, resulting in reduced NOVX polypeptide activity in the cells or tissues.
  • the present invention also encompasses a method of treating a disease or condition associated with the presence of a NOVX protein in an individual comprising administering to the individual an RNAi construct mat targets the mRNA of the protein (the mRNA that encodes the protein) for degradation.
  • a specific RNAi construct includes a siRNA or a double stranded gene transcript at is processed into siRNAs. Upon treatment, the target protein is not produced or is not produced to the extent it would be in the absence of the treatment.
  • a control sample of cells or tissues from healthy individuals provides a reference standard for determining NOVX expression levels. Expression levels are detected using the assays described, e.g., RT-PCR, Northern blotting, Western blotting, ELISA, and the like.
  • a subject sample of cells or tissues is taken from a mammal, preferably a human subject, suffering from a disease state.
  • the NOVX ribopolynucleotide is used to produce siRNA constructs, that are specific for the NOVX gene product.
  • NOVX siRNA's are administered to the cells or tissues by methods described for the transfection of nucleic acids into a cell or tissue, and a change in NOVX polypeptide or polynucleotide expression is observed in the subject sample relative to the control sample, using the assays described.
  • This NOVX gene knockdown approach provides a rapid method for determination of a NOVX minus (NOVX " ) phenotype in the treated subject sample.
  • NOVX " phenotype observed in the treated subject sample thus serves as a marker for monitoring the course of a disease state during treatment.
  • a NOVX siRNA is used in therapy.
  • Methods for the generation and use of a NOVX siRNA are known to those skilled in the art. Example techniques are provided below.
  • Sense RNA (ssRNA) and antisense RNA (asRNA) of NOVX are produced using known methods such as transcription in RNA expression vectors.
  • the sense and antisense RNA are about 500 bases in length each.
  • the produced ssRNA and asRNA (0.5 ⁇ M) in 10 mM Tris-HCl (pH 7.5) with 20 mM NaCl were heated to 95° C for 1 min then cooled and annealed at room temperature for 12 to 16 h.
  • the RNAs are precipitated and resuspended in lysis buffer (below).
  • RNAs are electrophoresed in a 2% agarose gel in TBE buffer and stained with ethidium bromide. See, e.g., Sambrook et al., Molecular Cloning. Cold Spring Harbor Laboratory Press, Plainview, N.Y. (1989). Lysate Preparation
  • Untreated rabbit reticulocyte lysate (Ambion) are assembled according to the manufacturer's directions. dsRNA is incubated in the lysate at 30° C for 10 min prior to the addition of mRNAs. Then NOVX RNAs are added and the incubation continued for an additional 60 min. The molar ratio of double stranded RNA and mRNA is about 200: 1. The NOVX mRNA is radiolabeled (using known techniques) and its stability is monitored by gel electrophoresis.
  • the double stranded RNA is internally radiolabeled with a 32 P-ATP. Reactions are stopped by the addition of 2 X proteinase K buffer and deproteinized as described previously (Tuschl et al., Genes Dev., 13:3191-3197 (1999)). Products are analyzed by electrophoresis in 15% or 18% polyacrylamide sequencing gels using appropriate RNA standards. By monitoring the gels for radioactivity, the natural production of 10 to 25 nt RNAs from the double stranded RNA can be determined.
  • the band of double stranded RNA about 21-23 bps, is eluded.
  • the efficacy of these 21-23 mers for suppressing NOVX transcription is assayed in vitro using the same rabbit reticulocyte assay described above using 50 nanomolar of double stranded 21-23 mer for each assay.
  • the sequence of these 21-23 mers is then determined using standard nucleic acid sequencing techniques.
  • RNAs are chemically synthesized using Expedite RNA phosphoramidites and thymidine phosphoramidite (Proligo, Germany). Synthetic oligonucleotides are deprotected and gel-purified (Elbashir, Lendeckel, & Tuschl, Genes & Dev. 15, 188-200 (2001)), followed by Sep-Pak C18 cartridge (Waters, Milford, Mass., USA) purification (Tuschl, etal., Biochemistry, 32:11658-11668 (1993)).
  • RNAs (20 ⁇ M) single strands are incubated in annealing buffer (100 mM potassium acetate, 30 mM HEPES-KOH at pH 7.4, 2 mM magnesium acetate) for 1 min at 90° C followed by 1 h at 37° C.
  • annealing buffer 100 mM potassium acetate, 30 mM HEPES-KOH at pH 7.4, 2 mM magnesium acetate
  • a cell culture known in the art to regularly express NOVX is propagated using standard conditions. 24 hours before transfection, at approx. 80% confluency, the cells are trypsinized and diluted 1 :5 with fresh medium without antibiotics (1-3 X 105 cells/ml) and transferred to 24-well plates (500 ml/well). Transfection is performed using a commercially available lipofection kit and NOVX expression is monitored using standard techniques with positive and negative control. A positive control is cells that naturally express NOVX while a negative control is cells that do not express NOVX. Base-paired 21 and 22 nt siRNAs with overhanging 3' ends mediate efficient sequence-specific mRNA degradation in lysates and in cell culture. Different concentrations of siRNAs are used.
  • siRNAs are effective at concentrations that are several orders of magnitude below the concentrations applied in conventional antisense or ribozyme gene targeting experiments.
  • the above method provides a way both for e deduction of NOVX siRNA sequence and me use of such siRNA for in vitro suppression.
  • In vivo suppression may be performed using the same siRNA using well known in vivo transfection or gene therapy transfection techniques.
  • Another aspect of the invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, or fragments, analogs or derivatives thereof.
  • An "antisense" nucleic acid comprises a nucleotide sequence that is complementary to a "sense" nucleic acid encoding a protein (e.g., complementary to me coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence).
  • antisense nucleic acid molecules comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire NOVX coding strand, or to only a portion thereof.
  • an antisense nucleic acid molecule is antisense to a "coding region" of the coding strand of a nucleotide sequence encoding a NOVX protein.
  • coding region refers to e region of the nucleotide sequence comprising codons which are translated into amino acid residues.
  • e antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding the NOVX protein.
  • noncoding region refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).
  • antisense nucleic acids of the invention can be designed according to the rules of Watson and Crick or Hoogsteen base pairing.
  • the antisense nucleic acid molecule can be complementary to the entire coding region of NOVX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion of the coding or noncoding region of NOVX mRNA.
  • the antisense oligonucleotide can be complementary to the region surrounding the translation start site of NOVX mRNA.
  • An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length.
  • An antisense nucleic acid of e invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in-the art.
  • an antisense nucleic acid e.g., an antisense oligonucleotide
  • an antisense nucleic acid can be chemically synthesized using naturally-occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids (e.g., phosphoromioate derivatives and acridine substimted nucleotides can be used).
  • modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-carboxymethylaminomethyl-2-thiouridine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymemylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 5-methoxyuracil, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, 2-thiouracil, 4-miour
  • 2-methylthio-N6-isopentenyladenine 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid me ylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (ac ⁇ 3)w, and 2,6-diaminopurine.
  • the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in e following subsection).
  • the antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding a NOVX protein to thereby inhibit expression of the protein (e.g., by inhibiting transcription and/or translation).
  • the hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule at binds to DNA duplexes, through specific interactions in me major groove of the double helix.
  • An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site.
  • antisense nucleic acid molecules can be modified to target selected cells and then administered systemically.
  • antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface (e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens).
  • the antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient nucleic acid molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.
  • the antisense nucleic acid molecule of the invention is an oc-anomeric nucleic acid molecule.
  • An ⁇ -anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual ⁇ -units, the strands run parallel to each other. See, e.g., Gaultier, et al, 1987. Nucl. Acids Res. 15: 6625-6641.
  • the antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (See, e.g., Inoue, et al. 1987. Nucl. Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (See, e.g., Inoue, et al, 1987. FEBSLett. 215: 327-330.
  • Nucleic acid modifications include, by way of non-limiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized. These modifications are carried out at least in part to enhance the chemical stability of the modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject.
  • an antisense nucleic acid of me invention is a ribozyme.
  • Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region.
  • ribozymes e.g., hammerhead ribozymes as described in Haselhoff and Geriach 1988. Nature 334: 585-591
  • a ribozyme having specificity for a NOVX-encoding nucleic acid can be designed based upon me nucleotide sequence of a NOVX cDNA disclosed herein (i.e., SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141).
  • SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141.
  • a derivative of a Tetrahymena L-19 INS R ⁇ A can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a OVX-encoding mR ⁇ A. See, e.g. , U.S. Patent
  • NOVX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the NOVX nucleic acid (e.g., the NOVX promoter and/or enhancers) to form triple helical structures that prevent transcription of the NOVX gene in target cells.
  • nucleotide sequences complementary to the regulatory region of the NOVX nucleic acid e.g., the NOVX promoter and/or enhancers
  • the NOVX nucleic acids can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., me stability, hybridization, or solubility of the molecule.
  • the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids. See, e.g., Hyrup, et al, 1996. BioorgMed Chem 4: 5-23.
  • peptide nucleic acids refer to nucleic acid mimics (e.g., DNA mimics) in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleotide bases are retained.
  • the neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength.
  • the synthesis of PNA oligomer can be performed using standard solid phase peptide synthesis protocols as described in Hyrup, et al, 1996. supra; Perry-O'Keefe, et al, 1996. Proc. Natl. Acad. Sci. USA 93: 14670-14675.
  • PNAs of NOVX can be used in therapeutic and diagnostic applications.
  • PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication.
  • PNAs of NOVX can also be used, for example, in e analysis of single base pair mutations in a gene (e.g., PNA directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., Si nucleases (See, Hyrup, et al, I996.supra); or as probes or primers for DNA sequence and hybridization (See, Hyrup, et al, 1996, supra; Perry-O'Keefe, et al, 1996.
  • PNAs of NOVX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in e art.
  • PNA-DNA chimeras of NOVX can be generated at may combine e advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes (e.g. , RNase H and DNA polymerases) to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity.
  • PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleotide bases, and orientation (see, Hyrup, et al., 1996. supra).
  • the synthesis of PNA-DNA chimeras can be performed as described in Hyrup, et al, 1996. supra and Finn, et al, 1996. Nucl Acids Res 24: 3357-3363.
  • a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5' end of DNA. See, e.g., Mag, et al, 1989. Nucl Acid Res 17: 5973-5988. PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment. See, e.g., Finn, et al, 1996. supra.
  • chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment. See, e.g., Petersen, et al, 1975. Bioorg. Med. Chem. Lett. 5: 1119-11124.
  • the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger, et al, 1989. Proc. Nail. Acad. Sci. U.S.A. 86: 6553-6556; Lemaitre, et al, 1987. Proc. Natl. Acad. Sci. 84: 648-652; PCT Publication No. WO88/09810) or the blood-brain barrier (see, e.g., PCT Publication No. WO 89/10134).
  • peptides e.g., for targeting host cell receptors in vivo
  • agents facilitating transport across the cell membrane see, e.g., Letsinger, et al, 1989. Proc. Nail. Acad. Sci. U.S.A. 86: 6553-6556; Lemaitre, et al,
  • oligonucleotides can be modified with hybridization triggered cleavage agents (see, e.g., Krol, et al, 1988. BioTechniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988. Pharm. Res. 5: 539-549).
  • the oligonucleotide maybe conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, and the like.
  • a polypeptide according to me invention includes a polypeptide including the amino acid sequence of NOVX polypeptides whose sequences are provided in any one of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • the invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residues shown in any one of SEQ ID NO:2n, wherein n is an integer between 1 and 141, while still encoding a protein mat maintains its NOVX activities and physiological functions, or a functional fragment thereof.
  • a NOVX variant that preserves NOVX-like function includes any variant in which residues at a particular position in the sequence have been substimted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues of e parent protein as well as the possibility of deleting one or more residues from the parent sequence. Any amino acid substimtion, insertion, or deletion is encompassed by e invention. In favorable circumstances, the substimtion is a conservative substimtion as defined above.
  • One aspect of the invention pertains to isolated NOVX proteins, and biologically-active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-NOVX antibodies.
  • native NOVX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques.
  • NOVX proteins are produced by recombinant DNA techniques.
  • a NOVX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
  • an “isolated” or “purified” polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the NOVX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized.
  • the language “substantially free of cellular material” includes preparations of NOVX proteins in which the protein is separated from cellular components of me cells from which it is isolated or recombinantly-produced.
  • the language "substantially free of cellular material” includes preparations of NOVX proteins having less than about 30% (by dry weight) of non-NOVX proteins (also referred to herein as a "contaminating protein”), more preferably less an about 20% of non-NOVX proteins, still more preferably less than about 10% of non-NOVX proteins, and most preferably less an about 5% of non-NONX proteins.
  • non-NOVX proteins also referred to herein as a "contaminating protein”
  • ⁇ OVX protein or biologically-active portion thereof is recombinantly-produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of me ⁇ OVX protein preparation.
  • the language “substantially free of chemical precursors or other chemicals” includes preparations of ⁇ OVX proteins in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein.
  • the language “substantially free of chemical precursors or other chemicals” includes preparations of ⁇ OVX proteins having less than about 30% (by dry weight) of chemical precursors or non- ⁇ OVX chemicals, more preferably less than about 20% chemical precursors or non- ⁇ OVX chemicals, still more preferably less than about 10% chemical precursors or non-NOVX chemicals, and most preferably less than about 5%> chemical precursors or non-NOVX chemicals.
  • Biologically-active portions of NOVX proteins include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequences of the NOVX proteins (e.g. , the amino acid sequence of SEQ ED NO:2n, wherein n is an integer between 1 and 141) that include fewer amino acids than the full-length NOVX proteins, and exhibit at least one activity of a NOVX protein.
  • biologically-active portions comprise a domain or motif with at least one activity of the NOVX protein.
  • a biologically-active portion of a NOVX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acid residues in length.
  • the NOVX protein has an amino acid sequence of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
  • the NOVX protein is substantially homologous to SEQ ID NO:2w, wherein n is an integer between 1 and 141, and retains the functional activity of the protem of SEQ ID NO:2n, wherein n is an integer between 1 and 141, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail, below.
  • e NOVX protein is a protein that comprises an amino acid sequence at least about 45% homologous to the amino acid sequence of SEQ ID NO:2ra, wherein n is an integer between 1 and 141, and retains the functional activity of the NOVX proteins of SEQ ID NO:2ra, wherein n is an integer between 1 and 141.
  • sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “homology” is equivalent to amino acid or nucleic acid “identity”
  • the nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch, 1970. JMolBiol48: 443-453.
  • sequence identity refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison.
  • percentage of sequence identity is calculated by comparing two optimally aligned sequences over at region of comparison, determining me number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
  • the identical nucleic acid base e.g., A, T, C, G, U, or I, in the case of nucleic acids
  • substantially identical denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.
  • NOVX chimeric or fusion proteins As used herein, a NOVX "chimeric protein” or “fusion protein” comprises a NOVX polypeptide operatively-linked to a non-NOVX polypeptide.
  • An "NOVX polypeptide” refers to a polypeptide having an amino acid sequence corresponding to a NOVX protein of SEQ ID NO:2n, wherein n is an integer between 1 and 141, whereas a "non-NOVX polypeptide” refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the NOVX protein, e.g.
  • a protein that is different from the NOVX protein and that is derived from me same or a different organism within a NOVX fusion protein the NOVX polypeptide can correspond to all or a portion of a NOVX protein.
  • a NOVX fusion protein comprises at least one biologically-active portion of a NOVX protein.
  • a NOVX fusion protein comprises at least two biologically-active portions of a NOVX protein.
  • a NOVX fusion protein comprises at least three biologically-active portions of a NOVX protein.
  • the term "operatively-linked" is intended to indicate that the NOVX polypeptide and the non-NOVX polypeptide are fused in-frame with one another.
  • the non-NOVX polypeptide can be fused to the N-terminus or C-terminus of the NOVX polypeptide.
  • the fusion protein is a GST-NO VX fusion protein in which the NOVX sequences are fused to me C-terminus of the GST (glutathione S-transferase) sequences.
  • Such fusion proteins can facilitate the purification of recombinant NOVX polypeptides.
  • me fusion protein is a NOVX protein containing a heterologous signal sequence at its N-terminus.
  • expression and/or secretion of NOVX can be increased through use of a heterologous signal sequence.
  • me fusion protein is a NOVX-immunoglobulin fusion protein in which the NOVX sequences are fused to sequences derived from a member of me immunoglobulin protein family.
  • the NOVX-immunoglobulin fusion proteins of the invention can be incorporated into pharmaceutical compositions and admimstered to a subject to inhibit an interaction between a NOVX ligand and a NOVX protein on the surface of a cell, to thereby suppress NOVX-mediated signal transduction in vivo.
  • the NOVX-immunoglobulin fusion proteins can be used to affect the bioavailability of a NOVX cognate ligand. Inhibition of the NOVX ligand NOVX interaction may be useful therapeutically for both me treatment of proliferative and differentiative disorders, as well as modulating (e.g. promoting or inhibiting) cell survival.
  • the NOVX ligand NOVX interaction may be useful therapeutically for both me treatment of proliferative and
  • NOVX-immunoglobulin fusion proteins of the invention can be used as immunogens to produce anti-NOVX antibodies in a subject, to purify NOVX ligands, and in screening assays to identify molecules that inhibit the interaction of NOVX with a NOVX ligand.
  • a NOVX chimeric or fusion protem of the invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamphfied to generate a chimeric gene sequence (.see, e.g., Ausubel, et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992).
  • anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamphfied to generate a chimeric gene sequence
  • a chimeric gene sequence see, e.g., Ausubel, et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992.
  • many expression vectors are commercially available mat already encode a fusion moiety (e.g., a GST polypeptide).
  • a NOVX-encoding nucleic acid
  • the invention also pertains to variants of the NOVX proteins that function as either NOVX agonists (i.e., mimetics) or as NOVX antagonists.
  • Variants of the NOVX protein can be generated by mutagenesis (e.g., discrete point mutation or truncation of the NOVX protein).
  • An agonist of the NOVX protein can retain substantially the same, or a subset of, the biological activities of the naturally occurring form of the NOVX protein.
  • An antagonist of the NOVX protein can inhibit one or more of the activities of the naturally occurring form of the NOVX protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade which includes the NOVX protein.
  • treatment of a subject with a variant having a subset of me biological activities of e naturally occurring form of the protein has fewer side effects in a subject relative to treatment with me naturally occurring form of the NOVX proteins.
  • Variants of the NOVX proteins that function as either NOVX agonists (i.e., mimetics) or as NOVX antagonists can be identified by screening combinatorial libraries of mutants (e.g. , truncation mutants) of the NOVX proteins for NOVX protein agonist or antagonist activity.
  • a variegated library of NOVX variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library.
  • a variegated library of NOVX variants can be produced by, for example, enzymatically ligating a mixmre of synthetic oligonucleotides into gene sequences such that a degenerate set of potential NOVX sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing e set of NOVX sequences therein.
  • fusion proteins e.g., for phage display
  • degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the desired set of potential NOVX sequences.
  • Methods for synthesizing degenerate oligonucleotides are well-known within the art. See, e.g., Narang, 1983. Tetrahedron 39: 3; Itakura, et al, 1984. Anna. Rev. Biochem. 53: 323; Itakura, et al, 1984. Science 198: 1056; Ike, et al, 1983. Nucl. Acids Res. 11: 477.
  • libraries of fragments of the NOVX protein coding sequences can be used to generate a variegated population of NOVX fragments for screening and subsequent selection of variants of a NOVX protein.
  • a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of a NOVX coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double-stranded DNA that can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with S t nuclease, and ligating me resulting fragment library into an expression vector.
  • expression libraries can be derived which encodes N-terminal and internal fragments of various sizes of the NOVX proteins.
  • Recursive ensemble mutagenesis (REM), a new technique at enhances me frequency of functional mutants in the libraries, can be used in combination with e screening assays to identify NOVX variants. See, e.g., Arkin and Yourvan, 1992. Proc. Natl Acad. Sci. USA 89: 7811-7815; Delgrave, et al, 1993. Protein Engineering 6:327-331. Anti-NOVX Antibodies
  • antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • immunoglobulin immunoglobulin
  • Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, F ab , Fab- and F( a b ' ) 2 fragments, and an F a b expression library.
  • antibody molecules obtained from humans relates to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule.
  • Certain classes have subclasses as well, such as IgG ls IgG 2 , and others.
  • me light chain may be a kappa chain or a lambda chain.
  • Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.
  • An isolated protein of the invention intended to serve as an antigen, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that immunospecifically bind me antigen, using standard techniques for polyclonal and monoclonal antibody preparation.
  • the foil-length protein can be used or, alternatively, the invention provides antigenic peptide fragments of the antigen for use as immunogens.
  • An antigenic peptide fragment comprises at least 6 amino acid residues of the amino acid sequence of me foil length protein, such as an amino acid sequence of SEQ ED NO:2 «, wherein n is an integer between 1 and 141 , and encompasses an epitope thereof such that an antibody raised against the peptide forms a specific immune complex with the foil length protein or with any fragment mat contains the epitope.
  • the antigenic peptide comprises at least 10 amino acid residues, or at least 15 amino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues.
  • Preferred epitopes encompassed by the antigenic peptide are regions of the protein mat are located on its surface; commonly these are hydrophilic regions.
  • At least one epitope encompassed by the antigenic peptide is a region of NOVX that is located on the surface of the protein, e.g., a hydrophilic region.
  • a hydrophobicity analysis of the human NOVX protein sequence will indicate which regions of a NOVX polypeptide are particularly hydrophilic and, merefore, are likely to encode surface residues useful for targeting antibody production.
  • hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in me art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation. See, e.g., Hopp and Woods, 1981, Proc. Nat.
  • epitope includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor.
  • Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • a NOVX polypeptide or a fragment mereof comprises at least one antigenic epitope.
  • An anti-NOVX antibody of the present invention is said to specifically bind to antigen NOVX when e equilibrium binding constant (K D ) is ⁇ 1 ⁇ M, preferably ⁇ 100 nM, more preferably ⁇ 10 nM, and most preferably ⁇ 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art.
  • K D equilibrium binding constant
  • a protein of the invention, or a derivative, fragment, analog, homolog or ortholog thereof may be utilized as an immunogen in me generation of antibodies that immunospecifically bind these protein components.
  • polyclonal Antibodies For the production of polyclonal antibodies, various suitable host animals (e.g. , rabbit, goat, mouse or other mammal) may be immunized by one or more injections with me native protein, a synthetic variant thereof, or a derivative of the foregoing.
  • An appropriate immunogenic preparation can contain, for example, the naturally occurring immunogenic protein, a chemically synthesized polypeptide representing the immunogenic protein, or a recombinantly expressed immunogenic protein.
  • the protein may be conjugated to a second protein known to be immunogenic in e mammal being immunized.
  • immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor.
  • the preparation can further include an adjuvant.
  • adjuvants used to increase e immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), adjuvants usable in humans such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents.
  • Additional examples of adjuvants which can be employed include MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
  • the polyclonal antibody molecules directed against the immunogenic protein can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson (The Engineer, published by The Engineer, Inc., Philadelphia PA, Vol. 14, No. 8 (April 17, 2000), pp. 25-28).
  • MAb monoclonal antibody
  • CDRs complementarity determining regions
  • MAbs thus contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.
  • Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975).
  • a mouse, hamster, or other appropriate host animal is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
  • the lymphocytes can be immunized in vitro.
  • the immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protem thereof.
  • peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired.
  • the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59-103).
  • Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin.
  • rat or mouse myeloma cell lines are employed.
  • the hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfosed, immortalized cells.
  • a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfosed, immortalized cells.
  • the culture medium for me hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
  • Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by me selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtamed, for instance, from the Salk mstimte Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63).
  • the culture medium in which the hybridoma cells are cultured can then be assayed for me presence of monoclonal antibodies directed against me antigen.
  • the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunoabsorbent assay
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980). It is an objective, especially important in therapeutic applications of monoclonal antibodies, to identify antibodies having a high degree of specificity and a high binding affinity for me target antigen.
  • the clones can be subcloned by limiting dilution procedures and grown by standard methods (Goding,1986). Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, me hybridoma cells can be grown in vivo as ascites in a mammal.
  • the monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • the monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567.
  • DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the hybridoma cells of the invention serve as a preferred source of such DNA.
  • the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • the DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of me homologous murine sequences (U.S. Patent No. 4,816,567; Morrison, Nature 368, 812-13 (1994)) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
  • non-immunoglobulin polypeptide can be substimted for the constant domains of an antibody of me invention, or can be substimted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
  • the antibodies directed against the protein antigens of the invention can further comprise humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin.
  • Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') 2 or other antigen-binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin, and contain minimal sequence derived from a non-human immunoglobulin.
  • Humanization can be performed following me method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. (See also U.S. Patent No. 5,225,539.) In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., 1986; Riechmann et al., 1988; and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)).
  • Fc immunoglobulin constant region
  • Fully human antibodies essentially relate to antibody molecules in which the entire sequence of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed "human antibodies", or “folly human antibodies” herein.
  • Human monoclonal antibodies can be prepared by the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al, 1983 Immunol Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985 In: MONOCLONAL AN ⁇ BODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).
  • Human monoclonal antibodies may be utilized in the practice of me present invention and may be produced by using human hybridomas (see Cote, et al., 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see Cole, et al, 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).
  • human antibodies can also be produced using additional techniques, including phage display libraries (Hoogenboom and Winter, J. Mol Biol, 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)).
  • human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles mat seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patent Nos.
  • Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce folly human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen.
  • transgenic nonhuman animals which are modified so as to produce folly human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen.
  • the endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome.
  • the human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments.
  • An animal which provides all me desired modifications is men obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than me foil complement of e modifications.
  • nonhuman animal is a mouse, and is termed the XenomouseTM as disclosed in PCT publications WO 96/33735 and WO 96/34096.
  • This animal produces B cells which secrete folly human immunoglobulins.
  • the antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies.
  • e genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules.
  • U.S. Patent No. 5,939,598 An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No. 5,939,598. It can be obtained by a method including deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent rearrangement of me locus and to prevent formation of a transcript of a rearranged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain me gene encoding the selectable marker.
  • a method for producing an antibody of interest such as a human antibody, is disclosed in U.S. Patent No. 5,916,771. It includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fosing the two cells to form a hybrid cell The hybrid cell expresses an antibody containing the heavy chain and the light chain.
  • techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see e.g., U.S. Patent No. 4,946,778).
  • methods can be adapted for me construction of F a b expression libraries (see e.g., Huse, et al., 1989 Science 246: 1275-1281) to allow rapid and effective identification of monoclonal F a fragments with the desired specificity for a protein or derivatives, fragments, analogs or homologs mereof.
  • Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F a v )2 fragment produced by pepsin digestion of an antibody molecule; (ii) an F ab fragment generated by reducing me disulfide bridges of an F( a b ' )2 fragment; (iii) an F ab fragment generated by the treatment of me antibody molecule with papain and a reducing agent and (iv) F v fragments.
  • Bispecific antibodies are monoclonal, preferably human or humanized, antibodies at have binding specificities for at least two different antigens.
  • one of the binding specificities is for an antigenic protein of the invention.
  • the second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit.
  • bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305:537-539 (1983)). Because of me random assortment of immunoglobulin heavy and light chains, these hybridomas (quadro as) produce a potential mixture often different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829, published 13 May 1993, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
  • Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding present in at least one of me fusions.
  • DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, e immunoglobulin light chain are inserted into separate expression vectors, and are co-transfected into a suitable host organism.
  • me interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
  • the preferred interface comprises at least a part of the CH3 region of an antibody constant domain.
  • one or more small amino acid side chains from me interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
  • Bispecific antibodies can be prepared as foil length antibodies or antibody fragments
  • bispecific antibodies e.g. F(ab') 2 bispecific antibodies.
  • Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of me dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thio trobenzoate (TNB) derivatives.
  • TAB thio trobenzoate
  • One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
  • the bispecific antibodies produced can be used as agents for e selective immobilization of enzymes.
  • Fab' fragments can be directly recovered from E. coli and chemically coupled to form bispecific antibodies.
  • Shalaby et al., J. Exp. Med. 175:217-225 (1992) describe the production of a folly humanized bispecific antibody F(ab') 2 molecule.
  • Each Fab' fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form me bispecific antibody.
  • the bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes agamst human breast tumor targets.
  • Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described.
  • bispecific antibodies have been produced using leucine zippers.
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
  • the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers.
  • This method can also be utilized for me production of antibody homodimers.
  • the "diabody” technology described by Hollinger et al, Proc. Natl Acad. Sci. USA 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments.
  • the fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
  • V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen-binding sites.
  • sFv single-chain Fv
  • Antibodies with more than two valencies are contemplated.
  • trispecific antibodies can be prepared. Tutt et al., J. Immunol 147:60 (1991).
  • bispecific antibodies can bind to two different epitopes, at least one of which originates in me protein antigen of me invention.
  • an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD 16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen.
  • Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen.
  • These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA.
  • a cytotoxic agent or a radionuclide chelator such as EOTUBE, DPTA, DOTA, or TETA.
  • Another bispecific antibody of interest binds the protein antigen described herein and forther binds tissue factor (TF).
  • Heteroconjugate antibodies are also within the scope of the present invention.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells
  • the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond.
  • suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S.
  • Patent No. 4,676,980
  • e antibody of the invention can be modified with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating cancer.
  • cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region.
  • the homodimeric antibody thus generated can have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al, J. Exp Med., 176: 1191-1195 (1992) and Shopes, J. Immunol., 148: 2918-2922 (1992).
  • Homodimeric antibodies with enhanced anti-tumor activity can also be prepared using heterobifonctional cross-linkers as described in Wolff et al. Cancer Research, 53: 2560-2565 (1993).
  • an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design, 3: 219-230 (1989). Immunoconjugates
  • the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fongal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fongal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAP ⁇ , and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • radionuclides are available for the production of radioconjugated antibodies. Examples include 212 Bi, 131 1, 131 In, 90 Y, and 186 Re. Conjugates of me antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), dusocyanates (such as tolyene 2,6-diisocyanate), and bis--coup
  • a ricin immunotoxin can be prepared as described in Vitetta et al, Science. 238: 1098 (1987).
  • Carbon- 14-labeled l-isothiocyanatobenzyl-3-memyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
  • the antibody in another embodiment, can be conjugated to a "receptor" (such streptavidin) for utilization in tumor pretargeting wherein me antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and men administration of a "ligand” (e.g. , avidin) that is in turn conjugated to a cytotoxic agent.
  • a "receptor” such streptavidin
  • the antibodies disclosed herein can also be formulated as immunoliposomes.
  • Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
  • Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatizedphosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al .,.J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction.
  • a chemotherapeutic agent such as Doxorubicin
  • methods for the screening of antibodies that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELISA) and other immunologically mediated techniques known within the art.
  • ELISA enzyme linked immunosorbent assay
  • selection of antibodies that are specific to a particular domain of an NOVX protein is facilitated by generation of hybridomas that bind to the fragment of an NOVX protein possessing such a domain.
  • antibodies that are specific for a desired domain within an NOVX protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.
  • Antibodies directed against a NOVX protein of the invention may be used in methods known within me art relating to the localization and/or quantitation of a NOVX protein (e.g., for use in measuring levels of me NOVX protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging me protein, and e like).
  • antibodies specific to a NOVX protein, or derivative, fragment, analog or homolog mereof, that contain the antibody derived antigen binding domain are utilized as pharmacologically active compounds (referred to hereinafter as "Therapeutics").
  • An antibody specific for a NOVX protein of the invention can be used to isolate a NOVX polypeptide by standard techniques, such as immunoaffinity, chromatography or immunoprecipitation.
  • An antibody to a NOVX polypeptide can facilitate the purification of a natural NOVX antigen from cells, or of a recombinantly produced NOVX antigen expressed in host cells.
  • an anti-NOVX antibody can be used to detect the antigenic NOVX protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate e abundance and pattern of expression of the antigenic NOVX protem.
  • Antibodies directed against a NOVX protein can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125 I, 131 I, 35 S or 3 H.
  • Antibodies of the invention may be used as therapeutic agents. Such agents will generally be employed to treat or prevent a disease or pathology in a subject.
  • An antibody preparation preferably one having high specificity and high affinity for its target antigen, is admimstered to the subject and will generally have an effect due to its binding with the target.
  • Such an effect may be one of two kinds, depending on e specific nature of the interaction between the given antibody molecule and the target antigen in question.
  • administration of the antibody may abrogate or inhibit the binding of the target with an endogenous ligand to which it naturally binds.
  • me antibody binds to the target and masks a binding site of the naturally occurring ligand, wherein the ligand serves as an effector molecule.
  • the receptor mediates a signal transduction pathway for which ligand is responsible.
  • the effect may be one in which the antibody elicits a physiological result by virtue of binding to an effector binding site on the target molecule.
  • the target a receptor having an endogenous ligand which may be absent or defective in the disease or pathology, binds the antibody as a surrogate effector ligand, initiating a receptor-based signal transduction event by the receptor.
  • a therapeutically effective amount of an antibody of the invention relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the antibody and its target antigen that, in certain cases, interferes with me functioning of the target, and in other cases, promotes a physiological response.
  • the amount required to be administered will furthermore depend on the binding affinity of the antibody for its specific antigen, and will also depend on the rate at which an administered antibody is depleted from the free volume other subject to which it is administered.
  • Common ranges for therapeutically effective dosing of an antibody or antibody fragment of me invention may be, by way of nonhmiting example, from about 0.1 mg/kg body weight to about 50 mg/kg body weight. Common dosing frequencies may range, for example, from twice daily to once a week.
  • compositions of Antibodies can be administered for the treatment of various disorders in the form of pharmaceutical compositions.
  • Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington : The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al, editors) Mack Pub. Co., Easton, Pa.
  • the antigenic protein is intracellular and whole antibodies are used as inhibitors, mtemalizing antibodies are preferred.
  • liposomes can also be used to deliver the antibody, or an antibody fragment, into cells. Where antibody fragments are used, the smallest inhibitory fragment that specifically binds to the binding domain of me target protein is preferred.
  • peptide molecules can be designed that retain the ability to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. See, e.g., Marasco et al, Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993).
  • the formulation herein can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities mat do not adversely affect each other.
  • the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
  • cytotoxic agent such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent.
  • Such molecules are suitably present in combination in amounts that are effective for me purpose intended.
  • the active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules
  • the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate non-degradable ethylene-vinyl acetate
  • degradable lactic acid-glycolic acid copolymers such as me LUPRON DEPOT TM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate)
  • poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • An agent for detecting an analyte protein is an antibody capable of binding to an analyte protein, preferably an antibody with a detectable label.
  • Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment mereof (e.g., F ab or F( ab)2 ) can be used.
  • the term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled.
  • biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term "biological sample”, therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph. That is, the detection method of the invention can be used to detect an analyte mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
  • in vitro techniques for detection of an analyte mRNA include Northern hybridizations and in situ hybridizations.
  • In vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence.
  • In vitro techniques for detection of an analyte genomic DNA include Southern hybridizations. Procedures for conducting immunoassays are described, for example in "ELISA: Theory and Practice: Methods in Molecular Biology", Vol. 42, J. R. Crowther (Ed.) Human Press, Totowa, NJ, 1995; "Immunoassay", E. Diamandis and T.
  • in vivo techniques for detection of an analyte protein include introducing into a subject a labeled anti-an analyte protein antibody.
  • the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • vectors preferably expression vectors, containing a nucleic acid encoding a NOVX protem, or derivatives, fragments, analogs or homologs mereof.
  • vector refers to a nucleic acid molecule capable of transporting anomer nucleic acid to which it has been linked.
  • vector is a nucleic acid molecule capable of transporting anomer nucleic acid to which it has been linked.
  • Plasmid which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.
  • a viral vector Another type of vector is a viral vector, wherein additional DNA segments can be ligated into e viral genome.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g, non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively-linked.
  • expression vectors are referred to herein as "expression vectors".
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and vector can be used interchangeably as the plasmid is the most commonly used form of vector.
  • the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
  • the recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, mat is operatively-linked to the nucleic acid sequence to be expressed.
  • "operably-linked" is intended to mean mat the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
  • regulatory sequence is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those mat direct expression of e nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
  • the expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., NOVX proteins, mutant forms of NOVX proteins, fusion proteins, etc.).
  • the recombinant expression vectors of the invention can be designed for expression of NOVX proteins in prokaryotic or eukaryotic cells.
  • NOVX proteins can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed forther in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).
  • the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
  • Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein.
  • Such fosion vectors typically serve three pu ⁇ oses: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (Hi) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
  • a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
  • enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
  • Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988.
  • GST glutathione S-transferase
  • E. coli expression vectors examples include pTrc (Amrann et al, (1988) Gene 69:301-315) an pET lld (Studier et ⁇ /., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
  • One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 119-128.
  • Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized inE. coli (see, e.g., Wada, et al, 1992. Nucl. Acids Res.20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
  • the NOVX expression vector is a yeast expression vector.
  • yeast expression vectors for expression in yeast Saccharomyces cerivisae include pYepSecl (Baldari, et al, 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al, 1987. Gene 54: 113-123), pYES2 (Invitrogen Co ⁇ oration, San Diego, Calif), and picZ (InVitrogen Co ⁇ , San Diego, Calif).
  • NOVX can be expressed in insect cells using baculovirus expression vectors.
  • Baculovirus vectors available for expression of proteins in cultured insect cells e.g., SF9 cells
  • Baculovirus vectors available for expression of proteins in cultured insect cells e.g., SF9 cells
  • m include the pAc series (Smith, et al, 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
  • a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector.
  • mammalian expression vectors include ⁇ CDM8 (Seed, 1981. Nature 329: 840) andpMT2PC (Kaufinan, etal, 1987. EMBO J. 6: 187-195).
  • me expression vector's controlpaths are often provided by viral regulatory elements.
  • commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40.
  • the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
  • tissue-specific regulatory elements are known in e art.
  • suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al, 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
  • the invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to NOVX mRNA.
  • Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen mat direct constitutive, tissue specific or cell type specific expression of antisense RNA.
  • the antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
  • RNA as a molecular tool for genetic analysis
  • Another aspect of e invention pertains to host cells into which a recombinant expression vector of the invention has been introduced.
  • progeny refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of me term as used herein.
  • a host cell can be any prokaryotic or eukaryotic cell.
  • NOVX protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
  • transformation and transfection are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
  • a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
  • selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate.
  • Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding NOVX or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while me other cells die).
  • a host cell of the invention such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) NOVX protein. Accordingly, the invention further provides methods for producing NOVX protein using the host cells of the invention.
  • me method comprises culturing the host cell of invention (into which a recombinant expression vector encoding NOVX protein has been introduced) in a suitable medium such that NOVX protein is produced.
  • the method forther comprises isolating NOVX protein from the medium or me host cell.
  • the host cells of the invention can also be used to produce non-human transgenic animals.
  • a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which NOVX protein-coding sequences have been introduced.
  • Such host cells can then be used to create non-human transgenic animals in which exogenous NOVX sequences have been introduced into their genome or homologous recombinant animals in which endogenous NOVX sequences have been altered.
  • Such animals are useful for studying me function and/or activity of NOVX protein and for identifying and/or evaluating modulators of NOVX protem activity.
  • a "transgenic animal” is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene.
  • Other examples of transgenic animals mclude non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc.
  • a transgene is exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and that remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal.
  • a "homologous recombinant animal” is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous NOVX gene has been altered by homologous recombination between me endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal.
  • a transgenic animal of the invention can be created by introducing NO VX-encoding nucleic acid into the male pronuclei of a fertilized oocyte (e.g., by microinjection, retroviral infection) and allowing the oocyte to develop in a pseudopregnant female foster animal.
  • the human NOVX cDNA sequences i.e., any one of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, can be introduced as a transgene into the genome of a non-human animal.
  • a non-human homologue of the human NOVX gene such as a mouse NOVX gene, can be isolated based on hybridization to me human NOVX cDNA (described forther supra) and used as a transgene.
  • Intronic sequences and polyadenylation signals can also be included in me transgene to increase the efficiency of expression of the transgene.
  • a tissue-specific regulatory sequence(s) can be operably-linked to me NOVX transgene to direct expression of NOVX protein to particular cells.
  • transgenic founder animal can be identified based upon the presence of the NOVX transgene in its genome and/or expression of NOVX mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene-encoding NOVX protein can forther be bred to other transgenic animals carrying other transgenes.
  • a vector which contains at least a portion of a NOVX gene into which a deletion, addition or substimtion has been introduced to thereby alter, e.g., functionally disrupt, me NOVX gene.
  • the NOVX gene can be a human gene (e.g., the cDNA of any one of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141), but more preferably, is a non-human homologue of a human NOVX gene.
  • a mouse homologue of human NOVX gene of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, can be used to construct a homologous recombination vector suitable for altering an endogenous NOVX gene in the mouse genome.
  • the vector is designed such mat, upon homologous recombination, the endogenous NOVX gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).
  • the vector can be designed such that, upon homologous recombination, the endogenous NOVX gene is mutated or otherwise altered but still encodes functional protein (e.g., me upstream regulatory region can be altered to thereby alter the expression of the endogenous NOVX protein).
  • the altered portion of the NOVX gene is flanked at its 5'- and 3'-termini by additional nucleic acid of me NOVX gene to allow for homologous recombination to occur between the exogenous NOVX gene carried by me vector and an endogenous NOVX gene in an embryonic stem cell.
  • flanking NOVX nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene.
  • flanking DNA typically, several kilobases of flanking DNA (bom at the 5'- and 3'-termini) are included in the vector. See, e.g., Thomas, et al, 1987. Cell 51: 503 for a description of homologous recombination vectors.
  • the vector is ten introduced into an embryonic stem cell line (e.g., by electioporation) and cells in which the introduced NOVX gene has homologously-recombined with me endogenous NOVX gene are selected. See, e.g., Li, et al, 1992. Cell 69: 915.
  • the selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras.
  • an animal e.g., a mouse
  • aggregation chimeras See, e.g., Bradley, 1987.
  • TERATOCARCINOMAS AND EMBRYONIC STEM CELLS A PRACTICAL APPROACH, Robertson, ed. IRL, Oxford, pp.
  • a chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term.
  • Progeny harboring the homologously-recombined DNA in their germ cells can be used to breed animals in which all cells of me animal contain the homologously-recombined DNA by germline transmission of the transgene.
  • Methods for constructing homologous recombination vectors and homologous recombinant animals are described forther in Bradley, 1991. Curr. Opin. Biotechnol 2: 823-829; PCT International Publication Nos.: WO 90/11354; WO 91/01140; WO 92/0968; and WO 93/04169.
  • transgenic non-humans animals can be produced that contain selected systems that allow for regulated expression of the transgene.
  • a system is the cre/loxP recombinase system of bacteriophage PI.
  • cre/loxP recombinase system See, e.g., Lakso, et al, 1992. Proc. Natl. Acad. Sci. USA 89: 6232-6236.
  • FLP recombinase system of Saccharomyces cerevisiae. See, O'Gorman, etal, 1991. Science 251:1351-1355.
  • mice containing transgenes encoding both the Cre recombinase and a selected protein are required.
  • Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
  • Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, et al, 1997. Nature 385: 810-813.
  • a cell e.g. , a somatic cell
  • the quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of me same species from which the quiescent cell is isolated.
  • the reconstructed oocyte is then cultured such that it develops to morula or blastocyte and men transferred to pseudopregnant female foster animal.
  • the offspring borne of this female foster animal will be a clone of me animal from which e cell (e.g., the somatic cell) is isolated.
  • compositions suitable for administration can be inco ⁇ orated into pharmaceutical compositions suitable for administration.
  • compositions typically comprise the nucleic acid molecule, protem, or antibody and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifongal agents, isotonic and abso ⁇ tion delaying agents, and the like, compatible with pharmaceutical administration.
  • Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is inco ⁇ orated herein by reference.
  • Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used.
  • the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be inco ⁇ orated into the compositions.
  • a pharmaceutical composition of me invention is formulated to be compatible with its intended route of administration.
  • routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include me following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyemylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for me adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor EL TM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against e contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and me like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by me use of a coating such as lecithin, by me maintenance of the required particle size in me case of dispersion and by the use of surfactants .
  • Prevention of me action of microorganisms can be achieved by various antibacterial and antifongal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in e composition.
  • Prolonged abso ⁇ tion of the injectable compositions can be brought about by including in the composition an agent which delays abso ⁇ tion, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by inco ⁇ orating me active compound (e.g. , a NOVX protein or anti-NOVX antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by inco ⁇ orating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution mereof.
  • Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For me pu ⁇ ose of oral therapeutic administration, the active compound can be inco ⁇ orated with excipients and used in me form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration can also be by transmucosal or transdermal means.
  • penetrants appropriate to me barrier to be permeated are used in me formulation.
  • penetrants are generally known in me art, and include, for example, for transmucosal administration, detergents, bile salts, and fosidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
  • the compounds can also be prepared in the form of suppositories (e.g. , with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
  • suppositories e.g. , with conventional suppository bases such as cocoa butter and other glycerides
  • retention enemas for rectal delivery.
  • the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
  • the materials can also be obtained commercially from Alza Co ⁇ oration and Nova Pharmaceuticals, Inc.
  • Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in me art, for example, as described in U.S. Patent No. 4,522,811.
  • Dosage unit form refers to physically discrete units suited as unitary dosages for me subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce me desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and me particular therapeutic effect to be achieved, and me limitations inherent in the art of compounding such an active compound for the treatment of individuals.
  • the nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors.
  • Gene merapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see, e.g., U.S. Patent No. 5,328,470) or by stereotactic injection (see, e.g., Chen, et al, 1994. Proc. Natl. Acad. Sci. USA 91: 3054-3057).
  • the pharmaceutical preparation of the gene merapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded.
  • the pharmaceutical preparation can include one or more cells that produce the gene delivery system.
  • compositions can be included in a container, pack, or dispenser together with instructions for administration. Screening and Detection Methods
  • the isolated nucleic acid molecules of the invention can be used to express NOVX protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect NOVX mRNA (e.g., in a biological sample) or a genetic lesion in a NOVX gene, and to modulate NOVX activity, as described forther, below.
  • the NOVX proteins can be used to screen drugs or compounds that modulate me NOVX protein activity or expression as well as to treat disorders characterized by insufficient or excessive production of NOVX protein or production of NOVX protein forms that have decreased or aberrant activity compared to NOVX wild-type protein (e.g.; diabetes (regulates insulin release); obesity (binds and transport lipids); metabolic disturbances associated with obesity, the metabolic syndrome X as well as anorexia and wasting disorders associated with chronic diseases and various cancers, and infectious disease(possesses anti-microbial activity) and the various dyslipidemias.
  • me anti-NOVX antibodies of the invention can be used to detect and isolate NOVX proteins and modulate NOVX activity.
  • the invention can be used in methods to influence appetite, abso ⁇ tion of nutrients and the disposition of metabolic substrates in both a positive and negative fashion.
  • the invention forther pertains to novel agents identified by me screening assays described herein and uses mereof for treatments as described, supra.
  • the invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i. e. , candidate or test compounds or agents (e.g. , peptides, peptidomimetics, small molecules or other drugs) that bind to NOVX proteins or have a stimulatory or inhibitory effect on, e.g., NOVX protein expression or NOVX protein activity.
  • modulators i. e. , candidate or test compounds or agents (e.g. , peptides, peptidomimetics, small molecules or other drugs) that bind to NOVX proteins or have a stimulatory or inhibitory effect on, e.g., NOVX protein expression or NOVX protein activity.
  • the invention also includes compounds identified in the screening assays described herein.
  • the invention provides assays for screening candidate or test compounds which bind to or modulate me activity of the membrane-bound form of a NOVX protein or polypeptide or biologically-active portion thereof.
  • test compounds of the invention can be obtained using any of me numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection.
  • biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. See, e.g., Lam, 1997 ' . Anticancer Drug Design 12: 145.
  • a "small molecule” as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD.
  • Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules.
  • Libraries of chemical and/or biological mixtures, such as fongal, bacterial, or algal extracts, are known in me art and can be screened with any of the assays of the invention.
  • an assay is a cell-based assay in which a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion mereof, on the cell surface is contacted with a test compound and the ability of me test compound to bind to a NOVX protein determined.
  • the cell for example, can of mammalian origin or a yeast cell. Determining the ability of me test compound to bind to the NOVX protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the NOVX protein or biologically-active portion mereof can be determined by detecting the labeled compound in a complex.
  • test compounds can be labeled with 125 1, 35 S, 14 C, or 3 H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting.
  • test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
  • the assay comprises contacting a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface with a known compound which binds NOVX to form an assay mixmre, contacting the assay mixmre with a test compound, and determining the ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX protein or a biologically-active portion mereof as compared to the known compound.
  • an assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of NOVX protein, or a biologically-active portion mereof, on the cell surface with a test compound and determining me ability of the test compound to modulate (e.g. , stimulate or inhibit) the activity of the NOVX protein or biologically-active portion mereof. Determining me ability of the test compound to modulate the activity of NOVX or a biologically-active portion thereof can be accomplished, for example, by determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule.
  • a "target molecule” is a molecule wim which a NOVX protein binds or interacts in nature, for example, a molecule on the surface of a cell which expresses a NOVX interacting protein, a molecule on the surface of a second cell, a molecule in the extracellular milieu, a molecule associated with the internal surface of a cell membrane or a cytoplasmic molecule.
  • a NOVX target molecule can be a non-NOVX molecule or a NOVX protein or polypeptide of the invention.
  • a NOVX target molecule is a component of a signal transduction pathway that facilitates transduction of an extracellular signal (e.g.
  • the target for example, can be a second intercellular protein that has catalytic activity or a protein that facilitates me association of downstream signaling molecules with NOVX.
  • Determining me ability of the NOVX protein to bind to or interact with a NOVX target molecule can be accomplished by one of the methods described above for determining direct binding. In one embodiment, determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule can be accomplished by determining the activity of the target molecule. For example, the activity of the target molecule can be determined by detecting induction of a cellular second messenger of the target (i.e.
  • a reporter gene comprising a NOVX-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase
  • a cellular response for example, cell survival, cellular differentiation, or cell proliferation.
  • an assay of the invention is a cell-free assay comprising contacting a NOVX protein or biologically-active portion thereof with a test compound and determining e ability of the test compound to bind to the NOVX protein or biologically-active portion thereof. Binding of the test compound to the NOVX protein can be determined either directly or indirectly as described above.
  • the assay comprises contacting the NOVX protein or biologically-active portion thereof with a known compoimd which binds NOVX to form an assay mixmre, contacting the assay mixmre wim a test compound, and determining me ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX or biologically-active portion thereof as compared to the known compound.
  • an assay is a cell-free assay comprising contacting
  • NOVX protem or biologically-active portion thereof with a test compound and determining the ability of the test compound to modulate (e.g. stimulate or inhibit) me activity of the NOVX protein or biologically-active portion thereof.
  • Determimng the ability of me test compound to modulate me activity of NOVX can be accomplished, for example, by determining me ability of the NOVX protein to bind to a NOVX target molecule by one of the methods described above for determining direct binding.
  • determining the ability of the test compound to modulate the activity of NOVX protein can be accomplished by determining e ability of the NOVX protein forther modulate a NOVX target molecule.
  • the catalytic/enzymatic activity of the target molecule on an appropriate substrate can be determined as described, supra.
  • the cell-free assay comprises contacting the NOVX protein or biologically-active portion thereof wim a known compound which binds NOVX protein to form an assay mixture, contacting the assay mixmre with a test compound, and determining e ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining me ability of the NOVX protein to preferentially bind to or modulate the activity of a NOVX target molecule.
  • the cell-free assays of the invention are amenable to use of both the soluble form or the membrane-bound form of NOVX protein.
  • solubilizing agent such that the membrane-bound form of NOVX protein is maintained in solution.
  • solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton ® X-100, Triton ® X-l 14, Thesit ® , Isotridecypoly(ethylene glycol ether) n , N-dodecyl ⁇ N,N-dimethyl-3-ammonio-l -propane sulfonate, 3-(3-cholamidopropyl) dimethylamminiol-1 -propane sulfonate (CHAPS), or 3-
  • binding of a test compound to NOVX protein, or interaction of NOVX protein with a target molecule in the presence and absence of a candidate compound can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels mclude microtiter plates, test tubes, and micro-centrifoge tubes.
  • a fusion protein can be provided that adds a domain that allows one or both of e proteins to be bound to a matrix.
  • GST-NO VX fosion proteins or GST-target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtiter plates, that are then combined with the test compound or the test compound and either me non-adsorbed target protein or NOVX protein, and the mix re is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, me matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described, supra.
  • glutathione sepharose beads Sigma Chemical, St. Louis, MO
  • glutathione derivatized microtiter plates that are then combined with the test compound or the test compound and either me non-adsorbed target protein or NOVX protein, and the mix re is incubated under conditions conducive to complex formation (e.g., at physiological
  • the complexes can be dissociated from the matrix, and the level of NOVX protein binding or activity determined using standard techniques.
  • Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention.
  • either the NOVX protein or its target molecule can be immobilized utilizing conjugation of biotin and streptavidin.
  • Biotinylated NOVX protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well-known within the art (e.g. , biotinylation kit, Pierce Chemicals, Rockford, III), and immobilized in the wells of stieptavidin-coated 96 well plates (Pierce Chemical).
  • antibodies reactive with NOVX protein or target molecules can be derivatized to the wells of the plate, and unbound target or NOVX protein trapped in the wells by antibody conjugation.
  • Methods for detecting such complexes include immunodetection of complexes using antibodies reactive with the NOVX protein or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated wim the NOVX protein or target molecule.
  • modulators of NOVX protein expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of NOVX mRNA or protein in me cell is determined. The level of expression of NOVX mRNA or protein in the presence of the candidate compound is compared to the level of expression of NOVX mRNA or protein in the absence of me candidate compound.
  • the candidate compound can men be identified as a modulator of NOVX mRNA or protein expression based upon this comparison. For example, when expression of NOVX mRNA or protein is greater (i.e., statistically significantly greater) in me presence of the candidate compound than in its absence, me candidate compound is identified as a stimulator of NOVX mRNA or protein expression.
  • the candidate compound when expression of NOVX mRNA or protein is less (statistically significantly less) in the presence of me candidate compound than in its absence, the candidate compound is identified as an inhibitor of NOVX mRNA or protein expression.
  • the level of NOVX mRNA or protein expression in the cells can be determined by methods described herein for detecting NOVX mRNA or protein.
  • the NOVX proteins can be used as "bait proteins" in a two-hybrid assay or three hybrid assay (see, e.g., U.S. PatentNo. 5,283,317; Zervos, et al, 1993. Ce// 72: 223-232; Madura, etal, 1993. J. Biol. Chem. 268: 12046-12054; Bartel, etal, 1993. Biotechniques 14: 920-924; Iwabuchi, et al, 1993.
  • NOVX-binding proteins proteins that bind to or interact with NOVX
  • NOVX-binding proteins proteins that bind to or interact with NOVX
  • NOVX-binding proteins are also involved in the propagation of signals by the NOVX proteins as, for example, upstream or downstream elements of the NOVX pathway.
  • the two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for NOVX is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4).
  • GAL-4 a known transcription factor
  • a DNA sequence from a library of DNA sequences, at encodes an unidentified protein ("prey" or “sample") is fused to a gene that codes for the activation domain of e known transcription factor. If the "bait” and the “prey” proteins are able to interact, in vivo, forming a NOVX-dependent complex, me DNA-binding and activation domains of e transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) mat is operably linked to a transcriptional regulatory site responsive to me transcription factor. Expression of the reporter gene can be detected and cell colonies containing thesolutional transcription factor can be isolated and used to obtain the cloned gene mat encodes the protein which interacts with NOVX.
  • a reporter gene e.g., LacZ
  • the invention forther pertains to novel agents identified by the aforementioned screening assays and uses thereof for treatments as described herein.
  • Detection Assays Portions or fragments of the cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. By way of example, and not of limitation, these sequences can be used to: (z) map their respective genes on a chromosome; and, thus, locate gene regions associated wim genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (Hi) aid in forensic identification of a biological sample. Some of these applications are described in the subsections, below.
  • this sequence can be used to map the location of the gene on a chromosome.
  • This process is called chromosome mapping.
  • portions or fragments of the NOVX sequences of SEQ ID NO:2n-l, wherein n is an mteger between 1 and 141, or fragments or derivatives thereof, can be used to map the location of the NOVX genes, respectively, on a chromosome.
  • the mapping of the NOVX sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.
  • NOVX genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp in length) from the NOVX sequences. Computer analysis of the NOVX, sequences can be used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the NOVX sequences will yield an amplified fragment. Somatic cell hybrids are prepared by fosing somatic cells from different mammals
  • human and mouse cells As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but in which human cells can, e one human chromosome that contains the gene encoding the needed enzyme will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a foil set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. See, e.g., D'Eustachio, et al, 1983. Science 220: 919-924. Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.
  • PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using me NOVX sequences to design oligonucleotide primers, sub-localization can be achieved with panels of fragments from specific chromosomes. Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can forther be used to provide a precise chromosomal location in one step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical like colcemid that disrupts the mitotic spindle.
  • FISH Fluorescence in situ hybridization
  • the chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually.
  • the FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases, will suffice to get good results at a reasonable amount of time. For a review of this technique, see, Nerma, et al., HUMAN CHROMOSOMES: A MANUAL OF BASIC TECHNIQUES (Pergamon Press, New York 1988).
  • Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions of the genes actually are preferred for mapping pmposes. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.
  • differences in e DNA sequences between individuals affected and unaffected with a disease associated wim the NOVX gene can be determined. If a mutation is observed in some or all of e affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent of the particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm me presence of a mutation and to distinguish mutations from polymo ⁇ hisms.
  • the NOVX sequences of e invention can also be used to identify individuals from minute biological samples.
  • an individual's genomic DNA is digested wim one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification.
  • the sequences of the invention are useful as additional DNA markers for RFLP ("restriction fragment length polymo ⁇ hisms," described in U.S. Patent No.
  • sequences of the invention can be used to provide an alternative technique that determines the actual base-by-base DNA sequence of selected portions of an individual's genome.
  • the NOVX sequences described herein can be used to prepare two PCR primers from the 5'- and 3'-termini of the sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.
  • Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences.
  • the sequences of the invention can be used to obtain such identification sequences from individuals and from tissue.
  • the NOVX sequences of the invention uniquely represent portions of me human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs wim a frequency of about once per each 500 bases. Much of me allelic variation is due to single nucleotide polymo ⁇ hisms (SNPs), which include restriction fragment length polymo ⁇ hisms (RFLPs).
  • SNPs single nucleotide polymo ⁇ hisms
  • RFLPs restriction fragment length polymo ⁇ hisms
  • each of the sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification pu ⁇ oses. Because greater numbers of polymo ⁇ hisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals.
  • the noncoding sequences can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers mat each yield a noncoding amplified sequence of 100 bases. If coding sequences, such as those of SEQ ID NO:2 «-l, wherein n is an integer between 1 and 141, are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
  • the invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, pharmacogenomics, and monitoring clinical trials are used for prognostic (predictive) pu ⁇ oses to thereby treat an individual prophylactically.
  • diagnostic assays for determining NOVX protein and/or nucleic acid expression as well as NOVX activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to mereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant NOVX expression or activity.
  • the disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.
  • the invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. For example, mutations in a NOVX gene can be assayed in a biological sample.
  • Such assays can be used for prognostic or predictive pinpose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with NOVX protein, nucleic acid expression, or biological activity.
  • Another aspect of me invention provides methods for determining NOVX protein, nucleic acid expression or activity in an individual to thereby select appropriate therapeutic or prophylactic agents for mat individual (referred to herein as "pharmacogenomics").
  • Pharmacogenomics allows for the selection of agents (e.g., drugs) for therapeutic or prophylactic treatment of an individual based on the genotype of the individual (e.g., the genotype of the individual exammed to determine the ability of the individual to respond to a particular agent.)
  • Yet another aspect of me invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX in clinical trials.
  • agents e.g., drugs, compounds
  • An exemplary method for detecting the presence or absence of NOVX in a biological sample involves obtaining a biological sample from a test subject and contacting me biological sample with a compound or an agent capable of detecting NOVX protein or nucleic acid (e.g., mRNA, genomic DNA) that encodes NOVX protein such that me presence of NOVX is detected in e biological sample.
  • a compound or an agent capable of detecting NOVX protein or nucleic acid e.g., mRNA, genomic DNA
  • An agent for detecting NOVX mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to NOVX mRNA or genomic DNA.
  • the nucleic acid probe can be, for example, a foll-length NOVX nucleic acid, such as the nucleic acid of SEQ ID NO:2n-l , wherein n is an integer between 1 and 141, or a portion mereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NOVX mRNA or genomic DNA.
  • n is an integer between 1 and 141
  • a portion mereof such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NOVX mRNA or genomic DNA.
  • An agent for detecting NOVX protein is an antibody capable of binding to NOVX protein, preferably an antibody with a detectable label.
  • Antibodies can be polyclonal, or more preferably, monoclonal.
  • an intact antibody, or a fragment thereof can be used.
  • labeled with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i. e. , physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled.
  • indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
  • biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method of the invention can be used to detect NOVX mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
  • in vitro techniques for detection of NOVX mRNA include Northern hybridizations and in situ hybridizations.
  • in vitro techniques for detection of NOVX protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence.
  • In vitro techniques for detection of NOVX genomic DNA include Southern hybridizations.
  • in vivo techniques for detection of NOVX protein include introducing into a subject a labeled anti-NOVX antibody.
  • me antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • the biological sample contains protein molecules from the test subject.
  • the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject.
  • a preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.
  • me methods forther involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting NOVX protein, mRNA, or genomic DNA, such mat me presence of NOVX protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of NOVX protein, mRNA or genomic DNA in the control sample with the presence of NOVX protein, mRNA or genomic DNA in the test sample.
  • kits for detecting the presence of NOVX in a biological sample can comprise: a labeled compound or agent capable of detecting NOVX protein or mRNA in a biological sample; means for determining the amount of NOVX in the sample; and means for comparing the amount of NOVX in the sample with a standard.
  • the compound or agent can be packaged in a suitable container.
  • the kit can forther comprise instructions for using the kit to detect NOVX protein or nucleic acid.
  • the diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity.
  • the assays described herein such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity.
  • the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder.
  • me invention provides a method for identifying a disease or disorder associated wim aberrant NOVX expression or activity in which a test sample is obtained from a subject and NOVX protein or nucleic acid (e.g.
  • test sample refers to a biological sample obtained from a subject of interest.
  • a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.
  • me prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated wim aberrant NOVX expression or activity.
  • agent e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
  • agents e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
  • e invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant NOVX expression or activity in which a test sample is obtained and NOVX protein or nucleic acid is detected (e.g., wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant NOVX expression or activity).
  • the methods of the invention can also be used to detect genetic lesions in a NOVX gene, thereby determining if a subject with the lesioned gene is at risk for a disorder characterized by aberrant cell proliferation and/or differentiation.
  • the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of an alteration affecting the integrity of a gene encoding a NOVX-protein, or the misexpression of the NOVX gene.
  • such genetic lesions can be detected by ascertaining me existence of at least one of: (i) a deletion of one or more nucleotides from a NOVX gene; (ii) an addition of one or more nucleotides to a NOVX gene; (Hi) a substimtion of one or more nucleotides of a NOVX gene, (iv) a chromosomal rearrangement of a NOVX gene; (v) an alteration in the level of a messenger RNA transcript of a NOVX gene, (vi) aberrant modification of a NOVX gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild-type splicing pattern of a messenger RNA transcript of a NOVX gene, (viii) a non-wild-type level of a NOVX protein, (ix) allelic loss of a NOVX gene, and (x) inappropriate post-translational modification of a NOVX protein.
  • a preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.
  • any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
  • detection of the lesion involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g, U.S. Patent Nos.4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran, et ⁇ , 1988. Science 241: 1077-1080; andNakazawa, et ⁇ l, 1994. Proc. N ⁇ tl. Ac ⁇ d. Sci.
  • PCR polymerase chain reaction
  • LCR ligation chain reaction
  • This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, contacting the nucleic acid sample with one or more primers that specifically hybridize to a NOVX gene under conditions such mat hybridization and amplification of me NOVX gene (if present) occurs, and detecting me presence or absence of an amplification product, or detecting e size of the amplification product and comparing me length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein.
  • nucleic acid e.g., genomic, mRNA or both
  • Alternative amplification methods include: self sustained sequence replication (see, Guatelli, et ⁇ l, 1990. Proc. N ⁇ tl. Ac ⁇ d. Sci. USA 87: 1874-1878), transcriptional amplification system (see, Kwoh, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 1173-1177); Q ⁇ Replicase (.see, Lizardi, et al, 1988. BioTechnology 6: 1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
  • mutations in a NOVX gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns.
  • sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA.
  • sequence specific ribozymes see, e.g., U.S. Patent No. 5,493,531 can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
  • genetic mutations in NOVX can be identified by hybridizing a sample and control nucleic acids, e.g. , DNA or RNA, to high-density arrays containing hundreds or thousands of oligonucleotides probes. See, e.g., Cronin, et al, 1996. Human Mutation 7: 244-255; Kozal, et al, 1996. Nat. Med. 2: 753-759.
  • genetic mutations in NOVX can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, et al, supra.
  • a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected.
  • Each mutation array is composed of parallel probe sets, one complementary to me wild-type gene and the other complementary to the mutant gene.
  • any of a variety of sequencing reactions known in the art can be used to directly sequence the NOVX gene and detect mutations by comparing me sequence of the sample NOVX with the corresponding wild-type (control) sequence.
  • Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert, 1977. Proc. Natl. Acad. Sci. USA 74: 560 or Sanger, 1977. Proc. Natl. Acad. Sci. USA 74: 5463. It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays (see, e.g., Naeve, et al, 1995.
  • Biotechniques 19: 448 including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101; Cohen, et al, 1996. Adv. Chromatography 36: 127-162; and Griffin, et al, 1993. Appl Biochem. Biotechnol 38: 147-159).
  • RNA DNA heteroduplexes See, e.g., Myers, et al, 1985. Science 230: 1242.
  • the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing me wild-type NOVX sequence with potentially mutant RNA or DNA obtained from a tissue sample.
  • the double-stranded duplexes are tieated with an agent that cleaves single-stranded regions of the duplex such as which will exist due to basepair mismatches between the contiol and sample strands.
  • RNA/DNA duplexes can be treated wim RNase and DNA/DNA hybrids treated with Si nuclease to enzymatically digesting the mismatched regions.
  • either DNA DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetioxide and with piperidine in order to digest mismatched regions. After digestion of me mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine me site of mutation. See, e.g., Cotton, etal, 1988. Proc. Natl. Acad. Sci. USA 85: 4397; Saleeba, et al, 1992. Methods Enzymol 217: 286-295.
  • me control DNA or RNA can be labeled for detection.
  • the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in NOVX cDNAs obtained from samples of cells.
  • DNA mismatch repair enzymes proteins that recognize mismatched base pairs in double-stranded DNA
  • me mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches. See, e.g., Hsu, etal, 1994. Carcinogenesis 15: 1657-1662.
  • a probe based on a NOVX sequence e.g., a wild-type NOVX sequence
  • a cDNA or other DNA product from a test cell(s).
  • the duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, e.g., U.S. Patent No. 5,459,039.
  • alterations in electrophoretic mobility will be used to identify mutations in NOVX genes.
  • single strand conformation polymo ⁇ hism may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids.
  • Single-stranded DNA fragments of sample and control NOVX nucleic acids will be denatured and allowed to renature.
  • the secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change.
  • the DNA fragments may be labeled or detected wim labeled probes.
  • RNA rather than DNA
  • the subject, method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on me basis of changes in electrophoretic mobility. See, e.g., Keen, etal, 1991. Trends Genet. 7: 5.
  • the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE).
  • DGGE denaturing gradient gel electrophoresis
  • DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting
  • GC-rich DNA by PCR.
  • a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA. See, e.g., Rosenbaum and Reissner, l987. Biophys. Chem. 265: 12753.
  • oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions that permit hybridization only if a perfect match is found. See, e.g., Saiki, et al, 1986. Nature 32A: 163; Saiki, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 6230.
  • Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when me oligonucleotides are attached to me hybridizing membrane and hybridized wim labeled target DNA.
  • Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of e molecule (so at amplification depends on differential hybridization; .see, e.g., Gibbs, et al, 1989. Nuc Acids Res. 17: 2437-2448) or at me extreme 3'-terminus of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (see, e.g., Prossner, 1993. Tibtech. 11 : 238).
  • amplification may also be performed using Taq ligase for amplification. See, e.g., Barany, 1991. Proc. Natl. Acad. Sci. USA 88: 189. In such cases, ligation will occur only if mere is a perfect match at the 3'-terminus of the 5' sequence, making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
  • the methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a NOVX gene.
  • any cell type or tissue preferably peripheral blood leukocytes, in which NOVX is expressed may be utilized in me prognostic assays described herein.
  • any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
  • Agents, or modulators that have a stimulatory or inhibitory effect on NOVX activity can be administered to individuals to treat (prophylactically or therapeutically) disorders.
  • the disorders include but are not limited to, e.g., those diseases, disorders and conditions listed above, and more particularly include those diseases, disorders, or conditions associated wim homologs of a NOVX protein, such as those summarized in Table A.
  • the pharmacogenomics i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drug
  • differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug.
  • me pharmacogenomics of the individual permits the selection of effective agents (e.g., drugs) for prophylactic or therapeutic treatments based on a consideration of me individual's genotype.
  • Such pharmacogenomics can forther be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of NOVX protein, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual.
  • Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, 1996. Clin. Exp. Pharmacol. Physiol, 23: 983-985; Linder, 1997. Clin. Chem., 43: 254-266.
  • two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare defects or as polymo ⁇ hisms.
  • G6PD glucose-6-phosphate dehydrogenase
  • me activity of drug metabolizing enzymes is a major determinant of bom the intensity and duration of drug action.
  • drug metabolizing enzymes e.g., N-acetyltiansferase 2 (NAT 2) and cytochrome pregnancy zone protein precursor enzymes CYP2D6 and CYP2C19
  • NAT 2 N-acetyltiansferase 2
  • CYP2D6 and CYP2C19 cytochrome pregnancy zone protein precursor enzymes
  • CYP2D6 and CYP2C19 cytochrome pregnancy zone protein precursor enzymes
  • These polymo ⁇ hisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations.
  • the gene coding for CYP2D6 is highly polymo ⁇ hic and several mutations have been identified in PM, which all lead to me absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drug response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for me analgesic effect of codeine mediated by its CYP2D6-formed metabolite mo ⁇ hine. At the other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, me molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.
  • the activity of NOVX protem, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual.
  • pharmacogenetic studies can be used to apply genotyping of polymo ⁇ hic alleles encoding drug-metabolizing enzymes to the identification of an individual's drug responsiveness phenotype. This knowledge, when applied to dosing or dmg selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with a NOVX modulator, such as a modulator identified by one of the exemplary screening assays described herein.
  • Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX can be applied not only in basic drug screening, but also in clinical trials.
  • agents e.g., drugs, compounds
  • the effectiveness of an agent determined by a screening assay as described herein to increase NOVX gene expression, protein levels, or upregulate NOVX activity can be monitored in clinical trails of subjects exhibiting decreased NOVX gene expression, protein levels, or downregulated NOVX activity.
  • the effectiveness of an agent determined by a screening assay to decrease NOVX gene expression, protein levels, or downregulate NOVX activity can be monitored in clinical trails of subjects exhibiting increased NOVX gene expression, protein levels, or upregulatedNOVX activity.
  • the expression or activity of NOVX and, preferably, omer genes that have been implicated in, for example, a cellular proliferation or immune disorder can be used as a "read out" or markers of me immune responsiveness of a particular cell.
  • genes, including NOVX, that are modulated in cells by treatment with an agent e.g., compound, drug or small molecule
  • an agent e.g., compound, drug or small molecule
  • NOVX activity e.g., identified in a screening assay as described herein
  • cells can be isolated and RNA prepared and analyzed for the levels of expression of NOVX and other genes implicated in me disorder.
  • the levels of gene expression can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one of the methods as described herein, or by measuring the levels of activity of NOVX or omer genes.
  • the gene expression pattern can serve as a marker, indicative of the physiological response of the cells to me agent. Accordingly, this response state may be determined before, and at various points during, treatment of the individual with the agent.
  • the invention provides a method for monitoring e effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, protein, peptide, peptidomimetic, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample from a subject prior to administiation of the agent; (ii) detecting the level of expression of a NOVX protein, mRNA, or genomic DNA in the preadministration sample; (Hi) obtaining one or more post-administration samples from the subject; (zv) detecting the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the pre-administration sample with the NOVX protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly.
  • an agent e
  • increased administration of the agent may be desirable to increase me expression or activity of NOVX to higher levels than detected, i.e., to increase the effectiveness of the agent.
  • decreased administration of me agent may be desirable to decrease expression or activity of NOVX to lower levels than detected, i.e., to decrease the effectiveness of the agent.
  • the invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant NOVX expression or activity.
  • the disorders include but are not limited to, e.g., those diseases, disorders and conditions listed above, and more particularly include those diseases, disorders, or conditions associated with homologs of a NOVX protein, such as those summarized in Table A.
  • Therapeutics that antagonize activity may be administered in a therapeutic or prophylactic manner.
  • Therapeutics mat may be utilized include, but are not limited to: (i) an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; (ii) antibodies to an aforementioned peptide; (Hi) nucleic acids encoding an aforementioned peptide; (iv) administration of antisense nucleic acid and nucleic acids that are "dysfunctional" (i.e., due to a heterologous insertion within the coding sequences of coding sequences to an aforementioned peptide) that are utilized to "knockout" endogenous function of an aforementioned peptide by homologous recombination (see, e.g., Capecchi, 1989.
  • modulators i.e., inhibitors, agonists and antagonists, including additional peptide mimetic of e invention or antibodies specific to a peptide of the invention
  • modulators i.e., inhibitors, agonists and antagonists, including additional peptide mimetic of e invention or antibodies specific to a peptide of the invention
  • Therapeutics mat are characterized by decreased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics mat increase (i.e., are agonists to) activity.
  • Therapeutics that upregulate activity may be admimstered in a therapeutic or prophylactic manner.
  • Therapeutics that may be utilized include, but are not limited to, an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; or an agonist mat increases bioavailability.
  • Increased or decreased levels can be readily detected by quantifying peptide and/or RNA, by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for RNA or peptide levels, structure and/or activity of the expressed peptides (or mRNAs of an aforementioned peptide).
  • tissue sample e.g., from biopsy tissue
  • assaying it in vitro for RNA or peptide levels, structure and/or activity of the expressed peptides (or mRNAs of an aforementioned peptide).
  • Methods that are well-known within the art include, but are not limited to, immunoassays (e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).
  • immunoassays e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.
  • hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).
  • the invention provides a method for preventing, in a subject, a disease or condition associated with an aberrant NOVX expression or activity, by administering to the subject an agent that modulates NOVX expression or at least one NOVX activity.
  • Subjects at risk for a disease that is caused or contributed to by aberrant NOVX expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein.
  • Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the NOVX aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression.
  • a NOVX agonist or NOVX antagonist agent can be used for treating e subject.
  • the appropriate agent can be determined based on screening assays described herein.
  • the modulatory method of the invention involves contacting a cell with an agent mat modulates one or more of the activities of NOVX protein activity associated with e cell.
  • An agent that modulates NOVX protein activity can be an agent as described herein, such as a nucleic acid or a protem, a naturally-occurring cognate ligand of a NOVX protein, a peptide, a NOVX peptidomimetic, or other small molecule.
  • the agent stimulates one or more NOVX protein activity. Examples of such stimulatory agents include active NOVX protein and a nucleic acid molecule encoding NOVX that has been introduced into me cell.
  • the agent inhibits one or more NOVX protein activity.
  • inhibitory agents include antisense NOVX nucleic acid molecules and anti-NOVX antibodies.
  • These modulatory methods can be performed in vitro (e.g., by culturing me cell with me agent) or, alternatively, in vivo (e.g., by administering the agent to a subject).
  • the invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of a NOVX protein or nucleic acid molecule.
  • e method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., up-regulates or down-regulates)
  • the method involves administering a NOVX protein or nucleic acid molecule as therapy to compensate for reduced or aberrant NOVX expression or activity.
  • Stimulation of NOVX activity is desirable in -stations in which NOVX is abnormally downregulated and/or in which mcreased NOVX activity is likely to have a beneficial effect.
  • a subject has a disorder characterized by aberrant cell proliferation and/or differentiation (e.g., cancer or immune associated disorders).
  • a gestational disease e.g., preclampsia.
  • suitable in vitro or in vivo assays are performed to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue.
  • in vitro assays may be performed with representative cells of me type(s) involved in the patient's disorder, to determine if a given Therapeutic exerts the desired effect upon the cell type(s).
  • Compounds for use in therapy may be tested in suitable animal model systems including, but not limited to rats, mice, chicken, cows, monkeys, rabbits, and me like, prior to testing in human subjects. Similarly, for in vivo testing, any of the animal model system known in the art may be used prior to administration to human subjects.
  • the NOVX nucleic acids and proteins of the invention are useful in potential prophylactic and therapeutic applications implicated in a variety of disorders.
  • the disorders include but are not limited to, e.g., those diseases, disorders and conditions listed above, and more particularly include those diseases, disorders, or conditions associated with homologs of a NOVX protein, such as those summarized in Table A.
  • a cDNA encoding the NOVX protein of the invention may be useful in gene merapy, and me protein may be useful when administered to a subject in need thereof.
  • the compositions of the invention will have efficacy for treatment of patients suffering from diseases, disorders, conditions and the like, including but not limited to those listed herein.
  • the novel nucleic acid encoding the NOVX protein, and the NOVX protein of the invention, or fragments mereof, may also be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed.
  • a forther use could be as an anti-bacterial molecule (i.e., some peptides have been found to possess anti-bacterial properties).
  • These materials are forther useful in me generation of antibodies, which immunospecifically-bind to the novel substances of the invention for use in therapeutic or diagnostic methods.
  • the invention will be forther described in me following examples, which do not limit the scope of me invention described in me claims.
  • Example A Polynucleotide and Polypeptide Sequences, and Homology Data
  • the NOVl clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 1A.
  • AAW70286 Human tissue factor pathway 5. .256 250/252 (99%) e-148 inhibitor-3 (TFPI-3) - Homo 1..252 251/252 (99%) sapiens, 252 aa. [ O9833920- A2, 06-AUG-1998]
  • NOVla protein was found to have homology to me proteins shown in the BLASTP data in Table IE.
  • the NOV2 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 2A.
  • N0V2a Residues/ Identities/
  • NOV2a protein was found to have homology to me proteins shown in the BLASTP data in Table 2E.
  • the NON3 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 3 A.
  • NOV3a Residues/ Identities/
  • N0V3b 1..161 161/185 (87%) 1..185 161/185 (87%)
  • me NOV3a protein yielded me following properties shown in Table 3C.
  • NOV3a protein was found to have homology to the proteins shown in me BLASTP data in Table 3E.
  • the NOV4 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 4A.
  • NOV4a Residues/ Identities/
  • PSort 0 .7000 probability located in plasma membrane 0 .3389 analysis : probability located in microbody (peroxisome) ; 0.2000 probability located in endoplasmic reticulum (membrane) ; 0 . 1000 probability located in mitochondrial inner membrane
  • NOV4a protein was found to have homology to the proteins shown in the BLASTP data in Table 4E.
  • the N0V5 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 5A.
  • PSort 0.4500 probability located in cytoplasm 0.3000 probability analysis : located in microbody (peroxisome) ; 0 . 1000 probability located in mitochondrial matrix space ; 0 . 1000 probability located im lysosome (lumen)
  • NOV5a protein was found to have homology to the proteins shown in the BLASTP data in Table 5D.
  • the NOV6 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 6A.
  • PSort 0 .8000 probability located in mitochondrial inner membrane ; analysis 0. 7000 probability located in plasma membrane ; 0.2000 probability located in endoplasmic reticulum (membrane) ; 0 .0646 probability located in microbody (peroxisome)
  • NOV6a protein was found to have homology to the proteins shown in the BLASTP data in Table 6D.
  • the NOV7 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 7A.
  • PSort 0 . 6500 probability located in plasma membrane 0 .4763 analysis : probability located in mitochondrial matrix space ; 0 .4500 probability located in cytoplasm; 0.2150 probability located in lysosome (lumen)
  • NOV7a protein was found to have homology to the proteins shown in the BLASTP data in Table 7E.
  • the NOV8 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 8A.
  • PSort 0 .6000 probability located in plasma membrane 0 .4000 analysis : probability located in Golgi body; 0.3000 probability located in endoplasmic reticulum (membrane) ; 0.2397 probability located in mitochondrial inner membrane
  • NOV8a protein was found to have homology to the proteins shown in me BLASTP data in Table 8D.
  • Protein NOV8a Identities/ n Protein/Organism/Length Expect
  • the NOV9 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 9A.
  • me NOV9a protein Further analysis of me NOV9a protein yielded the following properties shown in Table 9C.
  • NOV9a protein was found to have homology to the proteins shown in the BLASTP data in Table 9E.
  • the NOV10 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 10A.
  • PSort 0.8200 probability located in endoplasmic reticulum analysis (membrane); 0.1900 probability located in plasma membrane; 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
  • NOVlOa protein was found to have homology to the proteins shown in me BLASTP data in Table 10D.
  • the NOVl 1 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 11 A.
  • NOVl la protein was found to have homology to e proteins shown in the BLASTP data in Table 1 ID.
  • the NOVl 2 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 12A.
  • NOV12a TCAAAGGAAACTGACAAATTATCCCCAGCTGCCAGAAGAAGAAATCCTCACTGGACGG
  • NOV12a Residues/ Identities/
  • me NOV12a protem was found to have homology to the proteins shown in e BLASTP data in Table 12E.
  • Q9HBJ0 PLAC1 (Placenta- specific 1) - 1..212 21,1/212 (99%) e-126 Homo sapiens (Human), 212 aa . 1..212 211/212 (99%)
  • Q9JI83 EPCS26 (PLAC1) (Placental 1..171 104/171 (60%) le-60 specific protein 1) - Mus 1..171 134/171 (77%) musculus (Mouse) , 173 aa.
  • the NOVl 3 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 13 A.
  • NOV13a protein was found to have homology to the proteins shown in the BLASTP data in Table 13D.
  • the NOV14 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 14A.
  • N0V1 a ATGGATCTGGTGCTAAAAAGATGCCTTCTTCATTTGGCTGTGATAGGTGCTTTGCTGG
  • SEQ ID NO: 46 (575 aa MW at 60580.6kD
  • PSort 1 0 .4600 probability located in plasma membrane; 0 . 1000 analysis:
  • me NOV14a protein was found to have homology to the proteins shown in the BLASTP data in Table 14D.
  • the NOVl 5 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 15 A.
  • NOVl 5a protein was found to have homology to e proteins shown in the BLASTP data in Table 15E.
  • the NOVl 6 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 16 A.
  • NOVl 6a protein was found to have homology to the proteins shown in me BLASTP data in Table 16E.
  • the NOVl 7 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 17 A.
  • the NOVl 8 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 18 A.
  • the NOVl 9 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 19A.
  • NOVl9a AGCGGGCCGGGCGGCGGCGGGGAGATGCGGCTGCTGGCACTGGCGGCGGCCGCGCTGC
  • NOVl9a MRLLALAAAALLARAPAPEVCAALNVTVSPGPWDYLEGENATLLCHVSQKRRKDSLL CG173357-01 AVRWFFAHSFDSQEALMVKMTKLRWQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLT Protein Sequence LQPSDQGHYVCRVQEISRHRNKWTAWSNGSSATEMRVISLKASEESSFEKTKETWAFF EDLYVYAVLVCCMGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGESCH

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Disclosed herein are nucleic acid sequences that encode novel polypeptides. Also disclosed are polypeptides encoded by these nucleic acid sequences, and antibodies that immunospecifically bind to the polypeptide, as well as derivatives, variants, mutants, or fragments of the novel polypeptide, polynucleotide, or antibody specific to the polypeptide. Vectors, host cells, antibodies and recombinant methods for producing the polypeptides and polynucleotides, as well as methods for using same are also included. The invention further discloses therapeutic, diagnostic and research methods for diagnosis, treatment, and prevention of disorders involving any one of these novel human nucleic acids and proteins..

Description

THERAPEUTIC POLYPEPTIDES, NUCLEIC ACIDS ENCODING SAME, AND METHODS OF USE
FIELD OF THE INVENTION
The present invention relates to novel polypeptides, and the nucleic acids encoding them, having properties related to stimulation of biochemical or physiological responses in a cell, a tissue, an organ or an organism. More particularly, the novel polypeptides are gene products of novel genes, or are specified biologically active fragments or derivatives thereof. Methods of use encompass diagnostic and prognostic assay procedures as well as methods of treating diverse pathological conditions.
BACKGROUND OF THE INVENTION
Eu aryotic cells are characterized by biochemical and physiological processes which under normal conditions are exquisitely balanced to achieve the preservation and propagation of the cells. When such cells are components of multicellular organisms such as vertebrates, or more particularly organisms such as mammals, the regulation of the biochemical and physiological processes involves intricate signaling pathways. Frequently, such signaling pathways involve extracellular signaling proteins, cellular receptors that bind the signaling proteins, and signal transducing components located within the cells. Signaling proteins may be classified as endocrine effectors, paracrine effectors or autocrine effectors. Endocrine effectors are signaling molecules secreted by a given organ into the circulatory system, which are then transported to a distant target organ or tissue. The target cells include the receptors for the endocrine effector, and when the endocrine effector binds, a signaling cascade is induced. Paracrine effectors involve secreting cells and receptor cells in close proximity to each other, for example two different classes of cells in the same tissue or organ. One class of cells secretes the paracrine effector, which then reaches the second class of cells, for example by diffusion through the extracellular fluid. The second class of cells contains the receptors for the paracrine effector; binding of the effector results in induction of the signaling cascade that elicits the corresponding biochemical or physiological effect. Autocrine effectors are highly analogous to paracrine effectors, except that the same cell type that secretes the autocrine effector also contains the receptor. Thus the autocrine effector binds to receptors on the same cell, or on identical neighboring cells. The binding process then elicits the characteristic biochemical or physiological effect.
Signaling processes may elicit a variety of effects on cells and tissues including by way of nonhmiting example induction of cell or tissue proliferation, suppression of growth or proliferation, induction of differentiation or maturation of a cell or tissue, and suppression of differentiation or maturation of a cell or tissue.
Many pathological conditions involve dysregulation of expression of important effector proteins. In certain classes of pathologies the dysregulation is manifested as diminished or suppressed level of synthesis and secretion of protein effectors. In other classes of pathologies the dysregulation is manifested as increased or up-regulated level of synthesis and secretion of protein effectors. In a clinical setting a subject may be suspected of suffering from a condition brought on by altered or mis-regulated levels of a protein effector of interest. Therefore there is a need to assay for the level of the protein effector of interest in a biological sample from such a subject, and to compare the level with that characteristic of a nonpathological condition. There also is a need to provide the protein effector as a product of manufacture. Administration of the effector to a subject in need thereof is useful in treatment of the pathological condition. Accordingly, there is a need for a method of treatment of a pathological condition brought on by a diminished or suppressed levels of the protein effector of interest. In addition, there is a need for a method of treatment of a pathological condition brought on by a increased or up-regulated levels of the protein effector of interest. Antibodies are multichain proteins that bind specifically to a given antigen, and bind poorly, or not at all, to substances deemed not to be cognate antigens. Antibodies are comprised of two short chains termed light chains and two long chains termed heavy chains. These chains are constituted of immunoglobulin domains, of which generally there are two classes: one variable domain per chain, one constant domain in light chains, and three or more constant domains in heavy chains. The antigen-specific portion of the immunoglobulin molecules resides in the variable domains; the variable domains of one light chain and one heavy chain associate with each other to generate the antigen-biniding moiety. Antibodies that bind immunospecifically to a cognate or target antigen bind with high affinities. Accordingly, they are useful in assaying specifically for the presence of the antigen in a sample. In addition, they have the potential of inactivating the activity of the antigen.
Therefore there is a need to assay for the level of a protein effector of interest in a biological sample from such a subject, and to compare this level with that characteristic of a nonpathological condition. In particular, there is a need for such an assay based on the use of an antibody that binds immunospecifically to the antigen. There further is a need to inhibit the activity of the protein effector in cases where a pathological condition arises from elevated or excessive levels of the effector based on the use of an antibody that binds immunospecifically to the effector. Thus, there is a need for the antibody as a product of manufacture. There further is a need for a method of treatment of a pathological condition brought on by an elevated or excessive level of the protein effector of interest based on administering the antibody to the subject. SUMMARY OF THE INVENTION
The invention is based in part upon the discovery of isolated polypeptides including amino acid sequences selected from mature forms of the amino acid sequences selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141. The novel nucleic acids and polypeptides are referred to herein as NOVX, or NONl, ΝOV2, NON3, etc., nucleic acids and polypeptides. These nucleic acids and polypeptides, as well as derivatives, homologs, analogs and fragments thereof, will hereinafter be collectively designated as "ΝOVX" nucleic acid or polypeptide sequences.
The invention also is based in part upon variants of a mature form of the amino acid sequence selected from the group consisting of SEQ ID ΝO:2n, wherein n is an integer between 1 and 141, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed. In another embodiment, the invention includes the amino acid sequences selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141. In another embodiment, the invention also comprises variants of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed. The invention also involves fragments of any of the mature forms of the amino acid sequences selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, or any other amino acid sequence selected from this group. The invention also comprises fragments from these groups in which up to 15% of the residues are changed.
In another embodiment, the invention encompasses polypeptides that are naturally occurring allelic variants of the sequence selected from the group consisting of SEQ ID
NO:2n, wherein n is an integer between 1 and 141. These allelic variants include amino acid sequences that are the translations of nucleic acid sequences differing by a single nucleotide from nucleic acid sequences selected from the group consisting of SEQ ID NOS: 2n-l, wherein n is an integer between 1 and 141. The variant polypeptide where any amino acid changed in the chosen sequence is changed to provide a conservative substitution.
In another embodiment, the invention comprises a pharmaceutical composition involving a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 and a pharmaceutically acceptable carrier. In another embodiment, the invention involves a kit, including, in one or more containers, this pharmaceutical composition.
In another embodiment, the invention includes the use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease being selected from a pathology associated with a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein said therapeutic is the polypeptide selected from this group.
In another embodiment, the invention comprises a method for determining the presence or amount of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherem n is an integer between 1 and 141 in a sample, the method involving providing the sample; introducing the sample to an antibody that binds immunospecifically to the polypeptide; and determining the presence or amount of antibody bound to the polypeptide, thereby determining the presence or amount of polypeptide in the sample. In another embodiment, the invention includes a method for determining the presence of or predisposition to a disease associated with altered levels of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 in a first mammalian subject, the method involving measuring the level of expression of the polypeptide in a sample from the first mammalian subject; and comparing the amount of the polypeptide in this sample to the amount of the polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, the disease, wherein an alteration in the expression level of the polypeptide in the first subject as compared to the control sample indicates the presence of or predisposition to the disease. In another embodiment, the invention involves a method of identifying an agent that binds to a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 , the method including introducing the polypeptide to the agent; and determining whether the agent binds to the polypeptide. The agent could be a cellular receptor or a downstream effector. In another embodiment, the invention involves a method for identifying a potential therapeutic agent for use in treatment of a pathology, wherein the pathology is related to aberrant expression or aberrant physiological interactions of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, the method including providing a cell expressing the polypeptide of the invention and having a property or function ascribable to the polypeptide; contacting the cell with a composition comprising a candidate substance; and determining whether the substance alters the property or function ascribable to the polypeptide; whereby, if an alteration observed in the presence of the substance is not observed when the cell is contacted with a composition devoid of the substance, the substance is identified as a potential therapeutic agent.
In another embodiment, the invention involves a method for screening for a modulator of activity or of latency or predisposition to a pathology associated with a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, the method including administering a test compound to a test animal at increased risk for a pathology associated with the polypeptide of the invention, wherein the test animal recombinantly expresses the polypeptide of the invention; measuring the activity of the polypeptide in the test animal after administering the test compound; and comparing the activity of the protein in the test animal with the activity of the polypeptide in a control animal not administered the polypeptide, wherein a change in the activity of the polypeptide in the test animal relative to the control animal indicates the test compound is a modulator of latency of, or predisposition to, a pathology associated with the polypeptide of the invention. The recombinant test animal could express a test protein transgene or express the transgene under the control of a promoter at an increased level relative to a wild-type test animal The promoter may or may not b the native gene promoter of the transgene.
In another embodiment, the invention involves a method for modulating the activity of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141, the method including introducing a cell sample expressing the polypeptide with a compound that binds to the polypeptide in an amount sufficient to modulate the activity of the polypeptide.
In another embodiment, the invention involves a method of treating or preventing a pathology associated with a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 , the method including administering the polypeptide to a subject in which such treatment or prevention is desired in an amount sufficient to treat or prevent the pathology in the subject. The subject could be human. In another embodiment, the invention involves a method of treating a pathological state in a mammal, the method including administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 or a biologically active fragment thereof.
In another embodiment, the invention involves an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide having an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141; a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 ; a variant of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherem n is an integer between 1 and 141, in which any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; a nucleic acid fragment encoding at least a portion of a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 or any variant of the polypeptide wherein any amino acid of the chosen sequence is changed to a different amino acid, provided that no more than 10% of the amino acid residues in the sequence are so changed; and the complement of any of the nucleic acid molecules. In another embodiment, the invention comprises an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule comprises the nucleotide sequence of a naturally occurring allelic nucleic acid variant. In another embodiment, the invention involves an isolated nucleic acid molecule including a nucleic acid sequence encoding a polypeptide having an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141 that encodes a variant polypeptide, wherein the variant polypeptide has the polypeptide sequence of a naturally occurring polypeptide variant.
In another embodiment, the invention comprises an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule differs by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NOS: 2n-l, wherein n is an integer between 1 and 141.
In another embodiment, the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein ri is an integer between 1 and 141, wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141; a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141; and a nucleic acid fragment wherem one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed. In another embodiment, the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule hybridizes under stringent conditions to the nucleotide sequence selected from the group consisting of SEQ ID NO:2n-l , wherein n is an integer between 1 and 141, or a complement of the nucleotide sequence.
In another embodiment, the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141, wherein the nucleic acid molecule has a nucleotide sequence in which any nucleotide specified in the coding sequence of the chosen nucleotide sequence is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides in the chosen coding sequence are so changed, an isolated second polynucleotide that is a complement of the first polynucleotide, or a fragment of any of them.
In another embodiment, the invention includes a vector involving the nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141. This vector can have a promoter operably linked to the nucleic acid molecule. This vector can be located within a cell.
In another embodiment, the invention involves a method for determining the presence or amount of a nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141 in a sample, the method including providing the sample; introducing the sample to a probe that binds to the nucleic acid molecule; and determining the presence or amount of the probe bound to the nucleic acid molecule, thereby determining the presence or amount of the nucleic acid molecule in the sample. The presence or amount of the nucleic acid molecule is used as a marker for cell or tissue type. The cell type can be cancerous.
In another embodiment, the invention involves a method for determining the presence of or predisposition for a disease associated with altered levels of a nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO:2n, wherein n is an integer between 1 and 141 in a first mammalian subject, the method including measuring the amount of the nucleic acid in a sample from the first mammalian subject; and comparing the amount of the nucleic acid in the sample of step (a) to the amount of the nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease; wherein an alteration in the level of the nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease. The invention further provides an antibody that binds immunospecifically to a NONX polypeptide. The ΝONX antibody may be monoclonal, humanized, or a fully human antibody. Preferably, the antibody has a dissociation constant for the binding of the ΝOVX polypeptide to the antibody less than 1 x 10"9 M. More preferably, the ΝONX antibody neutralizes the activity of the ΝOVX polypeptide.
In a further aspect, the invention provides for the use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, associated with a ΝOVX polypeptide. Preferably the therapeutic is a ΝOVX antibody.
In yet a further aspect, the invention provides a method of treating or preventing a ΝOVX-associated disorder, a method of treating a pathological state in a mammal, and a method of treating or preventing a pathology associated with a polypeptide by administering a ΝOVX antibody to a subject in an amount sufficient to treat or prevent the disorder.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and are not intended to be limiting.
Other features and advantages of the invention will be apparent from the following detailed description and claims.
DETAILED DESCRIPTION OF THE INVENTION
The present invention provides novel nucleotides and polypeptides encoded thereby. Included in the invention are the novel nucleic acid sequences, their encoded polypeptides, antibodies, and other related compounds. The sequences are collectively referred to herein as "NOVX nucleic acids" or "NOVX polynucleotides" and the corresponding encoded polypeptides are referred to as "NOVX polypeptides" or "NOVX proteins." Unless indicated otherwise, "NOVX" is meant to refer to any of the novel sequences disclosed herein. Table A provides a summary of the NOVX nucleic acids and their encoded polypeptides. TABLE A. Sequences and Corresponding SEQ ID Numbers
Table A indicates the homology of NOVX polypeptides to known protein families. Thus, the nucleic acids and polypeptides, antibodies and related compounds according to the invention corresponding to a NOVX as identified in column 1 of Table A will be useful in therapeutic and diagnostic applications implicated in, for example, pathologies and disorders associated with the known protein families identified in column 5 of Table A.
Pathologies, diseases, disorders and condition and the like that are associated with NOVX sequences include, but are not limited to: ]e,^5 cardϊomyopathy, atherosclerosis^. hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventriculaj: (AN) canal defeet duetus arterio is, puhnonajy stenosis, subaortic sfe»osjs» ventricular septaϊ defect (VSD), valve diseases, toberøus sclerosis; obesity, ψetabolic disturbances associated with obesity, trapsplan t m,, adten leukody$toρhy? congenital adrenal hyperplasia, prostate cancer, diabetes, metabolic disorders, neoplasm;' adenocarcitioma, Jy phoma, uterus cancer, fertility, Jhemøphiiia, hypέ«Joagulatlθn| idiopathic thromboeytopenic purpura, immunodeficiencies, graft versus host disease, ADDS, bronchial asthma, Crohn's disease; multiple sclerosis, treatment -of Albright Hereditary Ostoeodystrophy, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders^ Alzheimer's Disease, Parkinson's Disorder^ immune disorders, hematopoietic disorders, and the various dy slipidemias,] the metabolic syndrome X and, wasting disorders associated with chronic diseases and various cancers, as well as conditions such as transplantation, neuroprotection, fertility3 ortegeneratio-α (in vitw and in vivo).}
NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts. The various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.
Consistent with other known members of the family of proteins, identified in column 5 of Table A, the NOVX polypeptides of the present invention show homology to, and contain domains that are characteristic of, other members of such protein families. Details of the sequence relatedness and domain analysis for each NOVX are presented in Example A.
The NOVX nucleic acids and polypeptides can also be used to screen for molecules, which inhibit or enhance NOVX activity or function. Specifically, the nucleic acids and polypeptides according to the invention may be used as targets for the identification of small molecules that modulate or inhibit diseases associated with the protein families listed in Table A.
The NOVX nucleic acids and polypeptides are also useful for detecting specific cell types. Details of the expression analysis for each NOVX are presented in Example C. Accordingly, the NOVX nucleic acids, polypeptides, antibodies and related compounds according to the invention will have diagnostic and therapeutic applications in the detection of a variety of diseases with differential expression in normal vs. diseased tissues, e.g. detection of a variety of cancers.
Additional utilities for NOVX nucleic acids and polypeptides according to the invention are disclosed herein.
NOVX clones
NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts. The various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong. The NOVX genes and their corresponding encoded proteins are useful for preventing, treating or ameliorating medical conditions, e.g., by protein or gene therapy. Pathological conditions can be diagnosed by determining the amount of the new protein in a sample or by determining the presence of mutations in the new genes. Specific uses are described for each of the NOVX genes, based on the tissues in which they are most highly expressed. Uses include developing products for the diagnosis or treatment of a variety of diseases and disorders.
The NOVX nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) a biological defense weapon.
In one specific embodiment, the invention includes an isolated polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherem n is an integer between 1 and 141; (b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherem n is an integer between 1 and 141, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; (c) an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141; (d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; and (e) a fragment of any of (a) through (d). In another specific embodiment, the invention includes an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a mature form of the ammo acid sequence given SEQ ID NO: 2n, wherein n is an mteger between 1 and 141; (b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; (c) the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141; (d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherem n is an integer between 1 and 141, in which any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; (e) a nucleic acid fragment encoding at least a portion of a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 141 or any variant of said polypeptide wherein any amino acid of the chosen sequence is changed to a different amino acid, provided that no more than 10% of the amino acid residues in the sequence are so changed; and (f) the complement of any of said nucleic acid molecules. In yet another specific embodiment, the invention includes an isolated nucleic acid molecule, wherein said nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of: (a) the nucleotide sequence selected from the group consisting of SEQ ED NO: 2n-l, wherein n is an integer between 1 and 141; (b) a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 141 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; (c) a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO: 2n-l, wherem n is an mteger between 1 and 141; and (d) a nucleic acid fragment wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 141 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15%o of the nucleotides are so changed.
NOVX Nucleic Acids and Polypeptides One aspect of the invention pertains to isolated nucleic acid molecules that encode
NOVX polypeptides or biologically active portions thereof. Also included in the invention are nucleic acid fragments sufficient for use as hybridization probes to identify NOVX-encoding nucleic acids (e.g., NOVX mRNAs) and fragments for use as PCR primers for the amplification and/or mutation of NOVX nucleic acid molecules. As used herein, the term "nucleic acid molecule" is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., RNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof. The nucleic acid molecule may be single-stranded or double-stranded, but preferably is comprised double-stranded DNA.
A NOVX nucleic acid can encode a mature NOVX polypeptide. As used herein, a "mature" form of a polypeptide or protein disclosed in the present invention is the product of a naturally occurring polypeptide or precursor form or proprotein. The naturally occurring polypeptide, precursor or proprotein includes, by way of nonhmiting example, the full-length gene product encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an ORF described herein. The product "mature" form arises, by way of nonhmiting example, as a result of one or more naturally occurring processing steps that may take place within the cell (e.g., host cell) in which the gene product arises. Examples of such processing steps leading to a "mature" form of a polypeptide or protein include the cleavage of the N-terminal methionine residue encoded by the initiation codon of an ORF, or the proteolytic cleavage of a signal peptide or leader sequence. Thus a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine, would have residues 2 through N remaining after removal of the N-terminal methionine. Alternatively, a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+l to residue N remaining. Further as used herein, a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristylation or phosphorylation. In general, a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.
The term "probe", as utilized herein, refers to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), about 100 nt, or as many as approximately, e.g., 6,000 nt, depending upon the specific use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences. Longer length probes are generally obtained from a natural or recombinant source, are highly specific, and much slower to hybridize than shorter-length oligo er probes. Probes may be single- stranded or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.
The term "isolated" nucleic acid molecule, as used herein, is a nucleic acid that is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid. Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5'- and 3'-termini of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated NOVX nucleic acid molecules can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell/tissue from which the nucleic acid is derived (e.g., brain, heart, liver, spleen, etc.). Moreover, an "isolated" nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material, or culture medium, or of chemical precursors or other chemicals. A nucleic acid molecule of the invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NO:2ra-l, wherein n is an integer between 1 and 141, or a complement of this nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or a portion of the nucleic acid sequence of SEQ ID NO:2«-l, wherem n is an integer between 1 and 141, as a hybridization probe, NOVX molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, et al., (eds.), MOLECULAR CLONING: A LABORATORY MANUAL 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel, et al, (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993.) A nucleic acid of the invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template with appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to NOVX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
As used herein, the term "oligonucleotide" refers to a series of linked nucleotide residues. A short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue. Oligonucleotides comprise a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length. In one embodiment of the invention, an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at least 6 contiguous nucleotides of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, or a complement thereof. Oligonucleotides may be chemically synthesized and may also be used as probes.
In another embodiment, an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule that is a complement of the nucleotide sequence shown in SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, or a portion of this nucleotide sequence (e.g. , a fragment that can be used as a probe or primer or a fragment encoding a biologically-active portion of a NOVX polypeptide). A nucleic acid molecule that is complementary to the nucleotide sequence of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, is one that is sufficiently complementary to the nucleotide sequence of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, that it can hydrogen bond with few or no mismatches to the nucleotide sequence shown in SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, thereby forming a stable duplex.
As used herein, the term "complementary" refers to Watson-Crick or Hoogsteen base pairing between nucleotides units of a nucleic acid molecule, and the term "binding" means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like. A physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
A "fragment" provided herein is defined as a sequence of at least 6 (contiguous) nucleic acids or at least 4 (contiguous) amino acids, a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, and is at most some portion less than a full length sequence. Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice. A full-length NOVX clone is identified as containing an ATG translation start codon and an in-frame stop codon. Any disclosed NOVX nucleotide sequence lacking an ATG start codon therefore encodes a truncated C-terminal fragment of the respective NOVX polypeptide, and requires that the corresponding full-length cDNA extend in the 5' direction of the disclosed sequence. Any disclosed NOVX nucleotide sequence lacking an in-frame stop codon similarly encodes a truncated N-terminal fragment of the respective NOVX polypeptide, and requires that the corresponding full-length cDNA extend in the 3' direction of the disclosed sequence.
A "derivative" is a nucleic acid sequence or amino acid sequence formed from the native compounds either directly, by modification or partial substitution. An "analog" is a nucleic acid sequence or amino acid sequence that has a structure similar to, but not identical to, the native compound, e.g. they differs from it in respect to certain components or side chains. Analogs may be synthetic or derived from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type. A "homolog" is a nucleic acid sequence or amino acid sequence of a particular gene that is derived from different species. Derivatives and analogs may be full length or other than full length. Derivatives or analogs of the nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, or 95% identity (with a preferred identity of 80-95%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the proteins under stringent, moderately stringent, or low stringent conditions. See e.g. Ausubel, et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993, and below. A "homologous nucleic acid sequence" or "homologous amino acid sequence," or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above. Homologous nucleotide sequences include those sequences coding for isoforms of NOVX polypeptides. Isoforms can be expressed in different tissues of the same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes. In the invention, homologous nucleotide sequences include nucleotide sequences encoding for a NOVX polypeptide of species other than humans, including, but not limited to: vertebrates, and thus can include, e.g., frog, mouse, rat, rabbit, dog, cat cow, horse, and other organisms. Homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations of the nucleotide sequences set forth herein. A homologous nucleotide sequence does not, however, include the exact nucleotide sequence encoding human NOVX protein. Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) in SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, as well as a polypeptide possessing NOVX biological activity. Various biological activities of the NOVX proteins are described below.
A NOVX polypeptide is encoded by the open reading frame ("ORF") of a NOVX nucleic acid. An ORF corresponds to a nucleotide sequence that could potentially be translated into a polypeptide. A stretch of nucleic acids comprising an ORF is unmterrupted by a stop codon. An ORF that represents the coding sequence for a full protein begins with an ATG "start" codon and terminates with one of the three "stop" codons, namely, TAA, TAG, or TGA. For the purposes of this invention, an ORF may be any part of a coding sequence, with or without a start codon, a stop codon, or both. For an ORF to be considered as a good candidate for coding for a bonafide cellular protein, a minimum size requirement is often set, e.g., a stretch of DNA that would encode a protein of 50 amino acids or more.
The nucleotide sequences determined from the cloning of the human NOVX genes allows for the generation of probes and primers designed for use in identifying and/or cloning NOVX homologues in other cell types, e.g. from other tissues, as well as NOVX homologues from other vertebrates. The probe/primer typically comprises substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 consecutive sense strand nucleotide sequence of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141; or an anti-sense strand nucleotide sequence of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141; or of a naturally occurring mutant of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141.
Probes based on the human NOVX nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In various embodiments, the probe has a detectable label attached, e.g. the label can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissues which mis-express a NOVX protein, such as by measuring a level of a NOVX-encoding nucleic acid in a sample of cells from a subject e.g., detecting NOVX mRNA levels or determining whether a genomic NOVX gene has been mutated or deleted.
"A polypeptide having a biologically-active portion of a NOVX polypeptide" refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide of the invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. A nucleic acid fragment encoding a "biologically-active portion of NOVX" can be prepared by isolating a portion of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, that encodes a polypeptide having a NOVX biological activity (the biological activities of the NOVX proteins are described below), expressing the encoded portion of NOVX protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of NOVX.
NOVX Nucleic Acid and Polypeptide Variants
The invention further encompasses nucleic acid molecules that differ from the nucleotide sequences of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, due to degeneracy of the genetic code and thus encode the same NOVX proteins as that encoded by the nucleotide sequences of SEQ ED NO:2«-l, wherein n is an integer between 1 and 141. In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence of SEQ ID NO:2ra, wherein n is an integer between 1 and 141. In addition to the human NOVX nucleotide sequences of SEQ ID NO:2«-l , wherein n is an mteger between 1 and 141, it will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences of the NOVX polypeptides may exist within a population (e.g. , the human population). Such genetic polymorphism in the NOVX genes may exist among individuals within a population due to natural allelic variation. As used herein, the terms "gene" and "recombinant gene" refer to nucleic acid molecules comprising an open reading frame (ORF) encoding a NOVX protein, preferably a vertebrate NOVX protein. Such natural allelic variations can typically result in 1-5%) variance in the nucleotide sequence of the NOVX genes. Any and all such nucleotide variations.and resulting amino acid polymorphisms in the NOVX polypeptides, which are the result of natural allelic variation and that do not alter the functional activity of the NOVX polypeptides, are intended to be within the scope of the invention.
Moreover, nucleic acid molecules encoding NOVX proteins from other species, and thus that have a nucleotide sequence that differs from a human SEQ ID NO:2w-l, wherein n is an integer between 1 and 141, are intended to be within the scope of the invention. Nucleic acid molecules corresponding to natural allelic variants and homologues of the NOVX cDNAs of the invention can be isolated based on their homology to the human NOVX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
Accordingly, in another embodiment, an isolated nucleic acid molecule of the invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:2?z-l, wherein n is an integer between 1 and l41. In another embodiment, the nucleic acid is at least 10, 25, 50, 100, 250, 500, 750, 1000, 1500, or 2000 or more nucleotides in length. In yet another embodiment, an isolated nucleic acid molecule of the invention hybridizes to the coding region. As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least about 65% homologous to each other typically remain hybridized to each other.
Homologs (i.e., nucleic acids encoding NOVX proteins derived from species other than human) or other related sequences (e.g., paralogs) can be obtained by low, moderate or high stringency hybridization with all or a portion of the particular human sequence as a probe using methods well known in the art for nucleic acid hybridization and cloning. As used herein, the phrase "stringent hybridization conditions" refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5 °C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50%) of the probes are occupied at equilibrium. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30 °C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60 °C for longer probes, primers and oligonucleotides. Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.
Stringent conditions are known to those skilled in the art and can be found in Ausubel, et al., (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, N. Y. (1989), 6.3.1-6.3.6. Preferably, the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other. A non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02%) PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65°C, followed by one or more washes in 0.2X SSC, 0.01% BSA at 50°C. An isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to a sequence of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, corresponds to a naturally-occurring nucleic acid molecule. As used herein, a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g. , encodes a natural protein).
In a second embodiment, a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided. A non-limiting example of moderate stringency hybridization conditions are hybridization in 6X SSC, 5X Reinhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55 °C, followed by one or more washes in IX SSC, 0.1% SDS at 37 °C. Other conditions of moderate stringency that may be used are well-known within the art. See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Krieger, 1990; GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY.
In a third embodiment, a nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequences of SEQ ID NO:2n-l, wherem n is an integer between 1 and 141, or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided. A non-limiting example of low stringency hybridization conditions are hybridization in 35% formamide, 5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.02% PVP, 0.02%o Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10% (wt vol) dextran sulfate at 40°C, followed by one or more washes in 2X SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS at 50°C. Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations). See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY; Shilo and Weinberg, 1981. Proc NatlAcadSci USA 78: 6789-6792. Conservative Mutations
In addition to naturally-occurring allelic variants of NOVX sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of SEQ ID NO:2ra-l, wherein n is an integer between 1 and 141, thereby leading to changes in the amino acid sequences of the encoded NOVX protein, without altering the functional ability of that NOVX protein. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NO:2n, wherein n is an integer between 1 and 141. A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequences of the NOVX proteins without altering their biological activity, whereas an "essential" amino acid residue is required for such biological activity. For example, amino acid residues that are conserved among the NOVX proteins of the invention are predicted to be particularly non-amenable to alteration. Amino acids for which conservative substitutions can be made are well-known within the art.
Another aspect of the invention pertains to nucleic acid molecules encoding NOVX proteins that contain changes in amino acid residues that are not essential for activity. Such NOVX proteins differ in amino acid sequence from SEQ ID NO:2H-1, wherein n is an mteger between l and 141, yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherem the protein comprises an ammo acid sequence at least about 40% homologous to the amino acid sequences of SEQ ID NO:2n, wherein n is an integer between 1 and 141. Preferably, the protein encoded by the nucleic acid molecule is at least about 60% homologous to SEQ ID NO:2κ, wherein n is an integer between 1 and 141; more preferably at least about 70%> homologous to SEQ ID NO:2n, wherein n is an mteger between 1 and 141; still more preferably at least about 80% homologous to SEQ ID NO:2«, wherein n is an integer between 1 and 141; even more preferably at least about 90% homologous to SEQ ID NO:2n, wherein n is an integer between 1 and 141; and most preferably at least about 95% homologous to SEQ ID NO:2», wherein n is an integer between 1 and 141. An isolated nucleic acid molecule encoding a NOVX protein homologous to the protein of SEQ ID NO:2«, wherein n is an integer between 1 and 141, can be created by introducing one or more nucleotide substimtions, additions or deletions into the nucleotide sequence of SEQ ID NO:2ra-l, wherein n is an integer between 1 and 141, such that one or more amino acid substimtions, additions or deletions are introduced into the encoded protein. Mutations can be introduced any one of SEQ ED NO:2«-l, wherein n is an integer between 1 and 141, by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substimtions are made at one or more predicted, non-essential amino acid residues. A "conservative amino acid substimtion" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined within the art. These families include amino acids with basic side chains (e.g. , lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted non-essential amino acid residue in me NOVX protein is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of a NOVX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for NOVX biological activity to identify mutants that retain activity. Following mutagenesis of a nucleic acid of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141, the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined.
The relatedness of amino acid families may also be determined based on side chain interactions. Substituted amino acids may be fully conserved "strong" residues or fully conserved "weak" residues. The "strong" group of conserved amino acid residues may be any one of the following groups: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW, wherein the single letter amino acid codes are grouped by those amino acids that may be substituted for each other. Likewise, the "weak" group of conserved residues may be any one of the following: CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, NDEQHK, NEQHRK, HFY, wherein the letters within each group represent the single letter amino acid code.
In one embodiment, a mutant NOVX protein can be assayed for (i) the ability to form protein-protein interactions with other NOVX proteins, other cell-surface proteins, or biologically-active portions thereof, (ii) complex formation between a mutant NOVX protein and a NOVX ligand; or (iii) the ability of a mutant NOVX protein to bind to an intracellular target protein or biologically-active portion thereof; (e.g. avidin proteins).
In yet another embodiment, a mutant NOVX protein can be assayed for the ability to regulate a specific biological function (e.g., regulation of insulin release). Interfering RNA
In one aspect of the invention, NOVX gene expression can be attenuated by RNA interference. One approach well-known in the art is short interfering RNA (siRNA) mediated gene silencing where expression products of a NOVX gene are targeted by specific double stranded NOVX derived siRNA nucleotide sequences that are complementary to at least a 19- 25 nt long segment of the NOVX gene transcript, including the 5 ' untranslated (UT) region, the ORF, or the 3' UT region. See, e.g., PCT applications WO00/44895, W099/32619, WO01/75164, WO01/92513, WO 01/29058, WO01/89304, WO02/16620, and WO02/29858, each incorporated by reference herein in their entirety. Targeted genes can be a NOVX gene, or an upstream or downstream modulator of the NOVX gene. Nonhmiting examples of upstream or downstream modulators of a NOVX gene include, e.g., a transcription factor that binds the NOVX gene promoter, a kinase or phosphatase that interacts with a NOVX polypeptide, and polypeptides involved in a NOVX regulatory pathway.
According to the methods of the present invention, NOVX gene expression is silenced using short interfering RNA. A NOVX polynucleotide according to the invention includes a siRNA polynucleotide. Such a NOVX siRNA can be obtained using a NOVX polynucleotide sequence, for example, by processing the NOVX ribopolynucleotide sequence in a cell-free system, such as but not limited to a Drosophila extract, or by transcription of recombinant double stranded NOVX RNA or by chemical synthesis of nucleotide sequences homologous to a NOVX sequence. See, e.g., Tuschl, Zamore, Lehmann, Bartel and Sharp (1999), Genes & Dev. 13: 3191-3197, incorporated herein by reference in its entirety. When synthesized, a typical 0.2 micromolar-scale RNA synthesis provides about 1 milligram of siRNA, which is sufficient for 1000 transfection experiments using a 24-well tissue culture plate format. The most efficient silencing is generally observed with siRNA duplexes composed of a 21-nt sense strand and a 21-nt antisense strand, paired in a manner to have a 2-nt 3' overhang. The sequence of the 2-nt 3' overhang makes an additional small contribution to the specificity of siRNA target recognition. The contribution to specificity is localized to the impaired nucleotide adjacent to the first paired bases. In one embodiment, the nucleotides in the 3' overhang are ribonucleotides. In an alternative embodiment, the nucleotides in the 3' overhang are deoxyribonucleotides. Using 2'-deoxyribonucleotides in the 3' overhangs is as efficient as using ribonucleotides, but deoxyribonucleotides are often cheaper to synthesize and are most likely more nuclease resistant. A contemplated recombinant expression vector of the invention comprises a NOVX
DNA molecule cloned into an expression vector comprising operatively-linked regulatory sequences flanking the NOVX sequence in a manner that allows for expression (by transcription of the DNA molecule) of both strands. An RNA molecule that is antisense to NOVX mRNA is transcribed by a first promoter (e.g., a promoter sequence 3' of the cloned DNA) and an RNA molecule that is the sense strand for the NOVX mRNA is transcribed by a second promoter (e.g., a promoter sequence 5' of the cloned DNA). The sense and antisense strands may hybridize in vivo to generate siRNA constructs for silencing of the NOVX gene. Alternatively, two constructs can be utilized to create the sense and anti-sense strands of a siRNA construct. Finally, cloned DNA can encode a construct having secondary structure, wherein a single transcript has both the sense and complementary antisense sequences from the target gene or genes. In an example of this embodiment, a hairpin RNAi product is homologous to all or a portion of the target gene. In another example, a hairpin RNAi product is a siRNA. The regulatory sequences flanking the NOVX sequence may be identical or may be different, such that their expression may be modulated independently, or in a temporal or spatial manner.
In a specific embodiment, siRNAs are transcribed intracellularly by cloning the NOVX gene templates into a vector containing, e.g., a RNA pol III transcription unit from the smaller nuclear RNA (snRNA) U6 or the human RNase P RNA HI . One example of a vector system is the GeneSuppressor™ RNA Interference kit (commercially available from Imgenex). The U6 and HI promoters are members of the type III class of Pol in promoters. The +1 nucleotide of the U6-like promoters is always guanosine, whereas the +1 for HI promoters is adenosine. The termination signal for these promoters is defined by five consecutive thymidines. The transcript is typically cleaved after the second uridine. Cleavage at this position generates a 3' UU overhang in the expressed siRNA, which is similar to the 3' overhangs of synthetic siRNAs. Any sequence less than 400 nucleotides in length can be transcribed by these promoter, therefore they are ideally suited for the expression of around 21 -nucleotide siRNAs in, e.g., an approximately 50-nucleotide RNA stem-loop transcript. A siRNA vector appears to have an advantage over synthetic siRNAs where long term knock-down of expression is desired. Cells transfected with a siRNA expression vector would experience steady, long-term mRNA inhibition. In contrast, cells transfected with exogenous synthetic siRNAs typically recover from mRNA suppression within seven days or ten rounds of cell division. The long-term gene silencing ability of siRNA expression vectors may provide for applications in gene therapy.
In general, siRNAs are chopped from longer dsRNA by an ATP-dependent ribonuclease called DICER. DICER is a member of the RNase III family of double-stranded RNA-specific endonucleases. The siRNAs assemble with cellular proteins into an endonuclease complex. In vitro studies in Drosophila suggest that the siRNAs/protein complex (si NP) is then transferred to a second enzyme complex, called an RNA-induced silencing complex (RISC), which contains an endoribonuclease that is distinct from DICER. RISC uses the sequence encoded by the antisense siRNA strand to find and destroy mRNAs of complementary sequence. The siRNA thus acts as a guide, restricting the ribonuclease to cleave only mRNAs complementary to one of the two siRNA strands. A NOVX mRNA region to be targeted by siRNA is generally selected from a desired
NOVX sequence beginning 50 tolOO nt downstream of the start codon. Alternatively, 5' or 3' UTRs and regions nearby the start codon can be used but are generally avoided, as these may be richer in regulatory protein binding sites. UTR-binding proteins and/or translation initiation complexes may interfere with binding of the siRNP or RISC endonuclease complex. An initial BLAST homology search for the selected siRNA sequence is done against an available nucleotide sequence library to ensure that only one gene is targeted. Specificity of target recognition by siRNA duplexes indicate that a single point mutation located in the paired region of an siRNA duplex is sufficient to abolish target mRNA degradation. See, Elbashir etal. 2001 EMBO J. 20(23):6877-88. Hence, consideration should be taken to accommodate SNPs, polymorphisms, allelic variants or species-specific variations when targeting a desired gene.
In one embodiment, a complete NOVX siRNA experiment includes the proper negative control. A negative control siRNA generally has the same nucleotide composition as the NOVX siRNA but lack significant sequence homology to the genome. Typically, one would scramble the nucleotide sequence of the NOVX siRNA and do a homology search to make sure it lacks homology to any other gene.
Two independent NOVX siRNA duplexes can be used to knock-down a target NOVX gene. This helps to control for specificity of the silencing effect. In addition, expression of two independent genes can be simultaneously knocked down by using equal concentrations of different NOVX siRNA duplexes, e.g., a NOVX siRNA and an siRNA for a regulator of a NOVX gene or polypeptide. Availability of siRNA-associating proteins is believed to be more limiting than target mRNA accessibility. A targeted NOVX region is typically a sequence of two adenines (AA) and two thymidines (TT) divided by a spacer region of nineteen (N19) residues (e.g., AA(N19)TT). A desirable spacer region has a G/C-content of approximately 30%> to 70%, and more preferably of about 50%. If the sequence AA(N19)TT is not present in the target sequence, an alternative target region would be AA(N21). The sequence of the NOVX sense siRNA corresponds to (Nl 9)TT or N21 , respectively. In me latter case, conversion of the 3' end of the sense siRNA to TT can be performed if such a sequence does not naturally occur in the NOVX polynucleotide. The rationale for this sequence conversion is to generate a symmetric duplex with respect to the sequence composition of the sense and antisense 3' overhangs. Symmetric 3' overhangs may help to ensure that the siRNPs are formed with approximately equal ratios of sense and antisense target RNA-cleaving siRNPs. See, e.g., Elbashir,
Lendeckel and Tuschl (2001). Genes & Dev. 15: 188-200, incorporated by reference herein in its entirely. The modification of the overhang of the sense sequence of the siRNA duplex is not expected to affect targeted mRNA recognition, as the antisense siRNA strand guides target recognition. Alternatively, if me NOVX target mRNA does not contain a suitable AA(N21 ) sequence, one may search for the sequence NA(N21). Further, the sequence of the sense strand and antisense strand may still be synthesized as 5' (N19)TT, as it is believed that the sequence of the 3 '-most nucleotide of the antisense siRNA does not contribute to specificity. Unlike antisense or ribozyme technology, the secondary structure of the target mRNA does not appear to have a strong effect on silencing. See, Harborth, et al. (2001) J. Cell Science 114: 4557-4565, incorporated by reference in its entirety.
Transfection of NOVX siRNA duplexes can be achieved using standard nucleic acid transfection methods, for example, OLIGOFECTAMINE Reagent (commercially available from Invitrogen). An assay for NOVX gene silencing is generally performed approximately 2 days after transfection. No NOVX gene silencing has been observed in the absence of transfection reagent, allowing for a comparative analysis of the wild-type and silenced NOVX phenotypes. In a specific embodiment, for one well of a 24-well plate, approximately 0.84 μg of the siRNA duplex is generally sufficient. Cells are typically seeded the previous day, and are transfected at about 50%> confluence. The choice of cell culture media and conditions are routine to those of skill in the art, and will vary with the choice of cell type. The efficiency of transfection may depend on the cell type, but also on the passage number and the confluency of the cells. The time and the manner of formation of siRNA-liposome complexes (e.g. inversion versus vortexing) are also critical. Low transfection efficiencies are the most frequent cause of unsuccessful NOVX silencing. The efficiency of transfection needs to be carefully examined for each new cell line to be used. Preferred cell are derived from a mammal, more preferably from a rodent such as a rat or mouse, and most preferably from a human. Where used for therapeutic treatment, the cells are preferentially autologous, although non-autologous cell sources are also contemplated as within the scope of the present invention.
For a control experiment, transfection of 0.84 μg single-stranded sense NOVX siRNA will have no effect on NOVX silencing, and 0.84 μg antisense siRNA has a weak silencing effect when compared to 0.84 μg of duplex siRNAs. Control experiments again allow for a comparative analysis of the wild-type and silenced NOVX phenotypes. To control for transfection efficiency, targeting of common proteins is typically performed, for example targeting of lamin A/C or transfection of a CMV-driven EGFP-expression plasmid (e.g. commercially available from Clontech). In the above example, a determination of the fraction of lamin A/C knockdown in cells is determined the next day by such techniques as immunofluorescence, Western blot, Northern blot or other similar assays for protein expression or gene expression. Lamin A/C monoclonal antibodies may be obtained from Santa Cruz Biotechnology.
Depending on the abundance and the half life (or turnover) of the targeted NOVX polynucleotide in a cell, a knock-down phenotype may become apparent after 1 to 3 days, or even later. In cases where no NOVX knock-down phenotype is observed, depletion of the NOVX polynucleotide may be observed by immunofluorescence or Western blotting. If the NOVX polynucleotide is still abundant after 3 days, cells need to be split and transferred to a fresh 24-well plate for re-transfection. If no knock-down of the targeted protein is observed, it may be desirable to analyze whether the target mRNA (NOVX or a NOVX upstream or downstream gene) was effectively destroyed by the transfected siRNA duplex. Two days after transfection, total RNA is prepared, reverse transcribed using a target-specific primer, and PCR-amplified with a primer pair covering at least one exon-exon junction in order to control for amplification of pre-mRNAs. RT/PCR of a non-targeted mRNA is also needed as control. Effective depletion of the mRNA yet undetectable reduction of target protein may indicate that a large reservoir of stable NOVX protein may exist in the cell. Multiple transfection in sufficiently long intervals may be necessary until the target protein is finally depleted to a point where a phenotype may become apparent. If multiple transfection steps are required, cells are split 2 to 3 days after transfection. The cells may be transfected immediately after splitting.
An inventive therapeutic method of the invention contemplates administering a NOVX siRNA construct as therapy to compensate for increased or aberrant NOVX expression or activity. The NOVX ribopolynucleotide is obtained and processed into siRNA fragments, or a NOVX siRNA is synthesized, as described above. The NOVX siRNA is administered to cells or tissues using known nucleic acid transfection techniques, as described above. A NOVX siRNA specific for a NOVX gene will decrease or knockdown NOVX transcription products, which will lead to reduced NOVX polypeptide production, resulting in reduced NOVX polypeptide activity in the cells or tissues. The present invention also encompasses a method of treating a disease or condition associated with the presence of a NOVX protein in an individual comprising administering to the individual an RNAi construct mat targets the mRNA of the protein (the mRNA that encodes the protein) for degradation. A specific RNAi construct includes a siRNA or a double stranded gene transcript at is processed into siRNAs. Upon treatment, the target protein is not produced or is not produced to the extent it would be in the absence of the treatment.
Where the NOVX gene function is not correlated with a known phenotype, a control sample of cells or tissues from healthy individuals provides a reference standard for determining NOVX expression levels. Expression levels are detected using the assays described, e.g., RT-PCR, Northern blotting, Western blotting, ELISA, and the like. A subject sample of cells or tissues is taken from a mammal, preferably a human subject, suffering from a disease state. The NOVX ribopolynucleotide is used to produce siRNA constructs, that are specific for the NOVX gene product. These cells or tissues are treated by administering NOVX siRNA's to the cells or tissues by methods described for the transfection of nucleic acids into a cell or tissue, and a change in NOVX polypeptide or polynucleotide expression is observed in the subject sample relative to the control sample, using the assays described. This NOVX gene knockdown approach provides a rapid method for determination of a NOVX minus (NOVX") phenotype in the treated subject sample. The NOVX" phenotype observed in the treated subject sample thus serves as a marker for monitoring the course of a disease state during treatment.
In specific embodiments, a NOVX siRNA is used in therapy. Methods for the generation and use of a NOVX siRNA are known to those skilled in the art. Example techniques are provided below.
Production of RNAs
Sense RNA (ssRNA) and antisense RNA (asRNA) of NOVX are produced using known methods such as transcription in RNA expression vectors. In the initial experiments, the sense and antisense RNA are about 500 bases in length each. The produced ssRNA and asRNA (0.5 μM) in 10 mM Tris-HCl (pH 7.5) with 20 mM NaCl were heated to 95° C for 1 min then cooled and annealed at room temperature for 12 to 16 h. The RNAs are precipitated and resuspended in lysis buffer (below). To monitor annealing, RNAs are electrophoresed in a 2% agarose gel in TBE buffer and stained with ethidium bromide. See, e.g., Sambrook et al., Molecular Cloning. Cold Spring Harbor Laboratory Press, Plainview, N.Y. (1989). Lysate Preparation
Untreated rabbit reticulocyte lysate (Ambion) are assembled according to the manufacturer's directions. dsRNA is incubated in the lysate at 30° C for 10 min prior to the addition of mRNAs. Then NOVX RNAs are added and the incubation continued for an additional 60 min. The molar ratio of double stranded RNA and mRNA is about 200: 1. The NOVX mRNA is radiolabeled (using known techniques) and its stability is monitored by gel electrophoresis.
In a parallel experiment made with e same conditions, the double stranded RNA is internally radiolabeled with a 32P-ATP. Reactions are stopped by the addition of 2 X proteinase K buffer and deproteinized as described previously (Tuschl et al., Genes Dev., 13:3191-3197 (1999)). Products are analyzed by electrophoresis in 15% or 18% polyacrylamide sequencing gels using appropriate RNA standards. By monitoring the gels for radioactivity, the natural production of 10 to 25 nt RNAs from the double stranded RNA can be determined.
The band of double stranded RNA, about 21-23 bps, is eluded. The efficacy of these 21-23 mers for suppressing NOVX transcription is assayed in vitro using the same rabbit reticulocyte assay described above using 50 nanomolar of double stranded 21-23 mer for each assay. The sequence of these 21-23 mers is then determined using standard nucleic acid sequencing techniques.
RNA Preparation
21 nt RNAs, based on the sequence determined above, are chemically synthesized using Expedite RNA phosphoramidites and thymidine phosphoramidite (Proligo, Germany). Synthetic oligonucleotides are deprotected and gel-purified (Elbashir, Lendeckel, & Tuschl, Genes & Dev. 15, 188-200 (2001)), followed by Sep-Pak C18 cartridge (Waters, Milford, Mass., USA) purification (Tuschl, etal., Biochemistry, 32:11658-11668 (1993)).
These RNAs (20 μM) single strands are incubated in annealing buffer (100 mM potassium acetate, 30 mM HEPES-KOH at pH 7.4, 2 mM magnesium acetate) for 1 min at 90° C followed by 1 h at 37° C.
Cell Culture
A cell culture known in the art to regularly express NOVX is propagated using standard conditions. 24 hours before transfection, at approx. 80% confluency, the cells are trypsinized and diluted 1 :5 with fresh medium without antibiotics (1-3 X 105 cells/ml) and transferred to 24-well plates (500 ml/well). Transfection is performed using a commercially available lipofection kit and NOVX expression is monitored using standard techniques with positive and negative control. A positive control is cells that naturally express NOVX while a negative control is cells that do not express NOVX. Base-paired 21 and 22 nt siRNAs with overhanging 3' ends mediate efficient sequence-specific mRNA degradation in lysates and in cell culture. Different concentrations of siRNAs are used. An efficient concentration for suppression in vitro in mammalian culture is between 25 nM to 100 nM final concentration. This indicates that siRNAs are effective at concentrations that are several orders of magnitude below the concentrations applied in conventional antisense or ribozyme gene targeting experiments.
The above method provides a way both for e deduction of NOVX siRNA sequence and me use of such siRNA for in vitro suppression. In vivo suppression may be performed using the same siRNA using well known in vivo transfection or gene therapy transfection techniques.
Antisense Nucleic Acids
Another aspect of the invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, or fragments, analogs or derivatives thereof. An "antisense" nucleic acid comprises a nucleotide sequence that is complementary to a "sense" nucleic acid encoding a protein (e.g., complementary to me coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence). In specific aspects, antisense nucleic acid molecules are provided that comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire NOVX coding strand, or to only a portion thereof. Nucleic acid molecules encoding fragments, homologs, derivatives and analogs of a NOVX protein of SEQ ID NO:2w, wherein n is an integer between 1 and 141, or antisense nucleic acids complementary to a NOVX nucleic acid sequence of SEQ ED NO:2«-l , wherein n is an integer between 1 and 141, are additionally provided.
In one embodiment, an antisense nucleic acid molecule is antisense to a "coding region" of the coding strand of a nucleotide sequence encoding a NOVX protein. The term "coding region" refers to e region of the nucleotide sequence comprising codons which are translated into amino acid residues. In another embodiment, e antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding the NOVX protein. The term "noncoding region" refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions). Given e coding strand sequences encoding the NOVX protein disclosed herein, antisense nucleic acids of the invention can be designed according to the rules of Watson and Crick or Hoogsteen base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of NOVX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion of the coding or noncoding region of NOVX mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of NOVX mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An antisense nucleic acid of e invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in-the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally-occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids (e.g., phosphoromioate derivatives and acridine substimted nucleotides can be used).
Examples of modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-carboxymethylaminomethyl-2-thiouridine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymemylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 5-methoxyuracil, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, 2-thiouracil, 4-miouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil,
2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid me ylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acρ3)w, and 2,6-diaminopurine. Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in e following subsection).
The antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding a NOVX protein to thereby inhibit expression of the protein (e.g., by inhibiting transcription and/or translation). The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule at binds to DNA duplexes, through specific interactions in me major groove of the double helix. An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface (e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens). The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient nucleic acid molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.
In yet another embodiment, the antisense nucleic acid molecule of the invention is an oc-anomeric nucleic acid molecule. An α-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual β-units, the strands run parallel to each other. See, e.g., Gaultier, et al, 1987. Nucl. Acids Res. 15: 6625-6641. The antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (See, e.g., Inoue, et al. 1987. Nucl. Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (See, e.g., Inoue, et al, 1987. FEBSLett. 215: 327-330.
Ribozymes and PNA Moieties Nucleic acid modifications include, by way of non-limiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized. These modifications are carried out at least in part to enhance the chemical stability of the modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject. one embodiment, an antisense nucleic acid of me invention is a ribozyme.
Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes as described in Haselhoff and Geriach 1988. Nature 334: 585-591) can be used to catalytically cleave NOVX mRNA transcripts to thereby inhibit translation of NOVX mRNA. A ribozyme having specificity for a NOVX-encoding nucleic acid can be designed based upon me nucleotide sequence of a NOVX cDNA disclosed herein (i.e., SEQ ID NO:2«-l, wherein n is an integer between 1 and 141). For example, a derivative of a Tetrahymena L-19 INS RΝA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a OVX-encoding mRΝA. See, e.g. , U.S. Patent
4,987,071 to Cech, et al. and U.S. Patent 5,116,742 to Cech, et al. ΝOVX mRΝA can also be used to select a catalytic RΝA having a specific ribonuclease activity from a pool of RΝA molecules. See, e.g., Bartel et al, (1993) Science 261:1411-1418. Alternatively, NOVX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the NOVX nucleic acid (e.g., the NOVX promoter and/or enhancers) to form triple helical structures that prevent transcription of the NOVX gene in target cells. See, e.g., Helene, 1991. Anticancer Drug Des. 6: 569-84; Helene, et al. 1992. Ann. N.Y. Acad. Sci. 660: 27-36; Maher, 1992. Bioassays 14: 807-15.
In various embodiments, the NOVX nucleic acids can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., me stability, hybridization, or solubility of the molecule. For example, the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids. See, e.g., Hyrup, et al, 1996. BioorgMed Chem 4: 5-23. As used herein, the terms "peptide nucleic acids" or "PNAs" refer to nucleic acid mimics (e.g., DNA mimics) in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleotide bases are retained. The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomer can be performed using standard solid phase peptide synthesis protocols as described in Hyrup, et al, 1996. supra; Perry-O'Keefe, et al, 1996. Proc. Natl. Acad. Sci. USA 93: 14670-14675.
PNAs of NOVX can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication. PNAs of NOVX can also be used, for example, in e analysis of single base pair mutations in a gene (e.g., PNA directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., Si nucleases (See, Hyrup, et al, I996.supra); or as probes or primers for DNA sequence and hybridization (See, Hyrup, et al, 1996, supra; Perry-O'Keefe, et al, 1996. supra). In another embodiment, PNAs of NOVX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in e art. For example, PNA-DNA chimeras of NOVX can be generated at may combine e advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes (e.g. , RNase H and DNA polymerases) to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleotide bases, and orientation (see, Hyrup, et al., 1996. supra). The synthesis of PNA-DNA chimeras can be performed as described in Hyrup, et al, 1996. supra and Finn, et al, 1996. Nucl Acids Res 24: 3357-3363. For example, a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5' end of DNA. See, e.g., Mag, et al, 1989. Nucl Acid Res 17: 5973-5988. PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment. See, e.g., Finn, et al, 1996. supra. Alternatively, chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment. See, e.g., Petersen, et al, 1975. Bioorg. Med. Chem. Lett. 5: 1119-11124.
In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger, et al, 1989. Proc. Nail. Acad. Sci. U.S.A. 86: 6553-6556; Lemaitre, et al, 1987. Proc. Natl. Acad. Sci. 84: 648-652; PCT Publication No. WO88/09810) or the blood-brain barrier (see, e.g., PCT Publication No. WO 89/10134). In addition, oligonucleotides can be modified with hybridization triggered cleavage agents (see, e.g., Krol, et al, 1988. BioTechniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988. Pharm. Res. 5: 539-549). To this end, the oligonucleotide maybe conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, and the like.
NOVX Polypeptides
A polypeptide according to me invention includes a polypeptide including the amino acid sequence of NOVX polypeptides whose sequences are provided in any one of SEQ ID NO:2n, wherein n is an integer between 1 and 141. The invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residues shown in any one of SEQ ID NO:2n, wherein n is an integer between 1 and 141, while still encoding a protein mat maintains its NOVX activities and physiological functions, or a functional fragment thereof.
In general, a NOVX variant that preserves NOVX-like function includes any variant in which residues at a particular position in the sequence have been substimted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues of e parent protein as well as the possibility of deleting one or more residues from the parent sequence. Any amino acid substimtion, insertion, or deletion is encompassed by e invention. In favorable circumstances, the substimtion is a conservative substimtion as defined above.
One aspect of the invention pertains to isolated NOVX proteins, and biologically-active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-NOVX antibodies. In one embodiment, native NOVX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, NOVX proteins are produced by recombinant DNA techniques. Alternative to recombinant expression, a NOVX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
An "isolated" or "purified" polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the NOVX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of NOVX proteins in which the protein is separated from cellular components of me cells from which it is isolated or recombinantly-produced. In one embodiment, the language "substantially free of cellular material" includes preparations of NOVX proteins having less than about 30% (by dry weight) of non-NOVX proteins (also referred to herein as a "contaminating protein"), more preferably less an about 20% of non-NOVX proteins, still more preferably less than about 10% of non-NOVX proteins, and most preferably less an about 5% of non-NONX proteins. When the ΝOVX protein or biologically-active portion thereof is recombinantly-produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of me ΝOVX protein preparation.
The language "substantially free of chemical precursors or other chemicals" includes preparations of ΝOVX proteins in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein. In one embodiment, the language "substantially free of chemical precursors or other chemicals" includes preparations of ΝOVX proteins having less than about 30% (by dry weight) of chemical precursors or non-ΝOVX chemicals, more preferably less than about 20% chemical precursors or non-ΝOVX chemicals, still more preferably less than about 10% chemical precursors or non-NOVX chemicals, and most preferably less than about 5%> chemical precursors or non-NOVX chemicals.
Biologically-active portions of NOVX proteins include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequences of the NOVX proteins (e.g. , the amino acid sequence of SEQ ED NO:2n, wherein n is an integer between 1 and 141) that include fewer amino acids than the full-length NOVX proteins, and exhibit at least one activity of a NOVX protein. Typically, biologically-active portions comprise a domain or motif with at least one activity of the NOVX protein. A biologically-active portion of a NOVX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acid residues in length.
Moreover, other biologically-active portions, in which other regions of the protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native NOVX protein. m an embodiment, the NOVX protein has an amino acid sequence of SEQ ID NO:2n, wherein n is an integer between 1 and 141. In other embodiments, the NOVX protein is substantially homologous to SEQ ID NO:2w, wherein n is an integer between 1 and 141, and retains the functional activity of the protem of SEQ ID NO:2n, wherein n is an integer between 1 and 141, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail, below. Accordingly, in another embodiment, e NOVX protein is a protein that comprises an amino acid sequence at least about 45% homologous to the amino acid sequence of SEQ ID NO:2ra, wherein n is an integer between 1 and 141, and retains the functional activity of the NOVX proteins of SEQ ID NO:2ra, wherein n is an integer between 1 and 141.
Determining Homology Between Two or More Sequences To determine me percent homology of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in me first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in e second sequence, then me molecules are homologous at that position (i.e., as used herein amino acid or nucleic acid "homology" is equivalent to amino acid or nucleic acid "identity"). The nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch, 1970. JMolBiol48: 443-453. Using GCG GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3, the coding region of the analogous nucleic acid sequences referred to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part of the DNA sequence of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141. The term "sequence identity" refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over at region of comparison, determining me number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The term "substantial identity" as used herein denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.
Chimeric and Fusion Proteins
The invention also provides NOVX chimeric or fusion proteins. As used herein, a NOVX "chimeric protein" or "fusion protein" comprises a NOVX polypeptide operatively-linked to a non-NOVX polypeptide. An "NOVX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a NOVX protein of SEQ ID NO:2n, wherein n is an integer between 1 and 141, whereas a "non-NOVX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the NOVX protein, e.g. , a protein that is different from the NOVX protein and that is derived from me same or a different organism. Within a NOVX fusion protein the NOVX polypeptide can correspond to all or a portion of a NOVX protein. In one embodiment, a NOVX fusion protein comprises at least one biologically-active portion of a NOVX protein. In another embodiment, a NOVX fusion protein comprises at least two biologically-active portions of a NOVX protein. In yet another embodiment, a NOVX fusion protein comprises at least three biologically-active portions of a NOVX protein. Within the fusion protein, the term "operatively-linked" is intended to indicate that the NOVX polypeptide and the non-NOVX polypeptide are fused in-frame with one another. The non-NOVX polypeptide can be fused to the N-terminus or C-terminus of the NOVX polypeptide.
In one embodiment, the fusion protein is a GST-NO VX fusion protein in which the NOVX sequences are fused to me C-terminus of the GST (glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of recombinant NOVX polypeptides.
In another embodiment, me fusion protein is a NOVX protein containing a heterologous signal sequence at its N-terminus. In certain host cells (e.g., mammalian host cells), expression and/or secretion of NOVX can be increased through use of a heterologous signal sequence.
In yet another embodiment, me fusion protein is a NOVX-immunoglobulin fusion protein in which the NOVX sequences are fused to sequences derived from a member of me immunoglobulin protein family. The NOVX-immunoglobulin fusion proteins of the invention can be incorporated into pharmaceutical compositions and admimstered to a subject to inhibit an interaction between a NOVX ligand and a NOVX protein on the surface of a cell, to thereby suppress NOVX-mediated signal transduction in vivo. The NOVX-immunoglobulin fusion proteins can be used to affect the bioavailability of a NOVX cognate ligand. Inhibition of the NOVX ligand NOVX interaction may be useful therapeutically for both me treatment of proliferative and differentiative disorders, as well as modulating (e.g. promoting or inhibiting) cell survival. Moreover, the
NOVX-immunoglobulin fusion proteins of the invention can be used as immunogens to produce anti-NOVX antibodies in a subject, to purify NOVX ligands, and in screening assays to identify molecules that inhibit the interaction of NOVX with a NOVX ligand.
A NOVX chimeric or fusion protem of the invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamphfied to generate a chimeric gene sequence (.see, e.g., Ausubel, et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992). Moreover, many expression vectors are commercially available mat already encode a fusion moiety (e.g., a GST polypeptide). A NOVX-encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to me NOVX protein.
NOVX Agonists and Antagonists
The invention also pertains to variants of the NOVX proteins that function as either NOVX agonists (i.e., mimetics) or as NOVX antagonists. Variants of the NOVX protein can be generated by mutagenesis (e.g., discrete point mutation or truncation of the NOVX protein). An agonist of the NOVX protein can retain substantially the same, or a subset of, the biological activities of the naturally occurring form of the NOVX protein. An antagonist of the NOVX protein can inhibit one or more of the activities of the naturally occurring form of the NOVX protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade which includes the NOVX protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset of me biological activities of e naturally occurring form of the protein has fewer side effects in a subject relative to treatment with me naturally occurring form of the NOVX proteins.
Variants of the NOVX proteins that function as either NOVX agonists (i.e., mimetics) or as NOVX antagonists can be identified by screening combinatorial libraries of mutants (e.g. , truncation mutants) of the NOVX proteins for NOVX protein agonist or antagonist activity. In one embodiment, a variegated library of NOVX variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of NOVX variants can be produced by, for example, enzymatically ligating a mixmre of synthetic oligonucleotides into gene sequences such that a degenerate set of potential NOVX sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing e set of NOVX sequences therein. There are a variety of methods which can be used to produce libraries of potential NOVX variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the desired set of potential NOVX sequences. Methods for synthesizing degenerate oligonucleotides are well-known within the art. See, e.g., Narang, 1983. Tetrahedron 39: 3; Itakura, et al, 1984. Anna. Rev. Biochem. 53: 323; Itakura, et al, 1984. Science 198: 1056; Ike, et al, 1983. Nucl. Acids Res. 11: 477.
Polypeptide Libraries In addition, libraries of fragments of the NOVX protein coding sequences can be used to generate a variegated population of NOVX fragments for screening and subsequent selection of variants of a NOVX protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of a NOVX coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double-stranded DNA that can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with St nuclease, and ligating me resulting fragment library into an expression vector. By this method, expression libraries can be derived which encodes N-terminal and internal fragments of various sizes of the NOVX proteins.
Various techniques are known in me art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening of the gene libraries generated by e combinatorial mutagenesis of NOVX proteins. The most widely used techniques, which are amenable to high throughput analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding me gene whose product was detected. Recursive ensemble mutagenesis (REM), a new technique at enhances me frequency of functional mutants in the libraries, can be used in combination with e screening assays to identify NOVX variants. See, e.g., Arkin and Yourvan, 1992. Proc. Natl Acad. Sci. USA 89: 7811-7815; Delgrave, et al, 1993. Protein Engineering 6:327-331. Anti-NOVX Antibodies
Included in the invention are antibodies to NOVX proteins, or fragments of NOVX proteins. The term "antibody" as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fab, Fab- and F(ab')2 fragments, and an Fab expression library. In general, antibody molecules obtained from humans relates to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgGls IgG2, and others. Furthermore, in humans, me light chain may be a kappa chain or a lambda chain. Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.
An isolated protein of the invention intended to serve as an antigen, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that immunospecifically bind me antigen, using standard techniques for polyclonal and monoclonal antibody preparation. The foil-length protein can be used or, alternatively, the invention provides antigenic peptide fragments of the antigen for use as immunogens. An antigenic peptide fragment comprises at least 6 amino acid residues of the amino acid sequence of me foil length protein, such as an amino acid sequence of SEQ ED NO:2«, wherein n is an integer between 1 and 141 , and encompasses an epitope thereof such that an antibody raised against the peptide forms a specific immune complex with the foil length protein or with any fragment mat contains the epitope. Preferably, the antigenic peptide comprises at least 10 amino acid residues, or at least 15 amino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues. Preferred epitopes encompassed by the antigenic peptide are regions of the protein mat are located on its surface; commonly these are hydrophilic regions.
In certain embodiments of the invention, at least one epitope encompassed by the antigenic peptide is a region of NOVX that is located on the surface of the protein, e.g., a hydrophilic region. A hydrophobicity analysis of the human NOVX protein sequence will indicate which regions of a NOVX polypeptide are particularly hydrophilic and, merefore, are likely to encode surface residues useful for targeting antibody production. As a means for targeting antibody production, hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in me art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation. See, e.g., Hopp and Woods, 1981, Proc. Nat. Acad. Sci. USA 78: 3824-3828; Kyte and Doolittle 1982, J. Mol Biol. 157: 105-142, each incorporated herein by reference in their entirety. Antibodies that are specific for one or more domains within an antigenic protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.
The term "epitope" includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. A NOVX polypeptide or a fragment mereof comprises at least one antigenic epitope. An anti-NOVX antibody of the present invention is said to specifically bind to antigen NOVX when e equilibrium binding constant (KD) is <1 μM, preferably < 100 nM, more preferably < 10 nM, and most preferably < 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art. A protein of the invention, or a derivative, fragment, analog, homolog or ortholog thereof, may be utilized as an immunogen in me generation of antibodies that immunospecifically bind these protein components.
Various procedures known within the art may be used for me production of polyclonal or monoclonal antibodies directed against a protein of e invention, or against derivatives, fragments, analogs homologs or orthologs thereof (see, for example, Antibodies: A Laboratory Manual, Harlow E, and Lane D, 1988, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, incorporated herein by reference). Some of these antibodies are discussed below.
Polyclonal Antibodies For the production of polyclonal antibodies, various suitable host animals (e.g. , rabbit, goat, mouse or other mammal) may be immunized by one or more injections with me native protein, a synthetic variant thereof, or a derivative of the foregoing. An appropriate immunogenic preparation can contain, for example, the naturally occurring immunogenic protein, a chemically synthesized polypeptide representing the immunogenic protein, or a recombinantly expressed immunogenic protein. Furthermore, the protein may be conjugated to a second protein known to be immunogenic in e mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. The preparation can further include an adjuvant. Various adjuvants used to increase e immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), adjuvants usable in humans such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents. Additional examples of adjuvants which can be employed include MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
The polyclonal antibody molecules directed against the immunogenic protein can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson (The Scientist, published by The Scientist, Inc., Philadelphia PA, Vol. 14, No. 8 (April 17, 2000), pp. 25-28).
Monoclonal Antibodies
The term "monoclonal antibody" (MAb) or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules at contain only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population. MAbs thus contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it. Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes can be immunized in vitro.
The immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protem thereof. Generally, either peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59-103). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfosed, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for me hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which substances prevent the growth of HGPRT-deficient cells.
Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by me selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtamed, for instance, from the Salk mstimte Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63).
The culture medium in which the hybridoma cells are cultured can then be assayed for me presence of monoclonal antibodies directed against me antigen. Preferably, the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980). It is an objective, especially important in therapeutic applications of monoclonal antibodies, to identify antibodies having a high degree of specificity and a high binding affinity for me target antigen.
After the desired hybridoma cells are identified, the clones can be subcloned by limiting dilution procedures and grown by standard methods (Goding,1986). Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, me hybridoma cells can be grown in vivo as ascites in a mammal.
The monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
The monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells of the invention serve as a preferred source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of me homologous murine sequences (U.S. Patent No. 4,816,567; Morrison, Nature 368, 812-13 (1994)) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substimted for the constant domains of an antibody of me invention, or can be substimted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
Humanized Antibodies The antibodies directed against the protein antigens of the invention can further comprise humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin. Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin, and contain minimal sequence derived from a non-human immunoglobulin. Humanization can be performed following me method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. (See also U.S. Patent No. 5,225,539.) In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., 1986; Riechmann et al., 1988; and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)).
Human Antibodies
Fully human antibodies essentially relate to antibody molecules in which the entire sequence of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed "human antibodies", or "folly human antibodies" herein. Human monoclonal antibodies can be prepared by the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al, 1983 Immunol Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985 In: MONOCLONAL ANΉBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96). Human monoclonal antibodies may be utilized in the practice of me present invention and may be produced by using human hybridomas (see Cote, et al., 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see Cole, et al, 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).
In addition, human antibodies can also be produced using additional techniques, including phage display libraries (Hoogenboom and Winter, J. Mol Biol, 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)). Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles mat seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in Marks et al. (Bio/Technology 10, 779-783 (1992)); Lonberg et al. (Nature 368 856-859 (1994)); Morrison ( Nature 368, 812-13 (1994)); Fishwild et al,( Nature Biotechnology 14, 845-51 (1996)); Neuberger (Nature Biotechnology 14, 826 (1996)); and Lonberg and Huszar (Intern. Rev. Immunol. 13 65-93 (1995)).
Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce folly human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen. (See PCT publication WO94/02602). The endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome. The human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all me desired modifications is men obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than me foil complement of e modifications. The preferred embodiment of such a nonhuman animal is a mouse, and is termed the Xenomouse™ as disclosed in PCT publications WO 96/33735 and WO 96/34096. This animal produces B cells which secrete folly human immunoglobulins. The antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies. Additionally, e genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules. An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No. 5,939,598. It can be obtained by a method including deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent rearrangement of me locus and to prevent formation of a transcript of a rearranged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain me gene encoding the selectable marker. A method for producing an antibody of interest, such as a human antibody, is disclosed in U.S. Patent No. 5,916,771. It includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fosing the two cells to form a hybrid cell The hybrid cell expresses an antibody containing the heavy chain and the light chain.
In a further improvement on this procedure, a method for identifying a clinically relevant epitope on an immunogen, and a correlative method for selecting an antibody that binds immunospecifically to the relevant epitope with high affinity, are disclosed in PCT publication WO 99/53049.
Fab Fragments and Single Chain Antibodies
According to the invention, techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see e.g., U.S. Patent No. 4,946,778). In addition, methods can be adapted for me construction of Fab expression libraries (see e.g., Huse, et al., 1989 Science 246: 1275-1281) to allow rapid and effective identification of monoclonal Fa fragments with the desired specificity for a protein or derivatives, fragments, analogs or homologs mereof. Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F av)2 fragment produced by pepsin digestion of an antibody molecule; (ii) an Fab fragment generated by reducing me disulfide bridges of an F(ab')2 fragment; (iii) an Fab fragment generated by the treatment of me antibody molecule with papain and a reducing agent and (iv) Fv fragments.
Bispecific Antibodies
Bispecific antibodies are monoclonal, preferably human or humanized, antibodies at have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for an antigenic protein of the invention. The second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit.
Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305:537-539 (1983)). Because of me random assortment of immunoglobulin heavy and light chains, these hybridomas (quadro as) produce a potential mixture often different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829, published 13 May 1993, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).
Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding present in at least one of me fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, e immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host organism. For further details of generating bispecific antibodies see, for example, Suresh et al, Methods in Enzymology, 121:210 (1986). According to another approach described in WO 96/27011 , me interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The preferred interface comprises at least a part of the CH3 region of an antibody constant domain. In mis method, one or more small amino acid side chains from me interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of me heterodimer over other unwanted end-products such as homodimers. Bispecific antibodies can be prepared as foil length antibodies or antibody fragments
(e.g. F(ab')2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab')2 fragments. These fragments are reduced in the presence of me dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thio trobenzoate (TNB) derivatives. One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for e selective immobilization of enzymes.
Additionally, Fab' fragments can be directly recovered from E. coli and chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp. Med. 175:217-225 (1992) describe the production of a folly humanized bispecific antibody F(ab')2 molecule. Each Fab' fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form me bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes agamst human breast tumor targets. Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny et al., J. Immunol. 148(5):1547-1553 (1992). The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for me production of antibody homodimers. The "diabody" technology described by Hollinger et al, Proc. Natl Acad. Sci. USA 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See, Gruber et al, J. Immunol. 152:5368 (1994).
Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tutt et al., J. Immunol 147:60 (1991).
Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in me protein antigen of me invention. Alternatively, an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG (FcγR), such as FcγRI (CD64), FcγRII (CD32) and FcγRIII (CD 16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen. Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen. These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Another bispecific antibody of interest binds the protein antigen described herein and forther binds tissue factor (TF).
Heteroconjugate Antibodies
Heteroconjugate antibodies are also within the scope of the present invention.
Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells
(U.S. Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360; WO
92/200373; EP 03089). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S.
Patent No. 4,676,980.
Effector Function Engineering
It can be desirable to modify e antibody of the invention with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating cancer. For example, cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated can have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al, J. Exp Med., 176: 1191-1195 (1992) and Shopes, J. Immunol., 148: 2918-2922 (1992). Homodimeric antibodies with enhanced anti-tumor activity can also be prepared using heterobifonctional cross-linkers as described in Wolff et al. Cancer Research, 53: 2560-2565 (1993). Alternatively, an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design, 3: 219-230 (1989). Immunoconjugates
The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fongal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPπ, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 1311, 131In, 90Y, and 186Re. Conjugates of me antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), dusocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al, Science. 238: 1098 (1987). Carbon- 14-labeled l-isothiocyanatobenzyl-3-memyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
In another embodiment, the antibody can be conjugated to a "receptor" (such streptavidin) for utilization in tumor pretargeting wherein me antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and men administration of a "ligand" (e.g. , avidin) that is in turn conjugated to a cytotoxic agent. Immunoliposomes
The antibodies disclosed herein can also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatizedphosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al .,.J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction. A chemotherapeutic agent (such as Doxorubicin) is optionally contained within e liposome. See Gabizon et al, J. National Cancer Inst, 81(19): 1484 (1989). Diagnostic Applications of Antibodies Directed Against the Proteins of the
Invention m one embodiment, methods for the screening of antibodies that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELISA) and other immunologically mediated techniques known within the art. In a specific embodiment, selection of antibodies that are specific to a particular domain of an NOVX protein is facilitated by generation of hybridomas that bind to the fragment of an NOVX protein possessing such a domain. Thus, antibodies that are specific for a desired domain within an NOVX protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein. Antibodies directed against a NOVX protein of the invention may be used in methods known within me art relating to the localization and/or quantitation of a NOVX protein (e.g., for use in measuring levels of me NOVX protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging me protein, and e like). In a given embodiment, antibodies specific to a NOVX protein, or derivative, fragment, analog or homolog mereof, that contain the antibody derived antigen binding domain, are utilized as pharmacologically active compounds (referred to hereinafter as "Therapeutics"). An antibody specific for a NOVX protein of the invention (e.g., a monoclonal antibody or a polyclonal antibody) can be used to isolate a NOVX polypeptide by standard techniques, such as immunoaffinity, chromatography or immunoprecipitation. An antibody to a NOVX polypeptide can facilitate the purification of a natural NOVX antigen from cells, or of a recombinantly produced NOVX antigen expressed in host cells. Moreover, such an anti-NOVX antibody can be used to detect the antigenic NOVX protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate e abundance and pattern of expression of the antigenic NOVX protem. Antibodies directed against a NOVX protein can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125I, 131I, 35S or 3H.
Antibody Therapeutics
Antibodies of the invention, including polyclonal, monoclonal, humanized and folly human antibodies, may used as therapeutic agents. Such agents will generally be employed to treat or prevent a disease or pathology in a subject. An antibody preparation, preferably one having high specificity and high affinity for its target antigen, is admimstered to the subject and will generally have an effect due to its binding with the target. Such an effect may be one of two kinds, depending on e specific nature of the interaction between the given antibody molecule and the target antigen in question. In the first instance, administration of the antibody may abrogate or inhibit the binding of the target with an endogenous ligand to which it naturally binds. In mis case, me antibody binds to the target and masks a binding site of the naturally occurring ligand, wherein the ligand serves as an effector molecule. Thus the receptor mediates a signal transduction pathway for which ligand is responsible.
Alternatively, the effect may be one in which the antibody elicits a physiological result by virtue of binding to an effector binding site on the target molecule. In this case the target, a receptor having an endogenous ligand which may be absent or defective in the disease or pathology, binds the antibody as a surrogate effector ligand, initiating a receptor-based signal transduction event by the receptor.
A therapeutically effective amount of an antibody of the invention relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the antibody and its target antigen that, in certain cases, interferes with me functioning of the target, and in other cases, promotes a physiological response. The amount required to be administered will furthermore depend on the binding affinity of the antibody for its specific antigen, and will also depend on the rate at which an administered antibody is depleted from the free volume other subject to which it is administered. Common ranges for therapeutically effective dosing of an antibody or antibody fragment of me invention may be, by way of nonhmiting example, from about 0.1 mg/kg body weight to about 50 mg/kg body weight. Common dosing frequencies may range, for example, from twice daily to once a week.
Pharmaceutical Compositions of Antibodies Antibodies specifically binding a protein of the invention, as well as other molecules identified by the screening assays disclosed herein, can be administered for the treatment of various disorders in the form of pharmaceutical compositions. Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington : The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al, editors) Mack Pub. Co., Easton, Pa. : 1995; Drug Absoφtion Enhancement : Concepts, Possibilities, Limitations, And Trends, Harwood Academic Publishers, Langhorne, Pa., 1994; and Peptide And Protein Drug Delivery (Advances In Parenteral Sciences, Vol. 4), 1991, M. Dekker, New York.
If the antigenic protein is intracellular and whole antibodies are used as inhibitors, mtemalizing antibodies are preferred. However, liposomes can also be used to deliver the antibody, or an antibody fragment, into cells. Where antibody fragments are used, the smallest inhibitory fragment that specifically binds to the binding domain of me target protein is preferred. For example, based upon me variable-region sequences of an antibody, peptide molecules can be designed that retain the ability to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. See, e.g., Marasco et al, Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993). The formulation herein can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities mat do not adversely affect each other. Alternatively, or in addition, the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for me purpose intended. The active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
Sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid andγ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as me LUPRON DEPOT ™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. ELISA Assay
An agent for detecting an analyte protein is an antibody capable of binding to an analyte protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment mereof (e.g., Fab or F(ab)2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such at it can be detected with fluorescently-labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term "biological sample", therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph. That is, the detection method of the invention can be used to detect an analyte mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of an analyte mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of an analyte genomic DNA include Southern hybridizations. Procedures for conducting immunoassays are described, for example in "ELISA: Theory and Practice: Methods in Molecular Biology", Vol. 42, J. R. Crowther (Ed.) Human Press, Totowa, NJ, 1995; "Immunoassay", E. Diamandis and T. Christopoulus, Academic Press, Inc., San Diego, CA, 1996; and "Practice and Thory of Enzyme Immunoassays", P. Tijssen, Elsevier Science Publishers, Amsterdam, 1985. Furthermore, in vivo techniques for detection of an analyte protein include introducing into a subject a labeled anti-an analyte protein antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
NOVX Recombinant Expression Vectors and Host Cells
Another aspect of me invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding a NOVX protem, or derivatives, fragments, analogs or homologs mereof. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting anomer nucleic acid to which it has been linked. One type of vector is a
"plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into e viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g, non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, mat is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably-linked" is intended to mean mat the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those mat direct expression of e nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that me design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., NOVX proteins, mutant forms of NOVX proteins, fusion proteins, etc.). The recombinant expression vectors of the invention can be designed for expression of NOVX proteins in prokaryotic or eukaryotic cells. For example, NOVX proteins can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed forther in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fosion or non-fosion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fosion vectors typically serve three puφoses: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (Hi) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fosion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) mat fuse glutathione S-transferase (GST), maltose E binding protem, or protein A, respectively, to the target recombinant protein.
Examples of suitable inducible non-fosion E. coli expression vectors include pTrc (Amrann et al, (1988) Gene 69:301-315) an pET lld (Studier et α/., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized inE. coli (see, e.g., Wada, et al, 1992. Nucl. Acids Res.20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
In another embodiment, the NOVX expression vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSecl (Baldari, et al, 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al, 1987. Gene 54: 113-123), pYES2 (Invitrogen Coφoration, San Diego, Calif), and picZ (InVitrogen Coφ, San Diego, Calif).
Alternatively, NOVX can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) mclude the pAc series (Smith, et al, 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include ρCDM8 (Seed, 1981. Nature 329: 840) andpMT2PC (Kaufinan, etal, 1987. EMBO J. 6: 187-195). When used in mammalian cells, me expression vector's control fonctions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al, MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
In anomer embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in e art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al, 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Banerji, et al, 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al, 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Grass, 1990. Science 249: 374-379) and the α-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546). The invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to NOVX mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen mat direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see, e.g., Weintraub, et al, "Antisense RNA as a molecular tool for genetic analysis," Reviews-Trends in Genetics, Vol. 1(1) 1986. Another aspect of e invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms "host cell" and
"recombinant host cell" are used interchangeably herein. It is understood mat such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of me term as used herein.
A host cell can be any prokaryotic or eukaryotic cell. For example, NOVX protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art. Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding NOVX or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while me other cells die).
A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) NOVX protein. Accordingly, the invention further provides methods for producing NOVX protein using the host cells of the invention. In one embodiment, me method comprises culturing the host cell of invention (into which a recombinant expression vector encoding NOVX protein has been introduced) in a suitable medium such that NOVX protein is produced. In another embodiment, the method forther comprises isolating NOVX protein from the medium or me host cell.
Transgenic NOVX Animals
The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which NOVX protein-coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous NOVX sequences have been introduced into their genome or homologous recombinant animals in which endogenous NOVX sequences have been altered. Such animals are useful for studying me function and/or activity of NOVX protein and for identifying and/or evaluating modulators of NOVX protem activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene. Other examples of transgenic animals mclude non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and that remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. As used herein, a "homologous recombinant animal" is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous NOVX gene has been altered by homologous recombination between me endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal. A transgenic animal of the invention can be created by introducing NO VX-encoding nucleic acid into the male pronuclei of a fertilized oocyte (e.g., by microinjection, retroviral infection) and allowing the oocyte to develop in a pseudopregnant female foster animal. The human NOVX cDNA sequences, i.e., any one of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, can be introduced as a transgene into the genome of a non-human animal. Alternatively, a non-human homologue of the human NOVX gene, such as a mouse NOVX gene, can be isolated based on hybridization to me human NOVX cDNA (described forther supra) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in me transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably-linked to me NOVX transgene to direct expression of NOVX protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Patent Nos. 4,736,866; 4,870,009; and 4,873,191; and Hogan, 1986. In: MANIPULATING THE MOUSE EMBRYO, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of the NOVX transgene in its genome and/or expression of NOVX mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene-encoding NOVX protein can forther be bred to other transgenic animals carrying other transgenes.
To create a homologous recombinant animal, a vector is prepared which contains at least a portion of a NOVX gene into which a deletion, addition or substimtion has been introduced to thereby alter, e.g., functionally disrupt, me NOVX gene. The NOVX gene can be a human gene (e.g., the cDNA of any one of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141), but more preferably, is a non-human homologue of a human NOVX gene. For example, a mouse homologue of human NOVX gene of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, can be used to construct a homologous recombination vector suitable for altering an endogenous NOVX gene in the mouse genome. In one embodiment, the vector is designed such mat, upon homologous recombination, the endogenous NOVX gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).
Alternatively, the vector can be designed such that, upon homologous recombination, the endogenous NOVX gene is mutated or otherwise altered but still encodes functional protein (e.g., me upstream regulatory region can be altered to thereby alter the expression of the endogenous NOVX protein). In the homologous recombination vector, the altered portion of the NOVX gene is flanked at its 5'- and 3'-termini by additional nucleic acid of me NOVX gene to allow for homologous recombination to occur between the exogenous NOVX gene carried by me vector and an endogenous NOVX gene in an embryonic stem cell. The additional flanking NOVX nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (bom at the 5'- and 3'-termini) are included in the vector. See, e.g., Thomas, et al, 1987. Cell 51: 503 for a description of homologous recombination vectors. The vector is ten introduced into an embryonic stem cell line (e.g., by electioporation) and cells in which the introduced NOVX gene has homologously-recombined with me endogenous NOVX gene are selected. See, e.g., Li, et al, 1992. Cell 69: 915.
The selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras. See, e.g., Bradley, 1987. In: TERATOCARCINOMAS AND EMBRYONIC STEM CELLS: A PRACTICAL APPROACH, Robertson, ed. IRL, Oxford, pp.
113-152. A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously-recombined DNA in their germ cells can be used to breed animals in which all cells of me animal contain the homologously-recombined DNA by germline transmission of the transgene. Methods for constructing homologous recombination vectors and homologous recombinant animals are described forther in Bradley, 1991. Curr. Opin. Biotechnol 2: 823-829; PCT International Publication Nos.: WO 90/11354; WO 91/01140; WO 92/0968; and WO 93/04169. In another embodiment, transgenic non-humans animals can be produced that contain selected systems that allow for regulated expression of the transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage PI. For a description of the cre/loxP recombinase system, See, e.g., Lakso, et al, 1992. Proc. Natl. Acad. Sci. USA 89: 6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae. See, O'Gorman, etal, 1991. Science 251:1351-1355. If a cre/loxP recombinase system is used to regulate expression of the transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, et al, 1997. Nature 385: 810-813. la brief, a cell (e.g. , a somatic cell) from the transgenic animal can be isolated and induced to exit the growth cycle and enter G0 phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of me same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and men transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone of me animal from which e cell (e.g., the somatic cell) is isolated.
Pharmaceutical Compositions
The NOVX nucleic acid molecules, NOVX proteins, and anti-NOVX antibodies (also referred to herein as "active compounds") of the invention, and derivatives, fragments, analogs and homologs thereof, can be incoφorated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protem, or antibody and a pharmaceutically acceptable carrier. As used herein, "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifongal agents, isotonic and absoφtion delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incoφorated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incoφorated into the compositions. A pharmaceutical composition of me invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include me following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyemylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for me adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against e contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and me like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by me use of a coating such as lecithin, by me maintenance of the required particle size in me case of dispersion and by the use of surfactants . Prevention of me action of microorganisms can be achieved by various antibacterial and antifongal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in e composition. Prolonged absoφtion of the injectable compositions can be brought about by including in the composition an agent which delays absoφtion, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incoφorating me active compound (e.g. , a NOVX protein or anti-NOVX antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incoφorating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution mereof.
Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For me puφose of oral therapeutic administration, the active compound can be incoφorated with excipients and used in me form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to me barrier to be permeated are used in me formulation. Such penetrants are generally known in me art, and include, for example, for transmucosal administration, detergents, bile salts, and fosidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
The compounds can also be prepared in the form of suppositories (e.g. , with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Coφoration and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in me art, for example, as described in U.S. Patent No. 4,522,811.
It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for me subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce me desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and me particular therapeutic effect to be achieved, and me limitations inherent in the art of compounding such an active compound for the treatment of individuals.
The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene merapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see, e.g., U.S. Patent No. 5,328,470) or by stereotactic injection (see, e.g., Chen, et al, 1994. Proc. Natl. Acad. Sci. USA 91: 3054-3057). The pharmaceutical preparation of the gene merapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where me complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration. Screening and Detection Methods
The isolated nucleic acid molecules of the invention can be used to express NOVX protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect NOVX mRNA (e.g., in a biological sample) or a genetic lesion in a NOVX gene, and to modulate NOVX activity, as described forther, below. In addition, the NOVX proteins can be used to screen drugs or compounds that modulate me NOVX protein activity or expression as well as to treat disorders characterized by insufficient or excessive production of NOVX protein or production of NOVX protein forms that have decreased or aberrant activity compared to NOVX wild-type protein (e.g.; diabetes (regulates insulin release); obesity (binds and transport lipids); metabolic disturbances associated with obesity, the metabolic syndrome X as well as anorexia and wasting disorders associated with chronic diseases and various cancers, and infectious disease(possesses anti-microbial activity) and the various dyslipidemias. In addition, me anti-NOVX antibodies of the invention can be used to detect and isolate NOVX proteins and modulate NOVX activity. In yet a forther aspect, the invention can be used in methods to influence appetite, absoφtion of nutrients and the disposition of metabolic substrates in both a positive and negative fashion.
The invention forther pertains to novel agents identified by me screening assays described herein and uses mereof for treatments as described, supra.
Screening Assays
The invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i. e. , candidate or test compounds or agents (e.g. , peptides, peptidomimetics, small molecules or other drugs) that bind to NOVX proteins or have a stimulatory or inhibitory effect on, e.g., NOVX protein expression or NOVX protein activity. The invention also includes compounds identified in the screening assays described herein. In one embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate me activity of the membrane-bound form of a NOVX protein or polypeptide or biologically-active portion thereof. The test compounds of the invention can be obtained using any of me numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound" library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. See, e.g., Lam, 1997 '. Anticancer Drug Design 12: 145.
A "small molecule" as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD. Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules. Libraries of chemical and/or biological mixtures, such as fongal, bacterial, or algal extracts, are known in me art and can be screened with any of the assays of the invention.
Examples of methods for me synthesis of molecular libraries can be found in the art, for example in: DeWitt, et al, 1993. Proc. Natl. Acad. Sci. U.S.A. 90: 6909; Erb, et al, 1994. Proc. Natl. Acad. Sci. U.S.A. 91: 11422; Zuckermann, et al, 1994. J. Med. Chem. 37: 2678; Cho, et al, 1993. Science 261: 1303; Carrell, et al, 1994. Angew. Chem. Int. Ed. Engl 33: 2059; Carell, et al, 1994. Angew. Chem. Int. Ed. Engl. 33: 2061; and Gallop, et al, 1994. J. Med. Chem. 37: 1233.
Libraries of compounds maybe presented in solution (e.g., Houghten, 1992. Biotechniques 13: 412-421), or on beads (Lam, 1991. Nature 354: 82-84), on chips (Fodor, 1993. Nature 364: 555-556), bacteria (Ladner, U.S. Patent No. 5,223,409), spores (Ladner, U.S. Patent 5,233,409), plasmids (Cull, et al, 1992. Proc. Natl. Acad. Sci. USA 89: 1865-1869) or on phage (Scott and Smim, 1990. Science 249: 386-390; Devlin, 1990. Science 249: 404-406; Cwirla, etal, 1990. Proc. Natl. Acad. Sci. U.S.A. 87: 6378-6382; Felici, 1991. J. Mol. Biol. 222: 301 -310; Ladner, U.S. Patent No. 5,233,409.).
In one embodiment, an assay is a cell-based assay in which a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion mereof, on the cell surface is contacted with a test compound and the ability of me test compound to bind to a NOVX protein determined. The cell, for example, can of mammalian origin or a yeast cell. Determining the ability of me test compound to bind to the NOVX protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the NOVX protein or biologically-active portion mereof can be determined by detecting the labeled compound in a complex. For example, test compounds can be labeled with 1251, 35S, 14C, or 3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting. Alternatively, test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. In one embodiment, the assay comprises contacting a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface with a known compound which binds NOVX to form an assay mixmre, contacting the assay mixmre with a test compound, and determining the ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX protein or a biologically-active portion mereof as compared to the known compound.
In anomer embodiment, an assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of NOVX protein, or a biologically-active portion mereof, on the cell surface with a test compound and determining me ability of the test compound to modulate (e.g. , stimulate or inhibit) the activity of the NOVX protein or biologically-active portion mereof. Determining me ability of the test compound to modulate the activity of NOVX or a biologically-active portion thereof can be accomplished, for example, by determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule. As used herein, a "target molecule" is a molecule wim which a NOVX protein binds or interacts in nature, for example, a molecule on the surface of a cell which expresses a NOVX interacting protein, a molecule on the surface of a second cell, a molecule in the extracellular milieu, a molecule associated with the internal surface of a cell membrane or a cytoplasmic molecule. A NOVX target molecule can be a non-NOVX molecule or a NOVX protein or polypeptide of the invention. In one embodiment, a NOVX target molecule is a component of a signal transduction pathway that facilitates transduction of an extracellular signal (e.g. a signal generated by binding of a compound to a membrane-bound NOVX molecule) through the cell membrane and into the cell. The target, for example, can be a second intercellular protein that has catalytic activity or a protein that facilitates me association of downstream signaling molecules with NOVX.
Determining me ability of the NOVX protein to bind to or interact with a NOVX target molecule can be accomplished by one of the methods described above for determining direct binding. In one embodiment, determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule can be accomplished by determining the activity of the target molecule. For example, the activity of the target molecule can be determined by detecting induction of a cellular second messenger of the target (i.e. intiacellular Ca2+, diacylglycerol, IP3, etc.), detecting catalytic/enzymatic activity of the target an appropriate substrate, detecting the induction of a reporter gene (comprising a NOVX-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a cellular response, for example, cell survival, cellular differentiation, or cell proliferation.
In yet another embodiment, an assay of the invention is a cell-free assay comprising contacting a NOVX protein or biologically-active portion thereof with a test compound and determining e ability of the test compound to bind to the NOVX protein or biologically-active portion thereof. Binding of the test compound to the NOVX protein can be determined either directly or indirectly as described above. In one such embodiment, the assay comprises contacting the NOVX protein or biologically-active portion thereof with a known compoimd which binds NOVX to form an assay mixmre, contacting the assay mixmre wim a test compound, and determining me ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX or biologically-active portion thereof as compared to the known compound. In still anomer embodiment, an assay is a cell-free assay comprising contacting
NOVX protem or biologically-active portion thereof with a test compound and determining the ability of the test compound to modulate (e.g. stimulate or inhibit) me activity of the NOVX protein or biologically-active portion thereof. Determimng the ability of me test compound to modulate me activity of NOVX can be accomplished, for example, by determining me ability of the NOVX protein to bind to a NOVX target molecule by one of the methods described above for determining direct binding. In an alternative embodiment, determining the ability of the test compound to modulate the activity of NOVX protein can be accomplished by determining e ability of the NOVX protein forther modulate a NOVX target molecule. For example, the catalytic/enzymatic activity of the target molecule on an appropriate substrate can be determined as described, supra.
In yet another embodiment, the cell-free assay comprises contacting the NOVX protein or biologically-active portion thereof wim a known compound which binds NOVX protein to form an assay mixture, contacting the assay mixmre with a test compound, and determining e ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining me ability of the NOVX protein to preferentially bind to or modulate the activity of a NOVX target molecule. The cell-free assays of the invention are amenable to use of both the soluble form or the membrane-bound form of NOVX protein. In the case of cell-free assays comprising the membrane-bound form of NOVX protein, it may be desirable to utilize a solubilizing agent such that the membrane-bound form of NOVX protein is maintained in solution. Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton® X-100, Triton® X-l 14, Thesit®, Isotridecypoly(ethylene glycol ether)n, N-dodecyl~N,N-dimethyl-3-ammonio-l -propane sulfonate, 3-(3-cholamidopropyl) dimethylamminiol-1 -propane sulfonate (CHAPS), or 3-(3-cholamidopropyl)dimethylamminiol-2-hydroxy-l-propane sulfonate (CHAPSO). In more than one embodiment of the above assay methods of the invention, it may be desirable to immobilize either NOVX protein or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to NOVX protein, or interaction of NOVX protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels mclude microtiter plates, test tubes, and micro-centrifoge tubes. In one embodiment, a fusion protein can be provided that adds a domain that allows one or both of e proteins to be bound to a matrix. For example, GST-NO VX fosion proteins or GST-target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtiter plates, that are then combined with the test compound or the test compound and either me non-adsorbed target protein or NOVX protein, and the mix re is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, me matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described, supra. Alternatively, the complexes can be dissociated from the matrix, and the level of NOVX protein binding or activity determined using standard techniques. Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention. For example, either the NOVX protein or its target molecule can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated NOVX protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well-known within the art (e.g. , biotinylation kit, Pierce Chemicals, Rockford, III), and immobilized in the wells of stieptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with NOVX protein or target molecules, but which do not interfere wim binding of the NOVX protein to its target molecule, can be derivatized to the wells of the plate, and unbound target or NOVX protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the NOVX protein or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated wim the NOVX protein or target molecule. In another embodiment, modulators of NOVX protein expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of NOVX mRNA or protein in me cell is determined. The level of expression of NOVX mRNA or protein in the presence of the candidate compound is compared to the level of expression of NOVX mRNA or protein in the absence of me candidate compound. The candidate compound can men be identified as a modulator of NOVX mRNA or protein expression based upon this comparison. For example, when expression of NOVX mRNA or protein is greater (i.e., statistically significantly greater) in me presence of the candidate compound than in its absence, me candidate compound is identified as a stimulator of NOVX mRNA or protein expression. Alternatively, when expression of NOVX mRNA or protein is less (statistically significantly less) in the presence of me candidate compound than in its absence, the candidate compound is identified as an inhibitor of NOVX mRNA or protein expression. The level of NOVX mRNA or protein expression in the cells can be determined by methods described herein for detecting NOVX mRNA or protein.
In yet another aspect of the invention, the NOVX proteins can be used as "bait proteins" in a two-hybrid assay or three hybrid assay (see, e.g., U.S. PatentNo. 5,283,317; Zervos, et al, 1993. Ce// 72: 223-232; Madura, etal, 1993. J. Biol. Chem. 268: 12046-12054; Bartel, etal, 1993. Biotechniques 14: 920-924; Iwabuchi, et al, 1993. Oncogene 8: 1693-1696; and Brent WO 94/10300), to identify other proteins that bind to or interact with NOVX ("NOVX-binding proteins" or "NOVX-bp") and modulate NOVX activity. Such NOVX-binding proteins are also involved in the propagation of signals by the NOVX proteins as, for example, upstream or downstream elements of the NOVX pathway. The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for NOVX is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, at encodes an unidentified protein ("prey" or "sample") is fused to a gene that codes for the activation domain of e known transcription factor. If the "bait" and the "prey" proteins are able to interact, in vivo, forming a NOVX-dependent complex, me DNA-binding and activation domains of e transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) mat is operably linked to a transcriptional regulatory site responsive to me transcription factor. Expression of the reporter gene can be detected and cell colonies containing the fonctional transcription factor can be isolated and used to obtain the cloned gene mat encodes the protein which interacts with NOVX.
The invention forther pertains to novel agents identified by the aforementioned screening assays and uses thereof for treatments as described herein.
Detection Assays Portions or fragments of the cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. By way of example, and not of limitation, these sequences can be used to: (z) map their respective genes on a chromosome; and, thus, locate gene regions associated wim genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (Hi) aid in forensic identification of a biological sample. Some of these applications are described in the subsections, below.
Chromosome Mapping
Once the sequence (or a portion of the sequence) of a gene has been-isolated, this sequence can be used to map the location of the gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments of the NOVX sequences of SEQ ID NO:2n-l, wherein n is an mteger between 1 and 141, or fragments or derivatives thereof, can be used to map the location of the NOVX genes, respectively, on a chromosome. The mapping of the NOVX sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.
Briefly, NOVX genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp in length) from the NOVX sequences. Computer analysis of the NOVX, sequences can be used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the NOVX sequences will yield an amplified fragment. Somatic cell hybrids are prepared by fosing somatic cells from different mammals
(e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but in which human cells can, e one human chromosome that contains the gene encoding the needed enzyme will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a foil set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. See, e.g., D'Eustachio, et al, 1983. Science 220: 919-924. Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.
PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using me NOVX sequences to design oligonucleotide primers, sub-localization can be achieved with panels of fragments from specific chromosomes. Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can forther be used to provide a precise chromosomal location in one step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical like colcemid that disrupts the mitotic spindle. The chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually. The FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases, will suffice to get good results at a reasonable amount of time. For a review of this technique, see, Nerma, et al., HUMAN CHROMOSOMES: A MANUAL OF BASIC TECHNIQUES (Pergamon Press, New York 1988). Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions of the genes actually are preferred for mapping pmposes. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.
Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on me chromosome can be correlated with genetic map data. Such data are found, e.g., in McKusick, MENDELIAN INHERITANCE IN MAN, available on-line through Johns Hopkins University Welch Medical Library). The relationship between genes and disease, mapped to e same chromosomal region, can then be identified through linkage analysis (co-inheritance of physically adjacent genes), described in, e.g., Egeland, et al, 1987. Nature, 325: 783-787.
Moreover, differences in e DNA sequences between individuals affected and unaffected with a disease associated wim the NOVX gene, can be determined. If a mutation is observed in some or all of e affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent of the particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm me presence of a mutation and to distinguish mutations from polymoφhisms.
Tissue Typing
The NOVX sequences of e invention can also be used to identify individuals from minute biological samples. In this technique, an individual's genomic DNA is digested wim one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. The sequences of the invention are useful as additional DNA markers for RFLP ("restriction fragment length polymoφhisms," described in U.S. Patent No.
5,272,057). Furthermore, the sequences of the invention can be used to provide an alternative technique that determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the NOVX sequences described herein can be used to prepare two PCR primers from the 5'- and 3'-termini of the sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.
Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences of the invention can be used to obtain such identification sequences from individuals and from tissue. The NOVX sequences of the invention uniquely represent portions of me human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs wim a frequency of about once per each 500 bases. Much of me allelic variation is due to single nucleotide polymoφhisms (SNPs), which include restriction fragment length polymoφhisms (RFLPs).
Each of the sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification puφoses. Because greater numbers of polymoφhisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers mat each yield a noncoding amplified sequence of 100 bases. If coding sequences, such as those of SEQ ID NO:2«-l, wherein n is an integer between 1 and 141, are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
Predictive Medicine The invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, pharmacogenomics, and monitoring clinical trials are used for prognostic (predictive) puφoses to thereby treat an individual prophylactically. Accordingly, one aspect of the invention relates to diagnostic assays for determining NOVX protein and/or nucleic acid expression as well as NOVX activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to mereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant NOVX expression or activity. The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers. The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. For example, mutations in a NOVX gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive pinpose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with NOVX protein, nucleic acid expression, or biological activity. Another aspect of me invention provides methods for determining NOVX protein, nucleic acid expression or activity in an individual to thereby select appropriate therapeutic or prophylactic agents for mat individual (referred to herein as "pharmacogenomics"). Pharmacogenomics allows for the selection of agents (e.g., drugs) for therapeutic or prophylactic treatment of an individual based on the genotype of the individual (e.g., the genotype of the individual exammed to determine the ability of the individual to respond to a particular agent.)
Yet another aspect of me invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX in clinical trials.
These and other agents are described in forther detail in the following sections. Diagnostic Assays
An exemplary method for detecting the presence or absence of NOVX in a biological sample involves obtaining a biological sample from a test subject and contacting me biological sample with a compound or an agent capable of detecting NOVX protein or nucleic acid (e.g., mRNA, genomic DNA) that encodes NOVX protein such that me presence of NOVX is detected in e biological sample. An agent for detecting NOVX mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to NOVX mRNA or genomic DNA. The nucleic acid probe can be, for example, a foll-length NOVX nucleic acid, such as the nucleic acid of SEQ ID NO:2n-l , wherein n is an integer between 1 and 141, or a portion mereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NOVX mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays of the invention are described herein. An agent for detecting NOVX protein is an antibody capable of binding to NOVX protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i. e. , physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method of the invention can be used to detect NOVX mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of NOVX mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of NOVX protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of NOVX genomic DNA include Southern hybridizations. Furthermore, in vivo techniques for detection of NOVX protein include introducing into a subject a labeled anti-NOVX antibody. For example, me antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.
In another embodiment, me methods forther involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting NOVX protein, mRNA, or genomic DNA, such mat me presence of NOVX protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of NOVX protein, mRNA or genomic DNA in the control sample with the presence of NOVX protein, mRNA or genomic DNA in the test sample.
The invention also encompasses kits for detecting the presence of NOVX in a biological sample. For example, the kit can comprise: a labeled compound or agent capable of detecting NOVX protein or mRNA in a biological sample; means for determining the amount of NOVX in the sample; and means for comparing the amount of NOVX in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can forther comprise instructions for using the kit to detect NOVX protein or nucleic acid.
Prognostic Assays
The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder. Thus, me invention provides a method for identifying a disease or disorder associated wim aberrant NOVX expression or activity in which a test sample is obtained from a subject and NOVX protein or nucleic acid (e.g. , mRNA, genomic DNA) is detected, wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity. As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.
Furthermore, me prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated wim aberrant NOVX expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder. Thus, e invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant NOVX expression or activity in which a test sample is obtained and NOVX protein or nucleic acid is detected (e.g., wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant NOVX expression or activity).
The methods of the invention can also be used to detect genetic lesions in a NOVX gene, thereby determining if a subject with the lesioned gene is at risk for a disorder characterized by aberrant cell proliferation and/or differentiation. In various embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of an alteration affecting the integrity of a gene encoding a NOVX-protein, or the misexpression of the NOVX gene. For example, such genetic lesions can be detected by ascertaining me existence of at least one of: (i) a deletion of one or more nucleotides from a NOVX gene; (ii) an addition of one or more nucleotides to a NOVX gene; (Hi) a substimtion of one or more nucleotides of a NOVX gene, (iv) a chromosomal rearrangement of a NOVX gene; (v) an alteration in the level of a messenger RNA transcript of a NOVX gene, (vi) aberrant modification of a NOVX gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild-type splicing pattern of a messenger RNA transcript of a NOVX gene, (viii) a non-wild-type level of a NOVX protein, (ix) allelic loss of a NOVX gene, and (x) inappropriate post-translational modification of a NOVX protein. As described herein, there are a large number of assay techniques known in the art which can be used for detecting lesions in a NOVX gene. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
In certain embodiments, detection of the lesion involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g, U.S. Patent Nos.4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran, et α , 1988. Science 241: 1077-1080; andNakazawa, et αl, 1994. Proc. Nαtl. Acαd. Sci. USA 91 : 360-364), the latter of which can be particularly useful for detecting point mutations in the NOVX-gene (see, Abravaya, et αl., 1995. Nucl. Acids Res. 23: 675-682). This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, contacting the nucleic acid sample with one or more primers that specifically hybridize to a NOVX gene under conditions such mat hybridization and amplification of me NOVX gene (if present) occurs, and detecting me presence or absence of an amplification product, or detecting e size of the amplification product and comparing me length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein.
Alternative amplification methods include: self sustained sequence replication (see, Guatelli, et αl, 1990. Proc. Nαtl. Acαd. Sci. USA 87: 1874-1878), transcriptional amplification system (see, Kwoh, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 1173-1177); Qβ Replicase (.see, Lizardi, et al, 1988. BioTechnology 6: 1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
In an alternative embodiment, mutations in a NOVX gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, e.g., U.S. Patent No. 5,493,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
In other embodiments, genetic mutations in NOVX can be identified by hybridizing a sample and control nucleic acids, e.g. , DNA or RNA, to high-density arrays containing hundreds or thousands of oligonucleotides probes. See, e.g., Cronin, et al, 1996. Human Mutation 7: 244-255; Kozal, et al, 1996. Nat. Med. 2: 753-759. For example, genetic mutations in NOVX can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, et al, supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to me wild-type gene and the other complementary to the mutant gene.
In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the NOVX gene and detect mutations by comparing me sequence of the sample NOVX with the corresponding wild-type (control) sequence. Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert, 1977. Proc. Natl. Acad. Sci. USA 74: 560 or Sanger, 1977. Proc. Natl. Acad. Sci. USA 74: 5463. It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays (see, e.g., Naeve, et al, 1995. Biotechniques 19: 448), including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101; Cohen, et al, 1996. Adv. Chromatography 36: 127-162; and Griffin, et al, 1993. Appl Biochem. Biotechnol 38: 147-159).
Other methods for detecting mutations in the NOVX gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or
RNA DNA heteroduplexes. See, e.g., Myers, et al, 1985. Science 230: 1242. In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing me wild-type NOVX sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are tieated with an agent that cleaves single-stranded regions of the duplex such as which will exist due to basepair mismatches between the contiol and sample strands. For instance, RNA/DNA duplexes can be treated wim RNase and DNA/DNA hybrids treated with Si nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetioxide and with piperidine in order to digest mismatched regions. After digestion of me mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine me site of mutation. See, e.g., Cotton, etal, 1988. Proc. Natl. Acad. Sci. USA 85: 4397; Saleeba, et al, 1992. Methods Enzymol 217: 286-295. In an embodiment, me control DNA or RNA can be labeled for detection. In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in NOVX cDNAs obtained from samples of cells. For example, me mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches. See, e.g., Hsu, etal, 1994. Carcinogenesis 15: 1657-1662. According to an exemplary embodiment, a probe based on a NOVX sequence, e.g., a wild-type NOVX sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, e.g., U.S. Patent No. 5,459,039. In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in NOVX genes. For example, single strand conformation polymoφhism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids. See, e.g., Orita, etal, 1989. Proc. Natl. Acad. Sci. USA: 86: 2766; Cotton, 1993. Mutat. Res. 285: 125-144; Hayashi, 1992. Genet. Anal. Tech. Appl. 9: 73-79. Single-stranded DNA fragments of sample and control NOVX nucleic acids will be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected wim labeled probes. The sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In one embodiment, the subject, method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on me basis of changes in electrophoretic mobility. See, e.g., Keen, etal, 1991. Trends Genet. 7: 5.
In yet another embodiment, the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE). See, e.g., Myers, etal, 1985. Nature 313: 495. When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting
GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA. See, e.g., Rosenbaum and Reissner, l987. Biophys. Chem. 265: 12753.
Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions that permit hybridization only if a perfect match is found. See, e.g., Saiki, et al, 1986. Nature 32A: 163; Saiki, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 6230. Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when me oligonucleotides are attached to me hybridizing membrane and hybridized wim labeled target DNA.
Alternatively, allele specific amplification technology that depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of e molecule (so at amplification depends on differential hybridization; .see, e.g., Gibbs, et al, 1989. Nuc Acids Res. 17: 2437-2448) or at me extreme 3'-terminus of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (see, e.g., Prossner, 1993. Tibtech. 11 : 238). In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage-based detection. See, e.g., Gasparini, et al, 1992. Mol. Cell Probes 6: 1. It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification. See, e.g., Barany, 1991. Proc. Natl. Acad. Sci. USA 88: 189. In such cases, ligation will occur only if mere is a perfect match at the 3'-terminus of the 5' sequence, making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
The methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a NOVX gene.
Furthermore, any cell type or tissue, preferably peripheral blood leukocytes, in which NOVX is expressed may be utilized in me prognostic assays described herein. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
Pharmacogenomics
Agents, or modulators that have a stimulatory or inhibitory effect on NOVX activity (e.g. , NOVX gene expression), as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders. The disorders include but are not limited to, e.g., those diseases, disorders and conditions listed above, and more particularly include those diseases, disorders, or conditions associated wim homologs of a NOVX protein, such as those summarized in Table A.
In conjunction with such treatment, the pharmacogenomics (i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drug) of the individual may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. Thus, me pharmacogenomics of the individual permits the selection of effective agents (e.g., drugs) for prophylactic or therapeutic treatments based on a consideration of me individual's genotype. Such pharmacogenomics can forther be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of NOVX protein, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual.
Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, 1996. Clin. Exp. Pharmacol. Physiol, 23: 983-985; Linder, 1997. Clin. Chem., 43: 254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare defects or as polymoφhisms. For example, glucose-6-phosphate dehydrogenase (G6PD) deficiency is a common inherited enzymopathy in which the main clinical complication is hemolysis after ingestion of oxidant drugs (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans.
As an illustrative embodiment, me activity of drug metabolizing enzymes is a major determinant of bom the intensity and duration of drug action. The discovery of genetic polymoφhisms of drug metabolizing enzymes (e.g., N-acetyltiansferase 2 (NAT 2) and cytochrome pregnancy zone protein precursor enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drug effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drug. These polymoφhisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations. For example, the gene coding for CYP2D6 is highly polymoφhic and several mutations have been identified in PM, which all lead to me absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drug response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for me analgesic effect of codeine mediated by its CYP2D6-formed metabolite moφhine. At the other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, me molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.
Thus, the activity of NOVX protem, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual. In addition, pharmacogenetic studies can be used to apply genotyping of polymoφhic alleles encoding drug-metabolizing enzymes to the identification of an individual's drug responsiveness phenotype. This knowledge, when applied to dosing or dmg selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with a NOVX modulator, such as a modulator identified by one of the exemplary screening assays described herein.
Monitoring of Effects During Clinical Trials
Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX (e.g., the ability to modulate aberrant cell proliferation and/or differentiation) can be applied not only in basic drug screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase NOVX gene expression, protein levels, or upregulate NOVX activity, can be monitored in clinical trails of subjects exhibiting decreased NOVX gene expression, protein levels, or downregulated NOVX activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease NOVX gene expression, protein levels, or downregulate NOVX activity, can be monitored in clinical trails of subjects exhibiting increased NOVX gene expression, protein levels, or upregulatedNOVX activity. In such clinical trials, the expression or activity of NOVX and, preferably, omer genes that have been implicated in, for example, a cellular proliferation or immune disorder can be used as a "read out" or markers of me immune responsiveness of a particular cell.
By way of example, and not of limitation, genes, including NOVX, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) mat modulates NOVX activity (e.g., identified in a screening assay as described herein) can be identified. Thus, to study the effect of agents on cellular proliferation disorders, for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of NOVX and other genes implicated in me disorder. The levels of gene expression (i.e., a gene expression pattern) can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one of the methods as described herein, or by measuring the levels of activity of NOVX or omer genes. In this manner, the gene expression pattern can serve as a marker, indicative of the physiological response of the cells to me agent. Accordingly, this response state may be determined before, and at various points during, treatment of the individual with the agent. In one embodiment, the invention provides a method for monitoring e effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, protein, peptide, peptidomimetic, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample from a subject prior to administiation of the agent; (ii) detecting the level of expression of a NOVX protein, mRNA, or genomic DNA in the preadministration sample; (Hi) obtaining one or more post-administration samples from the subject; (zv) detecting the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the pre-administration sample with the NOVX protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly. For example, increased administration of the agent may be desirable to increase me expression or activity of NOVX to higher levels than detected, i.e., to increase the effectiveness of the agent. Alternatively, decreased administration of me agent may be desirable to decrease expression or activity of NOVX to lower levels than detected, i.e., to decrease the effectiveness of the agent.
Methods of Treatment
The invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant NOVX expression or activity. The disorders include but are not limited to, e.g., those diseases, disorders and conditions listed above, and more particularly include those diseases, disorders, or conditions associated with homologs of a NOVX protein, such as those summarized in Table A.
These methods of treatment will be discussed more folly, below. Diseases and Disorders
Diseases and disorders that are characterized by increased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that antagonize (i.e., reduce or inhibit) activity. Therapeutics that antagonize activity may be administered in a therapeutic or prophylactic manner. Therapeutics mat may be utilized include, but are not limited to: (i) an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; (ii) antibodies to an aforementioned peptide; (Hi) nucleic acids encoding an aforementioned peptide; (iv) administration of antisense nucleic acid and nucleic acids that are "dysfunctional" (i.e., due to a heterologous insertion within the coding sequences of coding sequences to an aforementioned peptide) that are utilized to "knockout" endogenous function of an aforementioned peptide by homologous recombination (see, e.g., Capecchi, 1989. Science 244: 1288-1292); or (v) modulators ( i.e., inhibitors, agonists and antagonists, including additional peptide mimetic of e invention or antibodies specific to a peptide of the invention) that alter the interaction between an aforementioned peptide and its binding partner.
Diseases and disorders mat are characterized by decreased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics mat increase (i.e., are agonists to) activity. Therapeutics that upregulate activity may be admimstered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to, an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; or an agonist mat increases bioavailability.
Increased or decreased levels can be readily detected by quantifying peptide and/or RNA, by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for RNA or peptide levels, structure and/or activity of the expressed peptides (or mRNAs of an aforementioned peptide). Methods that are well-known within the art include, but are not limited to, immunoassays (e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).
Prophylactic Methods
In one aspect, the invention provides a method for preventing, in a subject, a disease or condition associated with an aberrant NOVX expression or activity, by administering to the subject an agent that modulates NOVX expression or at least one NOVX activity.
Subjects at risk for a disease that is caused or contributed to by aberrant NOVX expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the NOVX aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression. Depending upon me type of NOVX aberrancy, for example, a NOVX agonist or NOVX antagonist agent can be used for treating e subject. The appropriate agent can be determined based on screening assays described herein. The prophylactic methods of the invention are further discussed in the following subsections.
Therapeutic Methods
Another aspect of e invention pertains to methods of modulating NOVX expression or activity for therapeutic puφoses. The modulatory method of the invention involves contacting a cell with an agent mat modulates one or more of the activities of NOVX protein activity associated with e cell. An agent that modulates NOVX protein activity can be an agent as described herein, such as a nucleic acid or a protem, a naturally-occurring cognate ligand of a NOVX protein, a peptide, a NOVX peptidomimetic, or other small molecule. In one embodiment, the agent stimulates one or more NOVX protein activity. Examples of such stimulatory agents include active NOVX protein and a nucleic acid molecule encoding NOVX that has been introduced into me cell. In another embodiment, the agent inhibits one or more NOVX protein activity. Examples of such inhibitory agents include antisense NOVX nucleic acid molecules and anti-NOVX antibodies. These modulatory methods can be performed in vitro (e.g., by culturing me cell with me agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of a NOVX protein or nucleic acid molecule. In one embodiment, e method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., up-regulates or down-regulates)
NOVX expression or activity. In anomer embodiment, the method involves administering a NOVX protein or nucleic acid molecule as therapy to compensate for reduced or aberrant NOVX expression or activity.
Stimulation of NOVX activity is desirable in -stations in which NOVX is abnormally downregulated and/or in which mcreased NOVX activity is likely to have a beneficial effect. One example of such a situation is where a subject has a disorder characterized by aberrant cell proliferation and/or differentiation (e.g., cancer or immune associated disorders). Another example of such a situation is where the subject has a gestational disease (e.g., preclampsia). Determination of the Biological Effect of the Therapeutic
In various embodiments of the invention, suitable in vitro or in vivo assays are performed to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue. In various specific embodiments, in vitro assays may be performed with representative cells of me type(s) involved in the patient's disorder, to determine if a given Therapeutic exerts the desired effect upon the cell type(s). Compounds for use in therapy may be tested in suitable animal model systems including, but not limited to rats, mice, chicken, cows, monkeys, rabbits, and me like, prior to testing in human subjects. Similarly, for in vivo testing, any of the animal model system known in the art may be used prior to administration to human subjects.
Prophylactic and Therapeutic Uses of the Compositions of the Invention
The NOVX nucleic acids and proteins of the invention are useful in potential prophylactic and therapeutic applications implicated in a variety of disorders. The disorders include but are not limited to, e.g., those diseases, disorders and conditions listed above, and more particularly include those diseases, disorders, or conditions associated with homologs of a NOVX protein, such as those summarized in Table A.
As an example, a cDNA encoding the NOVX protein of the invention may be useful in gene merapy, and me protein may be useful when administered to a subject in need thereof. By way of non-limiting example, the compositions of the invention will have efficacy for treatment of patients suffering from diseases, disorders, conditions and the like, including but not limited to those listed herein.
Bom the novel nucleic acid encoding the NOVX protein, and the NOVX protein of the invention, or fragments mereof, may also be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. A forther use could be as an anti-bacterial molecule (i.e., some peptides have been found to possess anti-bacterial properties). These materials are forther useful in me generation of antibodies, which immunospecifically-bind to the novel substances of the invention for use in therapeutic or diagnostic methods. The invention will be forther described in me following examples, which do not limit the scope of me invention described in me claims. EXAMPLES
Example A: Polynucleotide and Polypeptide Sequences, and Homology Data
Example 1.
The NOVl clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 1A.
Sequence comparison of me above protein sequences yields e following sequence relationships shown in Table IB.
Table IB. Comparison of NOVla against NOVlb.
Protein Sequence NOVla Residues/ Identities/ Match Residues Similarities for the Matched Region
NOVlb 5..256 249/257 (96%) 1..257 251/257 (96%)
Further analysis of the NOVl a protein yielded the following properties shown in
Table lC.
Table lC. Protein Sequence Properties NOVla
PSort 0.8705 probability located in itochondrial inner membrane; analysis ; 0.6000 probability located in plasma membrane; 0.4983 probability located in mitochondrial intermembrane space; 0.4000 probability located in Golgi body
SignalP Cleavage site between residues 32 and 33 analysis :
A search of the NOVla protein against the Geneseq database, a proprietary database at contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table ID.
AA017719 Human unitz type protease 5..256 250/252 (99%) e-148 inhibitor bikunin - Homo 1..252 251/252 (99%) sapiens, 252 aa. [W09957274- Al, ll-NOV-1999]
AAB14187 Human placental bikunin 5. .256 250/252 (99%) e-148 protein # 5 - Homo sapiens, 1..252 251/252 (99%) 252 aa. [WO200037099-A2, 29- JUN-2000]
AAW70286 Human tissue factor pathway 5. .256 250/252 (99%) e-148 inhibitor-3 (TFPI-3) - Homo 1..252 251/252 (99%) sapiens, 252 aa. [ O9833920- A2, 06-AUG-1998]
In a BLAST search of public sequence datbases, the NOVla protein was found to have homology to me proteins shown in the BLASTP data in Table IE.
PFam analysis predicts that the NOVla protein contains the domains shown in the Table IF.
Table IF. Domain Analysis of NOVla
Pfam Domain j NOVla Match Region j Identities/ Expect Value
Example 2.
The NOV2 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 2A.
Sequence comparison of e above protein sequences yields the following sequence relationships shown in Table 2B.
Table 2B. Comparison of NOV2a against NOV2b.
N0V2a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
N0V2b 1..267 239/267 (89%)
1..239 239/267 (89%)
Further analysis of the NOV2a protein yielded me following properties shown in Table 2C.
Table 2C. Protein Sequence Properties NOV2a
PSort 0. 6400 probability located in plasma membrane ; 0.4600 analysis : probability located in Golgi body; 0 .3700 probability located in endoplas ic reticulum (membrane) ; 0 . 1000 probability located in endoplasmic reticulum (lumen)
SignalP Cleavage site between residues 37 and 38 analysis :
A search of the NOV2a protein agamst the Geneseq database, a proprietary database at contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 2D.
In a BLAST search of public sequence datbases, the NOV2a protein was found to have homology to me proteins shown in the BLASTP data in Table 2E.
PFam analysis predicts that the N0V2a protein contains the domains shown in the Table 2F.
Table 2F. Domain Analysis of NO 2a
Identities/
Pfam Domain NOV2a Match Region Similarities Expect Value for the Matched Region transmembrane4 10..256 102/270 (38%) 2 .6e-96 221/270 (82%)
Example 3.
The NON3 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 3 A.
Table 3A. ΝO 3 Sequence Analysis
SEQ ID NO: 9 486 bp
NOV3a, ATGGCAAAAGAGGAGCCCCAGAGTATCTCAAGGGACTTGCAGGAACTGCAGAAGAAGC
CG151575-01 DNA TGTCTCTGCTGATAGACTCCTTCCAGAATAACTCAAAGGTGGTGGCCTTTATGAAGTC Sequence TCCAGTGGGTCAGTACTTGGACAGCCATCCGTTTCTGGCCTTCACCTTGCTGGTGTTC ATTGTCATGTCGGCCGTTCCTGTTGGATTCTTCCTGCTCATCGTGGTGCTTACCACCC TGGCTGCTCTGCTGGGGGTCATAATATTGGAAGGATTGGTCATCTCTGTGGGTGGCTT CTCACTGCTCTGCATCCTCTGTGGTTTGGGCTTCGTATCACTCGCCATGTCGGGGATG ATGATAGCATCTTATGTAGTGGTCTCCAGCCTCATCAGCTGCTGGTTTTCTCCCAGGC CACTGACACAGCAAAACACCAGTTGTGACTTTCTGCCAGCCATGAAGTCTGCAGACTT CGAGGGGCTTTACCAGGAATGA
ORF Start: ATG at 1 ORF Stop: TGA at 484
NOV3a, MAEEPQSISRDLQELQKKLSLLIDSFQNNSK AFMKSPVGQYLDSHPFLAFTLLvF CG151575-01 IvMSAVPVGFFLLIWIiTTLAALLGVIILEGLVISVGGFSLLCILCGLGFVSLAMSGM Protein Sequence MIASYV SSLISC FSPRPLTQQNTSCDFLPAMKSADFEGLYQE
SEQ ID NO: 11 760 bp
NOV3b, GGCTCCCTCTCGGGACGCTCTTTCCTTCTTCCTCTTGTTCCTCCTCCTGCCTCTCTTC
CG151575-02 DNA GCTTCGCCTGCAAACGCGGTGGGGGCTGCTCGGCGGTCAGGAGCAGCAAGAGACAGAG Sequence CGACATGAGAGATTGGACCGCGGGCTGCACTGGAGAATTTACTGGTAGGATAATTCAT
CCCTAAAGAGATTGAAGTGAGCTTCAGAATGGCAAAAGAGGAGCCCCAGAGTATCTCA
AGGGACTTGCAGGAACTGCAGAAGAAGCTGTCTCTGCTGATAGACTCCTTCCAGAATA ACTCAAAGCTGCCCCAACACAGCAGGATCTCACTGGACTCTGATGATGGAGTGTCCAG GCTGGGCAGTGCTGGCTCCAAGGTGGTGGCCTTTATGAAGTCTCCAGTGGGTCAGTAC TTGGACAGCCATCCGTTTCTGGCCTTCACCTTGCTGGTGTTCATTGTCATGTCGGCCG TTCCTGTTGGATTCTTCCTGCTCATCGTGGTGCTTACCACCCTGGCTGCTCTGCTGGG GGTCATAATATTGGAAGGATTGGTCATCTCTGTGGGTGGCTTCTCACTGCTCTGCATC CTCTGTGGTTTGGGCTTCGTATCACTCGCCATGTCGGGGATGATGATAGCATCTTATG TAGTGGTCTCCAGCCTCATCAGCTGCTGGTTTTCTCCCAGGCCACTGACACAGCAAAA CACCAGTTGTGACTTTCTGCCAGCCATGAAGTCTGCAGACTTCGAGGGGCTTTACCAG GAATGA
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 3B.
Table 3B. Comparison of NOV3a against NOV3b.
NOV3a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
N0V3b 1..161 161/185 (87%) 1..185 161/185 (87%)
Further analysis of me NOV3a protein yielded me following properties shown in Table 3C.
Table 3C. Protein Sequence Properties NO 3a
PSort 0 .6000 probability located in plasma membrane; 0.4000 analysis : probability located in Golgi body; 0 .3000 probability located in endoplasmic reticulum (membrane) ; 0 .0300 probability located in mitochondrial inner membrane
SignalP Cleavage site between residues 69 and 70 analysis :
A search of e NOV3a protein agamst me Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 3D.
In a BLAST search of public sequence datbases, the NOV3a protein was found to have homology to the proteins shown in me BLASTP data in Table 3E.
PFam analysis predicts that the NOV3a protein contains the domains shown in the Table 3F.
Table 3F. Domain Analysis of NOV3a
Pfam Domain NOV3a Match Region Identities/ Expect Value
Example 4.
The NOV4 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 4A.
Table 4A. NOV4 Sequence Analysis
SEQ ID NO: 13 1088 bp
NOV4a, GTGAGTTTACCCCTATGAGACTGTGAGAGGCCCGGGGCCTACCTCAAAGGAGCGGGGT
CG151608-01 DNA CGCGAAGCTAGCTAGCAGCGGCCCCCCTCCAGGTCCCCGGGCCCGGCGGCGCGGCGGC Sequence GGCTTGGTTGTGAAGAGGCGGGGAAGCGGGTGTCCGGTCCCCGCCATGGAGGGCATGG
ACGTAGACCTGGACCCGGAGCTGATGCAGAAGTTCAGCTGCCTGGGCACCACCGACAA GGACGTGCTCATCTCCGAGTTCCAGAGGCTGCTCGGCTTCCAGCTCAATCCTGCCGGT TGCGCCTTCTTCCTGGACATGACCAACTGGAACCTACAAGCAGCAATTGGCGCCTATT ATGACTTTGAGAGCCCAAACATCAGTGTGCCCTCTATGTCCTTTGTTGAAGATGTCAC CATAGGAGAAGGGGAGTCAATACCTCCGGATACTCAGTTTGTAAAAACATGGCGGATC CAGAATTCTGGGGCAGAGGCCTGGCCTCCAGGGGTTTGTCTTAAATATGTCGGGGGAG ACCAATTTGGACATGTGAACATGGTGATGGTGAGATCGCTAGAGCCCCAAGAGATTGC AGATGTCAGCGTCCAGATGTGCAGCCCCAGCAGAGCAGGAATGTATCAGGGACAGTGG CGGATGTGCACTGCTACAGGACTCTACTATGGAGATGTCATCTGGGTGATTCTCAGTG TGGAGGTGGGTGGACTTTTAGGAGTAACGCAGCAGCTGTCATCTTTTGAAACGGAGTT CAACACACAGCCGCATCGTAAGGTAGAAGGAAACTTCAACCCTTTTGCCTCTCCCCAA AAGAACCGACAATCAGATGAAAACAACTTAAAAGACCCTGGGGGCTCCGAGTTCGACT CGATCAGCAAAAACACATGGGCTCCTGCTCCTGACACATGGGCTCCTGCTCCTGACCA AACTGAGCAAGACCAGAATAGACTGTCACAGAACTCTGTAAATCTGTCTCCCAGCAGT CACGCAAACAACTTATCAGTAGTGACTTACAGTAAGGGGCTCCATGGGCCTTACCCCT TCGGCCAGTCTTAAACGGGTGTCAGCAAAAAAAAAAAAAAAAAA
[ORF Start: ATG at 162 ORF Stop: TAA at 1056
NOV4a, MEGMDVDLDPE MQKFSCLGTTDKDVLISEFQRLLGFQ NPAGCAFFLDMTN NLQAA CG151608-01 IGAYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKT RIQNSGAEAWPPGVC K Protein Sequence YVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVI VILSVEVGGLLGVTQQ SSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENN KDPGG SEFDSISKNTWAPAPDTWAPAPDQTEQDQNR SQNSVNLSPSSHANNLSWTYSKGLH GPYPFGQS
SEQ ID NO: 15 735 bp
N0V4b, AGGCGGGGAAGCGGGTGTCCGGTCCCCGCCATGGAGGGCATGGACGTAGACCTGGACC
CG151608-02 DNA CGGAGCTGATGCAGAAGTTCAGCTGCCTGGGCACCACCGACAAGGACGTGCTCATCTC Sequence CGAGTTCCAGAGGCTGCTCGGCTTCCAGCTCAATCCTGCCGGTTGCGCCTTCTTCCTG GACATGACCAACTGGAACCTACAAGCAGCAATTGGCGCCTATTATGACTTTGAGAGCC CAAACATCAGTGTGCCCTCTATGTCCTTTGTTGAAGATGTCACCATAGGAGAAGGGGA GTCAATACCTCCGGATACTCAGTTTGTAAAAACATGGCGGATCCAGAATTCTGATGTC ATCTGGGTGATTCTCAGTGTGGAGGTGGGTGGACTTTTAGGAGTAACGCAGCAGCTGT CATCTTTTGAAACGGAGTTCAACACACAGCCGCATCGTAAGGTAGAAGGAAACTTCAA CCCTTTTGCCTCTCCCCAAAAGAACCGACAATCAGATGAAAACAACTTAAAAGACCCT GGGGGCTCCGAGTTCGACTCGATCAGCAAAAACACATGGGCTCCTGCTCCTGACACAT GGGCTCCTGCTCCTGACCAAACTGAGCAAGACCAGAATAGACTGTCACAGAACTCTGT AAATCTGTCTCCCAGCAGTCACGCAAACAACTTATCAGTAGTGACTTACAGTAAGGGG
Sequence comparison of me above protein sequences yields the following sequence relationships shown in Table 4B.
Table 4B. Comparison of NOV4a against NOV4b.
NOV4a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
N0V4b 171..298 128/128 (100%) 105..232 128/128 (100%)
Further analysis of the NOV4a protein yielded the following properties shown in Table 4C.
Table 4C. Protein Sequence Properties NOV4a
PSort 0 .7000 probability located in plasma membrane ; 0 .3389 analysis : probability located in microbody (peroxisome) ; 0.2000 probability located in endoplasmic reticulum (membrane) ; 0 . 1000 probability located in mitochondrial inner membrane
SignalP No Known Signal Sequence Predicted analysis :
A search of the NOV4a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 4D.
In a BLAST search of public sequence datbases, the NOV4a protein was found to have homology to the proteins shown in the BLASTP data in Table 4E.
PFam analysis predicts that the N0V4a protein contains the domains shown in the Table 4F.
Table 4F. Domain Analysis of NOV4a
Identities/
Pfam Domain I NOV4a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 5.
The N0V5 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 5A.
CCCAAGACTCTACAGTCAAAGCCTCAGTCTTTTGCCTTACCAGCGGCTACGAGAATCA TGCTGCTTCCCACACCCATCTGTTTAGAACCAGATGTACAATATTCCATAGATGTCTA TTTTTCTCAGCCTTTGCAAGGAGAGTCCCACGCTCATTCACATGTCCTGGTGGACTCT CTTGGCCTTATTCCCCAAATCAATTCATTGGAGAATTTCTGCAGCAAGCAGGACTTAG ATGAGTATCAGCTTCACAACTGTGTTGAAATTGCCTCAGCAATGGGACCTCAAGTGCT CCCGGGTGCCTGTGAAAGGCTGATCATCAGCATGTCTGCCAAGCTGCATGATGGGGCT GTGGCCTGCAAGTGTCACCCCCAGGGCTCAGTCGGATCCAGCTGCAGCCGACTTGGAG GCCAGTGCCAGTGTAAACCTCTTGTGGTCGGGCGCTGCTGTGACAGGTGCTCAACTGG AAGCTATGATTTGGGGCATCACGGCTGTCACCCATGTCACTGCCATCCTCAAGGATCA AAGGACACTGTATGTGACCAAGTAACAGGACAGTGCCCCTGCCATGGAGAGGTGTCTG GCCGCCGCTGTGATCGCTGCCTGGCAGGCTACTTTGGATTTCCCAGCTGCCACCCTTG CCCTTGTAATAGGTTTGCTGAACTTTGTGATCCTGAGACAGGGTCATGCTTCAATTGT GGAGGCTTTACAACTGGCAGAAACTGTGAAAGGTGTATTGATGGTTACTATGGAAATC CTTCTTCAGGACAGCCCTGTCGTCCTTGCCTGTGTCCAGATGATCCCTCAAGCAATCA GTATTTTGCCCATTCCTGTTATCAGAATCTGTGGAGCTCAGATGTAATCTGCAATTGT CTTCAAGGTTATACGGGTACTCAGTGTGGAGAATGCTCTACTGGTTTCTATGGAAATC CAAGAATTTCAGGAGCACCTTGCCAACCATGTGCCTGCAACAACAACATAGATGTAAC CGATCCAGAGTCCTGCAGCCGGGTAACAGGGGAGTGCCTTCGATGTTTGCACAACACT CAGGGCGCAAACTGCCAGCTCTGCAAACCAGGTCACTATGGATCAGCCCTCAATCAGA CCTGCAGAAGATGCTCCTGCCATGCTTCCGGCGTGAGTCCCATGGAGTGTCCCCCTGG TGGGGGAGCTTGCCTCTGTGACCCTGTCACTGGTGCATGTCCTTGTCTGCCGAATGTC ACAGGCCTGGCCTGTGACCGTTGTGCTGATGGATACTGGAATCTGGTCCCTGGCAGAG GATGTCAGTCATGTGACTGTGACCCTAGGACCTCTCAAAGTAGCCACTGTGACCAGGC AAGATACTTTAAAGCTTACTAGTGCACTCAAAGTGAGCATGATAGTGAGACATGGTTT
CTAAATGTGTAAAGAAAGTTTCTTTTATGTACTGTTGTTAATTAGTGCATTGAAACAG
GGGTGGCCTTACAGGGGATGGAGTCAGCCTCTATCAAGGAATGAAAACCAAAAAAAGA
GAATGA
ORF Start: ATG at 81 ORF Stop: TAG at 3384
SEQ ID NO: 18 1101 aa MW at 119568.2kD
N0V5a, MQFQLT F HLGW SYSKAQDDCNRGACHPTTGDLLVGRNTQ MASSTCG SRAQKYC CG152323-01 ILSYLEGEQKCSICDSRFPYDPYDQPNSHTIENVTVSFEPDREKKWWQSENG DHVSI Protein Sequence RLDLEALFRFSHLI TFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQ AQGVGDIVCDSKYSDIEPSTGGEWLKV DPSFEIENPYSPYIQDLVTLTNLRINFTK LHTLGDAL GRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGM VHGQCVCQHNTDGPNCERCKDFFQDAPWRPAAD QDNACRSCSCNSHSSRCHFDMTTY LASGGLSGGVCEDCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGG ICVSHSDPALGSVAGQCLCKENVEGAKCDQCKPNHYG SATDP GCQPCDCNPLGS P FLTCDVDTGQCLCLSYVTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKN GQCECRPHVTGRSCSEPAPGYFFAPLNFYLYEAEEATTLQGLAP GSETFGQSPAVHV VLGEPVPGNPVTWTGPGFARVLPGAG RFAVN IPFPVDFTIAIHYETQSAADWTVQI WNPPGGSEHCIPKTLQSKPQSFALPAATRIMLLPTPIC EPDVQYSIDVYFSQP QG ESHAHSHVLVDSLG IPQINSLENFCSKQDLDEYQ HNCVEIASAMGPQVLPGACERL 11SMSAKHDGAVACKCHPQGSVGSSCSRLGGQCQCKPLWGRCCDRCSTGSYDLGHH GCHPCHCHPQGSKDTVCDQVTGQCPCHGEVSGRRCDRCLAGYFGFPSCHPCPCNRFAE LCDPETGSCFNCGGFTTGRNCERCIDGYYGNPSSGQPCRPCLCPDDPSSNQYFAHSCY QNLWSSDVICNCLQGYTGTQCGECSTGFYGNPRISGAPCQPCACNNNIDVTDPESCSR VTGECLRCLHNTQGANCQLCKPGHYGSANQTCRRCSCHASGVSPMECPPGGGACLCD PVTGACPC PNVTGLACDRCADGYWNLVPGRGCQSCDCDPRTSQSSHCDQARYFKAY
Further analysis of the NOV5a protein yielded the following properties shown in Table 5B.
Table 5B. Protein Sequence Properties NOV5a
PSort 0.4500 probability located in cytoplasm; 0.3000 probability analysis : located in microbody (peroxisome) ; 0 . 1000 probability located in mitochondrial matrix space ; 0 . 1000 probability located im lysosome (lumen)
SignalP Cleavage site between residues 20 and 21 analysis :
A search of the NOV5a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 5C.
In a BLAST search of public sequence datbases, the NOV5a protein was found to have homology to the proteins shown in the BLASTP data in Table 5D.
Table 5D. Public BLASTP Results for NOV5a
NOV5a Identities/
Protein Residues/ Similarities for Expect
Accession Protein/Organism/Length Match the Matched Value
Number Residues Portion
Q9Y6U6 WUGSC:H_RG015P03.1 protein 23..1093 1059/1071 (98%) 0.0 - Homo sapiens (Human) , 1..1069 1061/1071 (98%) 1631 aa (fragment) .
PFam analysis predicts mat the NOV5a protein contains the domains shown in the Table 5E.
Example 6.
The NOV6 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 6A.
CG153011-01 NSQS QKGKQTHPSSHGGSKEKCRERR SLIKPSDLMRTHSLSQEQHGGFDDLQVCAD Protein Sequence PGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSIC VQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGT NNLP ICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLI SSS PPRCLALEAQVCPLPPMVSHGDFVCHPRPCERYNHGTWEFYCDPGYSLTSDYKYITC QYGEWFPSYQVYCIKSEQT PSTHETLLTT KIVAFTATSVLLVLLLVILARMFQTKF KAHFPPRGPPRSSSSDPDFWvDGVP MLPSYDEAVSGGLSALGPGYMASVGQGCPLP VDDQSPPAYPGSGDTDTGPGESETCDSVSGSSELLQSLYSPPRCQESTHPTSDNPDII ASTAEEVASTSPGIDIADEIPLMEEDP
Further analysis of the NOV6a protem yielded the following properties shown in Table 6B.
Table 6B. Protein Sequence Properties NOV6a
PSort 0 .8000 probability located in mitochondrial inner membrane ; analysis 0. 7000 probability located in plasma membrane ; 0.2000 probability located in endoplasmic reticulum (membrane) ; 0 .0646 probability located in microbody (peroxisome)
SignalP No Known Signal Sequence Predicted analysis
A search of the NOV6a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 6C.
In a BLAST search of public sequence datbases, the NOV6a protein was found to have homology to the proteins shown in the BLASTP data in Table 6D.
PFam analysis predicts at the NOV6a protein contains the domains shown in the Table 6E.
Example 7.
The NOV7 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 7A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 7B.
Further analysis of the NOV7a protein yielded the following properties shown in Table 7C.
Table 7C. Protein Sequence Properties NOV7a
PSort 0 . 6500 probability located in plasma membrane ; 0 .4763 analysis : probability located in mitochondrial matrix space ; 0 .4500 probability located in cytoplasm; 0.2150 probability located in lysosome (lumen)
Signal P Cleavage site between residues 12 and 13 analysis :
A search of the NOV7a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 7D.
In a BLAST search of public sequence datbases, the NOV7a protein was found to have homology to the proteins shown in the BLASTP data in Table 7E.
PFam analysis predicts mat the N0V7a protein contains the domains shown in the Table 7F.
Table 7F. Domain Analysis of NOV7a
Identities/
Pfa Domain NOV7a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 8.
The NOV8 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 8A.
Table 8A. NOV8 Sequence Analysis
SEQ ID NO: 25
NOV8a, GAACCAGTAGCCGCGGCTGCTTCTGTTGCCGCGGTCGGTGGTCGTTATGGATTCTCCA
CG153179-01 DNA TGGGACGAGTTGGCTCTGGCCTTCTCCCGCACGTCCATGTTTCCCTTTTTTGACATCG Sequence CGCACTATCTAGTGTCAGTGATGGCGGTGAAACGTCAGCCGGGAGCAGCTGCATTGGC ATGGAAGAATCCTATTTCAAGCTGGTTTACTGCTATGCTCCACTGTTTTGGTGGAGGA ATTTTATCCTGTCTACTGCTTGCAGAGCCTCCATTGAAGTTTCTTGCAAACCACACTA ACATATTACTGGCATCTTCAATCTGGTATATTACATTTTTTTGCCCGCATGACCTAGT TTCCCAGGGCTATTCATATCTACCTGTTCAACTACTGGCTTCGGGAATGAAGGAAGTG ACCAGAACTTGGAAAATAGTAGGTGGAGTCACACATGCTAATAGCTATTACAAAAATG GCTGGATAGTCATGATAGCTATTGGATGGGCCCGAGGTGCGGGTGGTACCATTATAAC GAATTTTGAGAGGTTGGTAAAAGGAGATTGGAAACCAGAAGGTGATGAATGGCTGAAG ACGTCATATTTTAGGGTACATGTGCAGAACGTGCAGGTTTGTTACATATGTATACATG TGCCATGTTGGTGTGCTACACCCATTAACTCGTCATTTAACATTAGCCCTGCCAAGGT AACCCTGCTGGGGTCAGTTATCTTCACATTCCAGCACACCCAGCATCTGGCAATATCA AAGCATAATCTTATGTTCCTTTATACCATCTTTATTGTGGCCACAAAGATAACCATGA TGACTACACAGACTTCTACTATGACATTTGCTCCTTTTGAGGATACATTGAGTTGGAT GCTATTTGGCTGGCAGCAGCCGTTTTCATCATGTGAGAAGAAAAGTGAAGCAAAGTCA CCTTCCAATGGCGTTGGGTCATTGGCCTCAAAGCCGGTAGATGTTGCCTCAGATAATG TTAAAAAGAAACATACTAAGAAGAATGAATAATTTACGTGATGAGCTCTACAAGGCCA AAAATTT
ORF Start: ATG at 47 ORF Stop: TAA at 1016
N0V8a, MDSPWDELALAFSRTSMFPFFDIAHYLVSVMAVKRQPGAAALAWKNPISSWFTAMLHC CG153179-01 FGGGILSCLLLAEPPLKFLANHTNILLASSIWYITFFCPHDLVSQGYSYLPVQLLASG Protein Sequence MKEVTRTWKIVGGVTHANSYYKNGWIVMIAIGWARGAGGTII NFERLVKGD KPEGD EWLKTSYFRVHVQNVQVCYICIHVPCWCATPINSSFNISPAKVTLLGSVIFTFQHTQH LAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLS MLFG QQPFSSCEK S EAKSPSNGVGSLASKPVDVASDNVKKKHTKNE Further analysis of the NOV8a protein yielded the following properties shown in Table 8B.
Table 8B. Protein Sequence Properties NOV8a
PSort 0 .6000 probability located in plasma membrane ; 0 .4000 analysis : probability located in Golgi body; 0.3000 probability located in endoplasmic reticulum (membrane) ; 0.2397 probability located in mitochondrial inner membrane
SignalP Cleavage site between residues 1 and 2 analysis :
A search of the NOV8a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 8C.
In a BLAST search of public sequence datbases, the NOV8a protein was found to have homology to the proteins shown in me BLASTP data in Table 8D.
Table 8D. Public BLASTP Results for NOV8a
Protein NOV8a Identities/ n Protein/Organism/Length Expect
Accessio Residues/ Similarities Value
Number Match for the
PFam analysis predicts that the NOV8a protein contains the domains shown in the Table 8E.
Table 8E. Domain Analysis of NOV8a
Identities/
Pfam Domain } NOV8a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 9.
The NOV9 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 9A.
CGTCATTTTTGGACGAAAATTTGTAAGCCAGTCCTTTTGGAGGGACAGGTCTGCTCCA GAAGAGGGCATAAAGACACTGCTCAAGCTCCAGAAATCTTCCAGCGTTGCGACTGTGG CCCTGGACTACTGTGTCGAAGCCAATTGACCAGCAATCGGCAGCATGCTCGATTAAGA GTATGCCAAAAAATAGAAAAGCTATAGATATTTCAAAATAAAGAAGAATCCACATGCA AAGGCGATTCA
ORF Start: ATG at 107 ORF Stop: TAG at 779
SEQ ID NO: 28 224 aa MW at 24864.3kD
NOV9a, MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRD CG153403-01 E PFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTT Protein Sequence GHPVQESQi-KRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQ VCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
SEQ ID NO: 29 630 bp
NOV9b, TGGAGAGCAGCCTCGCTTTGGTGACGCACAGTGCTGGGACCCTCCAGGAGCCCCGGGA
CG153403-02 DNA ATTGAAGGATGGTGGCGGCCGTCCTGCTGGGGCTGAGCTGGCTCTGCTCTCCCCTGGG Sequence AGCTCTGGTCCTGGACTTCAACAACATCAGGAGCTCTGCTGACCTGCATGGGGCCCGG AAGGGCTCACAGTGCCTGTCTGACACGGACTGCAATACCAGAAAGTTCTGCCTCCAGC CCCGCGATGAGAAGCCGTTCTGTGCTACATGTCGTGGGTTGCGGAGGAGGTGCCAGCG AGACGCCATGTGCTGCCCTGGGACACTCTGTGTGAACGGACAAGAGGGAGAAAGTTGT CTGAGAACTTTTGACTGTGGCCCTGGACTTTGCTGTGCTCGTCATTTTTGGACGAAAA TTTGTAAGCCAGTCCTTTTGGAGGGACAGGTCTGCTCCAGAAGAGGGCATAAAGACAC TGCTCAAGCTCCAGAAATCTTCCAGCGTTGCGACTGTGGCCCTGGACTACTGTGTCGA AGCCAATTGGCCAGCAATCGGCAGCATGCTCGATTAAGAGTATGCCAAAAAATAGAAA AGCTATAAATATTTCAAAATAAAGAAGATCCACATGCAAAGGCGATTCCA iORF Start: ATG at 67 jORF Stop: TAA at 586
SEQ ID NO: 30 173 aa MW at 19176. lkD
NOV9b, MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRD CG153403-02 EKPFCATCRGLRRRCQRDAMCCPGTLCVNGQEGESCLRTFDCGPGLCCARHFWTKICK Protein Sequence PVLLEGQVCSRRGHKDTAQAPEI QRCDCGPGLLCRSQLASNRQHARLRVCQKIEKL
SEQ ID NO: 31 484 bp
NOV9c, CACCGGATCCCTGGTCCTGGACTTCAACAACATCAGGAGCTCTGCTGACCTGCATGGG
305037558 DNA GCCCGGAAGGGCTCACAGTGCCTGTCTGACACGGACTGCAATACCAGAAAGTTCTGCC
Sequence TCCAGCCCCGCGATGAGAAGCCGTTCTGTGCTACATGTCGTGGGTTGCGGAGGAGGTG CCAGCGAGACGCCATGTGCTGCCCTGGGACACTCTGTGTGAACGGACAAGAGGGAGAA AGTTGTCTGAGAACTTTTGACTGTGGCCCTGGACTTTGCTGTGCTCGTCATTTTTGGA CGAAAATTTGTAAGCCAGTCCTTTTGGAGGGACAGGTCTGCTCCAGAAGAGGGCATAA AGACACTGCTCAAGCTCCAGAAATCTTCCAGCGTTGCGACTGTGGCCCTGGACTACTG TGTCGAAGCCAATTGGCCAGCAATCGGCAGCATGCTCGATTAAGAGTATGCCAAAAAA TAGAAAAGCTACTCGAGGGC iORF Start: at 2 ORF Stop: end of sequence
NOV9C, TGSLVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRC 305037558 QRDAMCCPGTLCVNGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHK Protein Sequence DTAQAPEIFQRCDCGPGLLCRSQLASNRQHARLRVCQKIEKLLEG
SEQ ID NO: 33 541 bp
N0V9d, CACCGGATCCACCATGGTGGCGGCCGTCCTGCTGGGGCTGAGCTGGCTCTGCTCTCCC
305037512 DNA CTGGGAGCTCTGGTCCTGGACTTCAACAACATCAGGAGCTCTGCTGACCTGCATGGGG
Sequence CCCGGAAGGGCTCACAGTGCCTGTCTGACACGGACTGCAATACCAGAAAGTTCTGCCT CCAGCCCCGCGATGAGAAGCCGTTCTGTGCTACATGTCGTGGGTTGCGGAGGAGGTGC CAGCGAGA^ GTTGTCTGAGAACTTTTGACTGTGGCCCTGGACTTTGCTGTGCTCGTCATTTTTGGAC GAAAATTTGTAAGCCAGTCCTTTTGGAGGGACAGGTCTGCTCCAGAAGAGGGCATAAA GACACTGCTCAAGCTCCAGAAATCTTCCAGCGTTGCGACTGTGGCCCTGGACTACTGT GTCGAAGCCAATTGGCCAGCAATCGGCAGCATGCTCGATTAAGAGTATGCCAAAAAAT AGAAAAGCTACTCGAGGGC
ORF Start: at 2 ORF Stop: end of sequence
SEQ ID NO: 34 180 aa MW at 19821.7kD
N0V9d, TGSTMVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCL 305037512 QPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNGQEGESCLRTFDCGPGLCCARHFWT Protein Sequence KICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLASNRQHARLRVCQKI EKLLEG
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 9B.
Further analysis of me NOV9a protein yielded the following properties shown in Table 9C.
Table 9C. Protein Sequence Properties NOV9a
PSort 0.7284 probability located in outside; 0.1000 probability analysis : located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in microbody (peroxisome)
SignalP Cleavage site between residues 19 and 20 analysis:
A search of the NOV9a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 9D.
In a BLAST search of public sequence datbases, the NOV9a protein was found to have homology to the proteins shown in the BLASTP data in Table 9E.
PFam analysis predicts that the N0V9a protein contams the domains shown in me Table 9F.
Table 9F. Domain Analysis of NOV9a
Identities/
Pfam Domain NOV9a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 10.
The NOV10 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 10A.
Further analysis of the NOVlOa protein yielded the following properties shown in Table 10B.
Table 10B. Protein Sequence Properties NOVlOa
PSort 0.8200 probability located in endoplasmic reticulum analysis : (membrane); 0.1900 probability located in plasma membrane; 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
SignalP Cleavage site between residues 28 and 29 analysis :
A search of the NOVlOa protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table IOC.
In a BLAST search of public sequence datbases, the NOVlOa protein was found to have homology to the proteins shown in me BLASTP data in Table 10D.
Table 10D. Public BLASTP Results for NOVlOa
Protein ties/ Expect
Protein/Organism/Length NOVl0a Identi Value
PFam analysis predicts mat the NOVlOa protein contains the domains shown in the Table 10E.
Example 11.
The NOVl 1 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 11 A.
GGCCTGAGCCTGCGCCTGCGCGCGCTGCTGCTGGACCACAACCGCGTCCGTGCGCTGC CGCCAGGTGCCTTCGCGGGAGCGGGCGCGCTACAGCGCCTGGACCTGCGCGAGAACGG GCTGCACTCGGTGCATGTGCGAGCCTTCTGGGGCCTGGGCGCGCTGCAGCTGCTGGAC CTGAGCGCCAACCAGCTGGAAGCACTGGCACCAGGGACTTTCGCGCCGCTGCGCGCGC TGCGCAACCTCTCATTGGCCGGCAACCGGCTGGCGCGCCTGGAGCCCGCGGCGCTAGG CGCGCTCCCGCTGCTGCGCTCACTCAGCCTGCAGGACAACGAGCTGGCGGCACTCGCG CCGGGGCTGCTGGGCCGCCTGCCCGCTCTAGACGCGCTGCACCTGCGCGGCAACCCTT GGGGCTGCGGGTGCGCGCTGCGCCCGCTCTGCGCCTGGCTGCGCCGGCACCCGCTGCC CGCGTCAGAGGCCGAGACGGTGCTCTGCGTGTGGCCGGGACGCCTGACGCTCAGCCCC CTGACTGCCTTTTCCGACGCCGCCTTTAGCCATTGCGCGCAGCCGCTCGCCCTGCGGG ACCTGGCCGTGGTTTACACGCTCGGGCCGGCCTCCTTCCTCGTCAGCCTGGCTTCCTG CCTGGCGCTGGGCTCTGGGCTCACCGCCTGCCGTGCGCGCCGCCGCCGCCTCCGCACC GCCGCCCTCCGCCCGCCGAGACCGCCAGACCCGAACCCCGATCCCGACCCCCACGGCT GTGCCTCGCCCGCGGACCCGGGGAGCCCCGCCGCTGCCGCCCAAGCCTGAGCGGCCGC
GGCCGCCTGGAGCGCTCGAAGCTTCCCCCATGCCTTTGCCCTCCCTTTACACTGTCTG
CCGGCGTCAACAAGCGACACAGACCGAAAAAAAAAGAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAACAAAAAATT
ORF Start: ATG at 90 ORF Stop: TGA at 1092
SEQ ID NO: 38 1334 aa MW at 34891. OkD
NOVlla, MRGPSWLRPRPLL LL LLSPWPVWAHVSATASPSGSLGAPDCPEVCTCVPGG ASCS CG157567-01 A S PAVPPGLS RLRALLDHNRVRALPPGAFAGAGA QRLDLRENGLHSVHVRAFW Protein Sequence GLGA QLLDLSANQ EALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSL QDNE AALAPGLLGRLPALDA HLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCV WPGRTLSP TAFSDAAFSHCAQPLA RDLAWYTLGPASFLVSLASC ALGSGLTAC RARRRRLRTAA RPPRPPDPNPDPDPHGCASPADPGSPAAAAQA
Further analysis of me NOVl la protein yielded me following properties shown in Table 1 IB.
Table 11B. Protein Sequence Properties NOVlla
PSort 0 .5947 probability located in outside; 0 . 1000 probability analysis : located in endoplasmic reticulum (membrane) ; 0.1000 probability located in endoplasmic reticulum (lumen) ; 0.1000 probability located in microbody (peroxisome)
SignalP Cleavage site between residues 27 and 28 analysis :
A search of the NOVl la protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 1 lC.
In a BLAST search of public sequence datbases, the NOVl la protein was found to have homology to e proteins shown in the BLASTP data in Table 1 ID.
PFam analysis predicts mat the NOVl la protein contains the domains shown in the Table HE.
Table HE. Domain Analysis of NOVlla
Identities/
Pf m Domain NOVlla Match Region Similarities Expect Value for the Matched Region
Example 12.
The NOVl 2 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 12A.
Table 12A. NOV12 Sequence Analysis
SEQ ID NO: 39 |838 bp
NOV12a, TCAAAGGAAACTGACAAATTATCCCCAGCTGCCAGAAGAAGAAATCCTCACTGGACGG
CG157760-01 DNA CTTCCTGTTTCCTGTGGTTCATTATCTGATTGGCTGCAGGGATGAAAGTTTTTAAGTT Sequence CATAGGACTGATGATCCTCCTCACCTCTGCGCTTTCAGCCGGTTCAGGACAAAGTCCA ATGACTGTGCTGTGCTCCATAGACTGGTTCATGGTCACAGTGCACCCCTTCATGCTAA ACAACGATGTGTGTGTACACTTTCATGAACTACACTTGGGCCTGGGTTGCCCCCCAAA CCATGTTCAGCCACACGCCTACCAGTTCACCTACCGTGTTACTGAATGTGGCATCAGG GCCAAAGCTGTCTCTCAGGACATGGTTATCTACAGCACTGAGATACACTACTCTTCTA AGGGCACGCCATCTAAGTTTGTGATCCCAGTGTCATGTGCTGCCCCCCAAAAGTCCCC ATGGCTCACCAAGCCCTGCTCCATGAGAGTAGCCAGCAAGAGCAGGGCCACAGCCCAG AAGGATGAGAAATGCTACGAGGTGTTCAGCTTGTCACAGTCCAGTCAAAGGCCCAACT GCGATTGTCCACCTTGTGTCTTCAGTGAAGAAGAGCATACCCAGGTCCCTTGTCACCA AGCAGGGGCTCAGGAGGCTCAACCTCTGCAGCCATCTCACTTTCTTGATATTTCTGAG GATTGGTCTCTTCACACAGATGATATGATTGGGTCCATGTGATCCTCAGGTTTGGGGT
CTCCTGAAGATGCTATTTCTAGAATTAGTATATAGTGTACAAATGTCTGACAAATAAG
TGCTCTTGTGACCCTCATTAAGGCGA
ORF Start: ATG at 100 ORF Stop: TGA at 736
SEQ ID NO: 40 212 aa MW at 23581.8kD
NOV12a, MKVFKFIGLMILLTSAIiSAGSGQSPMTVLCSID FMVTVHPFMLNNDVCVHFHELHLG CG157760-01 ILGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCA Protein Sequence jAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHT QVPCHQAGAQEAQPLQPSHFLDISED SLHTDDMIGSM
SEQ ID NO: 41 697 bp
NOV12b, TCAAAGGAAACTGACAAATTATCCCCAGCTGCCAAAAGAAGAAATCCTCACTGGACGG
CG157760-02 DNA CTTCCTGTTTCCTGTGGTTCATTATCTGATTGGCTGCAGGGATGAAAGTTTTTAAGTT Sequence CATAGGACTGATGATCCTCCTCACCTCTGCGTTTTCAGCCGGTTCAGGACAAAGTCCA ATGACTGTGCTGTGCTCCATAGACTGGTTCATGGTCACAGTGCACCCCTTCATGCTAA ACAACGATGTGTGTGTACACTTTCATGAACTACACTTGGGCCTGGGTTGCCCCCCAAA CCATGTTCAGCCACACGCCTACCAGTTCACCTACCGTGTTACTGAATGTGGCATCAGG GCCAGCAAGAGCAGGGCCACAGCCCAGAAGGATGAGAAATGCTACGAGGTGTTCAGCT TGTCACAGTCCAGTCAAAGGCCCAACTGCGATTGTCCACCTTC AGAGCATACCCAGGTCCCTTGTCACCAAGCAGGGGCTCAGGAGGCTCAACCTCTGCAG CCATCTCACTTTCTTGATATTTCTGAGGATTGGTCTCTTCACACAGATGATATGATTG GGTCCATGTGATCCTCAGGTTTGGGGTCTCCTGAAGATGCTATTTCTAGAATTAGTAT ATAGTGTACAAATGTCTGACAAATAAGTGCTCTTGTGACCCTCATGTAAGGGCGATTC
ORF Start: ATG at 100 ORF Stop: TGA at 589
SEQ ID NO: 42 163 aa MW at 18277.6kD
NOV12b, MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLG CG157760-02 LGCPPNHVQPHAYQFTYRVTECGIRASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPP Protein Sequence CVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM
Sequence comparison of me above protein sequences yields the following sequence relationships shown in Table 12B.
Table 12B. Comparison of NOV12a against NOV12b.
NOV12a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOV12b .212 162/212 (76%) .163 162/212 (76%)
Further analysis of e NOV12a protein yielded me following properties shown in Table 12C.
Table 12C. Protein Sequence Properties NOV12a
PSort 0 . 6568 probability located in outside ; 0 . 1000 probability analysis : located in endoplasmic reticulum (membrane) ; 0 . 1000 probability located in endoplasmic reticulum (lumen) ; 0 . 1000 probability located in lysosome (lumen)
SignalP Cleavage site between residues 23 _and 24 analysis :
A search of the NOVl 2a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 12D.
In a BLAST search of public sequence datbases, me NOV12a protem was found to have homology to the proteins shown in e BLASTP data in Table 12E.
Table 12E. Public BLASTP Results for NOV12a
Identities/
NOV12a
Protein Similarities Residues/ Expect
Accession Protein/Organism/Length Match for the Value
Number Matched Residues Portion
Q9HBJ0 PLAC1 (Placenta- specific 1) - 1..212 21,1/212 (99%) e-126 Homo sapiens (Human), 212 aa . 1..212 211/212 (99%)
Q9JI83 EPCS26 (PLAC1) (Placental 1..171 104/171 (60%) le-60 specific protein 1) - Mus 1..171 134/171 (77%) musculus (Mouse) , 173 aa.
BAC04191 CDNA FLJ36198 fis, clone 9..125 38/118 (32%) 7e-17 TESTI2028242, weakly similar 5..122 70/118 (59%) to Mus musculus EPCS26 mRNA - Homo sapiens (Human), 158 aa .
Q925U0 Initiate factor 3 (Oocyte- .122 34/117 (29%) 6e-09 secreted protein 1 precursor) .122 62/117 (52%) - Mus musculus (Mouse) , 202 aa.
BAC11848 Initiate factor 3 2 - Mus .88 25/83 (30%) 3e-05 musculus (Mouse) , 92 aa. .89 46/83 (55%)
PFam analysis predicts that the NOVl 2a protein contains the domains shown in the Table 12F.
Table 12F. Domain Analysis of NOV12a
Pf am Domain J NOV12a Match Region J Identities/ Expect Value Similarities for the Matched Region
No Significant Matches Found
Example 13.
The NOVl 3 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 13 A.
Table 13A. NOV13 Sequence Analysis
SEQ ID NO: 43 1103 bp
NOV13a, AAGCAGGCTGGTACGCCCTGGAGTTAANGGATGGCTGCGGGTTTGGCGGCGCTGCGCC
CG157844-01 DNA GGCAGGCAGCGAGGCCGGGTCGGGCCCTGGGCCCTCGCGCCCCTCCCGCGAGGCCTGT Sequence CATGCAGGGCCCCGCCGGGAACGCGAGCCGGGGACTGCCAGGCGGGCCGCCCTCCACA GTCGCGTCCGGGGCGGGCCGCTGCGAGAGCGGCGCGCTCATGCACAGCTTCGGCATCT TCCTGCAGGGGCTGCTCGGCGTCGTGGCCTTCAGCACGTTAATGGTCAAACGCTTCAG AGAACCAAAGCATGAAAGACGTCCGTGGAGGATATGGTTTTTAGACACTTCCAAACAA GCCATAGGAATGCTGTTCATCCACTTTGCAAATGTATACCTAGCAGATCTCAGTGAAG AGGACCCTTGTTCACTGTACCTCATCAACTTCCTCCTGGACGCCACTGTGGGCATGCT GCTCATCTACGTGGGGGTGCGCGCCGTCAGCGTCCTGGTAGAGTGGCAGCAGTGGGAG TCCCTGCGCTTCGGCGAATATGGAGACCCTCTGCAGTGTGGAGCCTGGGTCGGGCAGT GCGCTCTTTACATCGTGATCATGATTTTTGAAAAGTCTGTCGTCTTCATCGTCCTCCT CCTACTCCAGTGGAAAAAGGTGGCCCTATTGAATCCAATTGAAAACCCCGACCTGAAG CTGGCCATCGTCATGCTGATCGTCCCCTTCTTTGTCAACGCTTTGATGTTTTGGGTAG TGGACAATTTCCTCATGAGAAAGGGGAAGACGAAAGCTAAGCTAGAAGAAAGGGGAGC CAACCAGGACTCGAGGAATGGGAGCAAGGTCCGCTACCGGAGGGCCGCATCCCACGAG GAGTCTGAGTCTGAGATCCTGATCTCAGCGGATGATGAGATGGAGGAGTCCGACGTGG AGGAGGACCTCCGCAGACTGACCCCCCTCAAGCCTGTGAAGAAAAAGAAGCACCGCTT TGGGCTACCCGTATGACACATTCCCATGCTGGGGGTGACGGGAGGGCCCCGCCAGCCG
CTGGTGTGCAGAGGTCATCCCACAGCATCGTTCCTTACCCTCTCTCTGCCCTTCACCC
ORF Start: ATG at 31 ORF Stop: TGA at 1000
SEQ ID NO: 44 323 aa MW at 36089.9kD
NOV13a, MAAGLAALRRQAARPGRALGPRAPPARPVMQGPAGNASRGLPGGPPSTVASGAGRCES CG157844-01 GALMHSFGIFLQGLLGWAFSTLMVKRFREPKHERRPWRIWFLDTSKQAIGMLFIHFA Protein Sequence NVYLADLSEEDPCSLYLINFLLDATVGMLLIYVGVRAVSVLVEWQQWESLRFGEYGDP LQCGAWVGQCALYIVIMIFEKSWFIVLLLLQWKKVALLNPIENPDLKLAIVMLIVPF FVNALMFWWDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEESESEILISA DDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPV
Further analysis of the NOVl 3 a protein yielded the following properties shown in Table 13B.
Table 13B. Protein Sequence Properties NOV13a
PSort 0.6113 probability located in mitochondrial inner membrane; analysis: 0.6000 probability located in plasma membrane; 0.4387 probability located in mitochondrial intermembrane space; 0.4000 probability located in Golgi body
A search of the NOVl 3a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 13C.
In a BLAST search of public sequence datbases, the NOV13a protein was found to have homology to the proteins shown in the BLASTP data in Table 13D.
PFam analysis predicts that e NOVl 3a protein contains the domains shown in the Table 13E.
Table 13E. Domain Analysis of NOV13a
Identities/
Pfam Domai J NOV13a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 14.
The NOV14 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 14A.
Table 14A. NOV14 Sequence Analysis
SEQ ID NO: 45 1728 bp
N0V1 a, ATGGATCTGGTGCTAAAAAGATGCCTTCTTCATTTGGCTGTGATAGGTGCTTTGCTGG
CG158114-01 DNA CTGTGGGGGCTACAAAAGGGAGCCAGGTGTGGGGAGGACAGCCAGTGTATCCCCAGGA Sequence AACTGACGATGCCTGCATCTTCCCTGATGGTGGACCTTGCCCATCTGGCTCTTGGTCT CAGAAGAGAAGCTTTGTTTATGTCTGGAAGACCTGGGGCCAATACTGGCAAGTTCTAG GGGGCCCAGTGTCTGGGCTGAGCATTGGGACAGGCAGGGCAATGCTGGGCACACACAC CATGGAAGTGACTGTCTACCATCGCCGGGGATCCCGGAGCTATGTGCCTCTTGCTCAT TCCAGCTCAGCCTTCACCATTACTGACCAGGTGCCTTTCTCCGTGAGCGTGTCCCAGT TGCGGGCCTTGGATGGAGGGAACAAGCACTTCCTGAGAAATCAGCCTCTGACCTTTGC CCTCCAGCTCCATGACCCCAGTGGCTATCTGGCTGAAGCTGACCTCTCCTACACCTGG GACTTTGGAGACAGTAGTGGAACCCTGATCTCTCGGGCACTTGTGGTCACTCATACTT ACCTGGAGCCTGGCCCAGTCACTGCCCAGGTGGTCCTGCAGGCTGCCATTCCTCTCAC CTCCTGTGGCTCCTCCCCAGTTCCAGGCACCACAGATGGGCACAGGCCAACTGCAGAG GCCCCTAACACCACAGCTGGCCAAGTGCCTACTACAGAAGTTGTGGGTACTACACCTG GTCAGGCGCCAACTGCAGAGCCCTCTGGAACCACATCTGTGCAGGTGCCAACCACTGA AGTCATAAGCACTGCACCTGTGCAGATGCCAACTGCAGAGAGCACAGGTATGACACCT GAGAAGGTGCCAGTTTCAGAGGTCATGGGTACCACACTGGCAGAGATGTCAACTCCAG AGGCTACAGGTATGACACCTGCAGAGGTATCAATTGTGGTGCTTTCTGGAACCACAGC TGCACAGGTAACAACTACAGAGTGGGTGGAGACCACAGCTAGAGAGCTACCTATCCCT GAGCCTGAAGGTCCAGATGCCAGCTCAATCATGTCTACGGAAAGTATTACAGGTTCCC TGGGCCCCCTGCTGGATGGTACAGCCACCTTAAGGCTGGTGAAGAGACAAGTCCCCCT GGATTGTGTTCTGTATCGATATGGTTCCTTTTCCGTCACCCTGGACATTGTCCAGGGT ATTGAAAGTGCCGAGATCCTGCAGGCTGTGCCGTCCGGTGAGGGGGATGCATTTGAGC TGACTGTGTCCTGCCAAGGCGGGCTGCCCAAGGAAGCCTGCATGGAGATCTCATCGCC AGGGTGCCAGCCCCCTGCCCAGCGGCTGTGCCAGCCTGTGCTACCCAGCCCAGCCTGC CAGCTGGTTCTGCACCAGATACTGAAGGGTGGCTCGGGGACATACTGCCTCAATGTGT CTCTGGCTGATACCAACAGCCTGGCAGTGGTCAGCACCCAGCTTATCATGCCTGGTCA AGAAGCAGGCCTTGGGCAGGTTCCGCTGATCGTGGGCATCTTGCTGGTGTTGATGGCT GTGGTCCTTGCATCTCTGATATATAGGCGCAGACTTATGAAGCAAGACTTCTCCGTAC CCCAGTTGCCACATAGCAGCAGTCACTGGCTGCGTCTACCCCGCATCTTCTGCTCTTG TCCCATTGGTGAGAATAGCCCCCTCCTCAGTGGGCAGCAGGTCTGA
ORF Start: ATG at 1 ORF Stop: TGA at 1726
SEQ ID NO: 46 (575 aa MW at 60580.6kD
N0V14a, MDLVLKRCLLHLAVIGALLAVGATKGSQVWGGQPVYPQETDDACIFPDGGPCPSGSWS CG158114-01 QKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAH Protein Sequence SSSAFTITDQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTW DFGDSSGTLISRALWTHTYLEPGPVTAQWLQAAIPLTSCGSSPVPGTTDGHRPTAE APNTTAGQVPTTEWGTTPGQAPTAEPSGTTSVQVPTTEVISTAPVQMPTAESTGMTP EKVPVSEVMGTTLAEMSTPEATGMTPAEVSIWLSGTTAAQVTTTEWVETTARELPIP EPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIVQG lESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPAC QLVLHQILKGGSGTYCLNVSLADTNSLAWSTQLIMPGQEAGLGQVPLIVGILLVLMA WLASLIYRRRLMKQDFSVPQLPHSSSHWLRLPRIFCSCPIGENSPLLSGQQV
Further analysis of me NOV14a protein yielded me following properties shown in Table 14B.
Table 14B. Protein Sequence Properties NOV14a
PSort 1 0 .4600 probability located in plasma membrane; 0 . 1000 analysis: | probability located in endoplasmic reticulum (membrane) ;
0.1000 probability located in endoplasmic reticulum (lumen) ;
0 . 1000 probability located in outside
SignalP Cleavage site between residues 27 and 28 analysi :
A search of the NOV14a protein against the Geneseq database, a proprietary database at contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 14C.
In a BLAST search of public sequence datbases, me NOV14a protein was found to have homology to the proteins shown in the BLASTP data in Table 14D.
PFam analysis predicts that the N0V14a protein contains the domains shown in the Table 14E.
Table 14E. Domain Analysis of NOV14a
Identities/
Pfa Domain NOV14a Match Region Similarities Expect Value for the Matched Region
PKD 131..215 26/99 (26%) 5.6e-0£ 61/99 (62%)
Example 15.
The NOVl 5 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 15 A.
Table 15A. NOV15 Sequence Analysis
SEQ ID NO: 47 1733 bp
NOV15a, CTCGAGCTGCAGAGCTAGCTCTGCAGCTCGCTGCAGAGCTCAGCTGCGTCCGGCGGAGI
CG158553-01 DNA GCAGCTGCTGACCCAGCTGTGGACTGTGCCGGGGGCGGGGGACGGAGGGGCAGGAGCC Sequence CTGGGCTCCCCGTGGCGGGGGCTGTATCATGGACCACCTCGGGGCGTCCCTCTGGCCC
CAGGTCGGCTCCCTTTGTCTCCTGCTCGCTGGGGCCGCCTGGGCGCCCCCGCCTAACC TCCCGGACCCCAAGTTCGAGAGCAAAGCGGCCTTGCTGGCGGCCCGGGGGCCCGAAGA GCTTCTGTGCTTCACCGAGCGGTTGGAGGACTTGGTGTGTTTCTGGGAGGAAGCGGCG AGCGCTGGGGTGGGCCCGGGCAACTACAGCTTCTCCTACCAGCTCGAGGATGAGCCAT GGAAGCTGTGTCGCCTGCACCAGGCTCCCACGGCTCGTGGTGCGGTGCGCTTCTGGTG TTCGCTGCCTACAGCCGACACGTCGAGCTTCGTGCCCCTAGAGTTGCGCGTCACAGCA GCCTCCGGCGCTCCGCGATATCACCGTGTCATCCACATCAATGAAGTAGTGCTCCTAG ACGCCCCCGTGGGGCTGGTGGCGCGGTTGGCTGACGAGAGCGGCCACGTAGTGTTGCG CTGGCTCCCGCCGCCTGAGACACCCATGACGTCTCACATCCGCTACGAGGTGGACGTC TCGGCCGGCAACGGCGCAGGGAGCGTACAGAGGGTGGAGATCCTGGAGGGCCGCACCG AGTGTGTGCTGAGCAACCTGCGGGGCCGGACGCGCTACACCTTCGCCGTCCGCGCGCG TATGGCTGAGCCGAGCTTCGGCGGCTTCTGGAGCGCCTGGTCGGAGCCTGTGTCGCTG CTGACGCCTAGCGACCTGGACCCCCTCATCCTGACGCTCTCCCTCATCCTCGTGGTCA TCCTGGTGCTGCTGACCGTGCTCGCGCTGCTCTCCCACCGCCGGGCTCTGAAGCAGAA GATCTGGCCTGGCATCCCGAGCCCAGAGAGCGAGTTTGAAGGCCTCTTCACCACCCAC AAGGGTAACTTCCAGCTGTGGCTGTACCAGAATGATGGCTGCCTGTGGTGGAGCGCCT GCACCCCCTTCACGGAGGACCCACCTGCTTTCCTGGAAGTCCTCTCAGAGCGCTGCTG GGGGACGATGCAGGCAGTGGAGCCGGGGACAGATGATGAGGGCCCCCTGCTGGAGCCA GTGGGCAGTGAGCATGCCCAGGATACCTATCTGGTGCTGGACAAATGGTTGCTGCCCC GGAACCCGCCCAGTGAGGACCTCCCAGGGCCATGGGCACTGTGCCCTGAGCTGCCCCC TACCCCACCCCACCTAAAGTACCTGTACCTTGTGGTATCTGACTCTGGCATCTCAACT GACTACAGCTCAGGGGACTCCCAGGGAGCCCAAGGGGGCTTATCCGATGGCCCCTACT CCAGCCCTTATGAGAACAGCCCTATCCCAGCCGCTGAGCCTCTGCCCCCCAGCTATGT GGCTTGCTCTTAGGACACCAGGCTGCAGATGATCAGGGATCCAATATGACTCAGAGAA
CCAGTGCAGACTCAAGACTTATGGAACAGGGATGGCGAGGCCTCTCTCAGGAGCAGGG
GCATTGCTGATTTTGTCTGCCCAATCCATCCTGCTCAGGAAACCACAACCTTGCAGTA
TTTTTAAATATGTATAGTTTTTTTGCTGCAGAGCTAGCTCTGCAGCTCGAG
ORF Start: ATG at 145 ORF Stop: TAG at 1519 AGCGGTTGGGGGACTTGGTGTGTTTCTGGGAGGAAGCGGCGAGCGCTGGGGTGGGCCC GGGCAACTACAGCTTCTCCTACCAGCTCGAGGATGAGCCATGGAAGCTGTGTCGCCTG CACCAGGCTCCCACGGCTCGTGGTGCGGTGCGCTTCTGGTGCTCGCTGCCTACAGCCG ACACGTCGAGCTTCGTGCCCCTAGAGTTGCGCGTCACAGCAGCCTCCGGCGCTCCGCG ATATCACCGTGTCATCCACATCAATGAAGTAGTGCTTCTAGACGCCCCCGTGGGGCTG GTGGCGCGGTTGGCTGACGAGAGCGGCCACGTAGTGTTGCGCTGGCTCCCGCCGCCTG AGACACCCATGACGTCCCACATCCGCTACGAGGTGGACGTCTCGGCCGGCAACGGCGC AGGGAGCGTACAGAGGGTGGAGATCCTGGAGGGCCGCACCGAGTGTGTGCTGAGCAAC CTGCGGGGCCGGACGCGCTACACCTTCGCCGTCCGCACGCGTATGGCTGAGCCGAGCT TCGGCGGCTTCTGGAGCGCCTGGTCGGAGCCTGTGTCGCTGCTGACGCCTAGCGACCT GGACCCCCTCATCCTGACGCTCTCCCTCATCCTCGTGGTCATCCTGGTGCTGCTGACC GTGCTCGCGCTGCTCTCCCACCGCCGGGCTCTGAAGCAGAAGATCTGGCCTGGCATCC CGAGCCCAGAGAGCGAGTTTGAAGGCCTCTTCACCACCCACAAGGGTAACTTCCAGCT GTGGCTGTACCAGAATGATGGCTGCCTGTGGTGGAGCCCCTGCACCCCCTTCACGGAG GACCCACCTGCTTCCCTGGAAGTCCTCTCAGAGCGCTGCTGGGGGACGATGCAGGCAG TGGAGCCGGGGACAGATGATGAGGGCCCCCTGCTGGAGCCAGTGGGCAGTGAGCATGC CCAGGATACCTATCTGGTGCTGGACAAATGGTTGCTGCCCCGGAACCCGCCCAGTGAG GACCTCCCAGGGCCATGGGCACTGTGCCCTGAGCTGCCCCCTACCCCACCCCACCTAA AGTACCTGTACCTTGTGGTATCTGACTCTGGCATCTCAACTGACTACAGCTCAGGGGA CTCCCAGGGAGCCCAAGGGGGCTTATCCGATGGCCCCTACTCCAGCCCTTATGAGAAC AGCCCTATCCCAGCCGCTGAGCCTCTGCCCCCCAGCTATGTGGCTTGCTCTTAGGACA CCAGGCTGCAGATGATCAGGGATCCAATATGACTCAGAGAACC
ORF Start: ATG at 12 ORF Stop: TAG at 1386
SEQ ID NO: 52 1458 aa MW at 49993. kD
NOV15c, MDHLGASLWPQVGSLCLL AGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLG CG158553-02 D VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCR HQAPTARGAVRFWCS PTADTSS Protein Sequence FVPLELRVTAASGAPRYHRVIHINEWLDAPVGLVARLADESGHWIiRW PPPETPM TSHIRYEVDVSAGNGAGSVQRVEILEGRTECV SN RGRTRYTFAVRTRMAEPSFGGF WSAWSEPVSLLTPSDLDPLI TLSLILWILV LTVLA SHRRALKQKIWPGIPSPE SΞFEG FTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEV SERCWGTMQAVEPG TDDEGPLLEPVGSEHAQDTY VLDKWLLPRNPPSEDLPGPWALCPELPPTPPH KYLY LWSDSGISTDYSSGDSQGAQGGLSDGPYSSPYENSPIPAAEPLPPSYVACS
SEQ ID NO: 53 1585 bp
NOV15d, GGGGCTGTATCATGGACCACCTCGGGGCGTCCCTCTGGCCCCAGGTCGGCTCCCTTTG
CG158553-03 DNA TCTCCTGCCCGCTGGGGCCGCCTGGGCGCCCCCGCCTAACCTCCCGGACCCCAAGTTC Sequence GAGAGCAAAGCGGCCTTGCTGGCGGCCCGGGGGCCCGAAGAGCTTCTGTGCTTCACCG AGCGGTTGGAGGACTTGGTGTGTTTCTGGGAGGAAGCGGCGAGCGCTGGGGTGGGCCC GGGCAACTACAGCTTCTCCTACCAGCTCGAGGATGAGCCATGGAAGCTGTGTCGCCTG CACCAGGCTCCCACGGCTCGTGGTGCGGTGCGCTTCTGGTGTTCGCTGCCTACAGCCG ACACGTCGAGCTTCGTGCCCCTAGAGTTGCGCGTCACAGCAGCCTCCGGCGCTCCGCG ATATCACCGTGTCATCCACATCAATGAAGTAGTGCTCCTAGACGCCCCCGTGGGGCTG GTGGCGCGGTTGGCTGACGAGAGCGGCCACGTAGTGTTGCGCTGGCTCCCGCCGCCTG AGACACCCATGACGTCTCACATCCGCTACGCGGTGGACGTCTCGGCCGGCAACGGCGC AGGGAGCGTACAGAGGGTGAAGATCCTGGAGGGCCGCACCGAGTGTGTGCTGAGCAAC CTGCGGGGCCGGACGCGCTACACCTTCGCCGTCCGCGCGCGTATGGCTGAGCCGAGCT TCGGCGGCTTCTGGAGCGCCTGGTCGGAGCCTGTGTCGCTGCTGACGCCTAGCGACCT GGACCCCCTCATCCTGACGCTCTCCCTCATCCTCGTGGTCATCCTGGTGCTGCTGACC GTGCTCGCGCTGCTCTCCCACCGCCGGGCTCTGAAGCAGAAGATCTGGCCTGGCATCC CGAGCCCAGAGAGCGAGTTTGAAGGCCTCTTCACCACCCACAAGGGTAACTTCCAGCT GTGGCTGTACCAGAATGATGGCTGCCTGTGGTGGAGCCCCTGCACCCCCTTCACGGAG GACCCACCTGCTTCCCTGGAAGTCCTCTCAGAGCGCTGCTGGGGGACGATGCAGGCAG TGGAGCCGGGGACAGATGATGAGGGCCCCCTGCTGGAGCCAGTGGGCAGTGAGCATGC CCAGGATACCTATCTGGTGCTGGACAAATGGTTGCTGCCCCGGAACCCGCCCAGTGAG GACCTCCCAGGGCCTGGTGGCAGTGTGGACATAGTGGCCATGGATGAAGGCTCAGAAG CATCCTCCTGCTCATCTGCTTTGGCCTCGAAGCCCAGCCCAGAGGGAGCCTCTGCTGC CAGCTTTGAGTACACTATCCTGGACCCCAGCCCCCAGCTCTTGCGTCCATGGACACTG TGCCCTGAGCTGCCCCCTACCCCACCCCACCTAAAGTACCTGTACCTTGTGGTATCTG ACTCTGGCATCTCAACTGACTACAGCTCAGGGGACTCCCAGGGAGCCCAAGGGGGCTT ATCCGATGGCCCCTACTCCAACCCTTATGAGAACAGCCTTATCCCAGCCGCTGAGCCT CTGCCCCCCAGCTATGTGGCTTGCTCTTAGGACACCAGGCTGCAGATGATCAGGGATC CAATATGACTCAGAGAACC
ORF Start: ATG at 12 :ORF Stop: TAG at 1536
SEQ ID NO: 54 508 aa MW at 54999.6kD
N0V15d, MDHLGASLWPQVGSLCL PAGAAWAPPPNLPDPKFESKAAL AARGPEEL CFTERLE CG158553-03 DLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCR HQAPTARGAVRFWCSLPTADTSS Protein Sequence FVP ELRVTAASGAPRYHRVIHINEWLLDAPVG VARLADESGHWLRWLPPPETPM TSHIRYAVDVSAGNGAGSVQRVKILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGF WSAWSEPVSLLTPSDLDPLILTLSLI WILVLLTVALLSHRRA KQKIWPGIPSPE SEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEV SERCWGTMQAVEPG TDDEGP LEPVGSEHAQDTYIiVLDKWLLPRNPPSED PGPGGSVDIVAMDEGSEASSC SSALASKPSPEGASAASFEYTI DPSPQLLRPWTLCPELPPTPPHLKYLYLWSDSGI STDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 15B.
Further analysis of the NOVl 5a protein yielded the following properties shown in Table 15C.
Table 15C. Protein Sequence Properties NOV15a
PSort 0.4600 probability located in plasma membrane; 0.1762 analysis: probability located in microbody (peroxisome) ; 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Cleavage site between residues 26 and 27 analysis: A search of the NOVl 5a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 15D.
In a BLAST search of public sequence datbases, the NOVl 5a protein was found to have homology to e proteins shown in the BLASTP data in Table 15E.
PFam analysis predicts mat the NOVl 5a protein contains the domains shown in me Table 15F.
Table 15F. Domain Analysis of NOV15a
Identities/
Pfam Domain NOVl5a Match Region Similarities Expect Value for the Matched Region fn3 145 . . 228 21/88 ( 24 % ) 0 . 00059 59/88 ( 67% )
Example 16.
The NOVl 6 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 16 A.
Table 16A. NOV16 Sequence Analysis
SEQ ID NO: 55 751 bp
NOVl6a, CGCGGCAGCTCCCACCATGGCGGAGACCAAGCTCCAGCTGTTTGTCAAGGCGAGTGAG
CG158983-01 DNA GACGGGGAGAGCGTGGGTCACTGCCCCTCCTGCCAGCGGCTCTTCATGGTCCTGCTCC Sequence TCAAGGGCGTACCTTTCACCCTCACCACGGTGGACACGCGCAGGTCCCCGGACGTGCT GAAGGACTTCGCCCCCGGCTCGCAGCTGCCCATCCTGCTCTATGACAGCGACGCCAAG ACAGACACGCTGCAGATCGAGGACTTTCTGGAGGAGACGCTGGGGCCGCCCGAGGAGT CCAACACCGCCGGCAACGACGTTTTCCACAAGTTCTCCGCGTTCATCAAGAACCCGGT GCCCGCGCAGGACGAAGCCCTGTACCAGCAGCTGCTGCGCGCCCTCGCCAGGCTGGAC AGCTACCTGCGCGCGCCCCTGGAGCACGAGCTGGCGGGGGAGCCGCAGCTGCGCGAGT CCCGCCGCCGCTTCCTGGACGGCGACAGGCTCACGCTGGCCGACTGCAGCCTCCTGCC CAAGCTGCACATCGTCGACACGGTGTGCGCGCACTTCCGCCAGGCGCCCATCCCCGCG GAGTGCGCGGCGTACGCCGTTACCTGGACAGCGCGATGCAGGAGAAAGAGTTCAAATA CACGTGTCCGCACAGCGCCGAGATCCTGGCGGCCTACCGGCCCGCCGTGCACCCCACG CTAGCGCCCCACCCCGCGTCTGTCGCCCAATAAAGGCATCTTTGTCGGGAAAAAA
ORF Start: ATG at 17 ORF Stop: TAG at 698
SEQ ID NO: 56 J227 aa MW at 25431.7kD
NOVl6a, MAETK-LQLFVKASEDGESVGHCPSCQR FMVLLLKGVPFTLTTVDTRRSPDVLKDFAP CG158983-01 GSQLPI YDSDAKTDTLQIEDFLEETLGP EESNTAGNDVFHKFSAFIKNPVPAQDE Protein Sequence ALYQQLLRALAR DSYLRAPLEHELAGEPQLRESRRRFLDGDR Tl-ADCS LPK HIV DTVCAHFRQAPIPAECAAYAVTWTARCRRKSSNTRVRTAPRSWRPTGPPCTPR
SEQ ID NO: 57 693 bp
NOVl6b, CCCACCATGGCGGAGACCAAGCTCCAGCTGTTTGTCAAGGCGAGTGAGGACGGGGAGA CG158983-02 DNA GCGTGGGTCACTGCCCCTCCTGCCAGCGGCTCTTCATGGTCCTGCTCCTCAAGGGCGTj ORF Start: ATG at 17 ORF Stop: TAG at 698
SEQ ID NO: 62 227 aa MW at 25431.7kD
:N0V16d, MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFT TTVDTRRSPDVLKDFAP CG158983-01 GSQLPIL YDSDATDTLQIEDFLEET GPPEESNTAGNDVFHKFSAFIKNPVPAQDE Protein Sequence AYQQLLRALAR DSY RAPLEHE AGEPQLRESRRRF DGDRLTLADCSLLPKLHIV DTVCAHFRQAPIPAECAAYAVTWTARCRRKSSNTRVRTAPRSWRPTGPPCTPR
SEQ ID NO: 63 751 bp
NOVlδe, CGCGGCAGCTCCCACCATGGCGGAGACCAAGCTCCAGCTGTTTGTCAAGGCGAGTGAG
CG158983-01 DNA GACGGGGAGAGCGTGGGTCACTGCCCCTCCTGCCAGCGGCTCTTCATGGTCCTGCTCC Sequence TCAAGGGCGTACCTTTCACCCTCACCACGGTGGACACGCGCAGGTCCCCGGACGTGCT GAAGGACTTCGCCCCCGGCTCGCAGCTGCCCATCCTGCTCTATGACAGCGACGCCAAG ACAGACACGCTGCAGATCGAGGACTTTCTGGAGGAGACGCTGGGGCCGCCCGAGGAGT CCAACACCGCCGGCAACGACGTTTTCCACAAGTTCTCCGCGTTCATCAAGAACCCGGT GCCCGCGCAGGACGAAGCCCTGTACCAGCAGCTGCTGCGCGCCCTCGCCAGGCTGGAC AGCTACCTGCGCGCGCCCCTGGAGCACGAGCTGGCGGGGGAGCCGCAGCTGCGCGAGT CCCGCCGCCGCTTCCTGGACGGCGACAGGCTCACGCTGGCCGACTGCAGCCTCCTGCC CAAGCTGCACATCGTCGACACGGTGTGCGCGCACTTCCGCCAGGCGCCCATCCCCGCG GAGTGCGCGGCGTACGCCGTTACCTGGACAGCGCGATGCAGGAGAAAGAGTTCAAATA CACGTGTCCGCACAGCGCCGAGATCCTGGCGGCCTACCGGCCCGCCGTGCACCCCACG CTAGCGCCCCACCCCGCGTCTGTCGCCCAATAAAGGCATCTTTGTCGGGAAAAAA
ORF Start: ATG at 17 ORF Stop: TAG at 698
SEQ ID NO: 64 (227 aa MW at 25431.7kD
NOV16e, MAETKLQ FVKASEDGESVGHCPSCQRLFMVLLLKGVPFT-TTVDTRRSPDV KDFAP CG158983-01 GSQ PIL YDSDAKTDTLQIEDFLEET GPPEESNTAGNDVFHKFSAFIKNPVPAQDE Protein Sequence ALYQQLLRALAR DSYLRAP EHE AGEPQLRESRRRF DGDRLTLADCSL PKLHIV DTVCAHFRQAPIPAECAAYAVTWTARCRRKSSNTRVRTAPRSWRPTGPPCTPR
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 16B.
Further analysis of the NOVl 6a protein yielded the following properties shown in Table 16C.
Table 16C. Protein Sequence Properties NOVl 6a
PSort 0.9000 probability located in Golgi body,- 0. 7900 probability analysis . located in plasma membrane ; 0 .3000 probability located in microbody (peroxisome) ; 0.2000 probability located in endoplasmic reticulum (membrane)
SignalP Cleavage site between residues 43 and 44 analysis :
A search of the NOVl 6a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 16D.
In a BLAST search of public sequence datbases, the NOVl 6a protein was found to have homology to the proteins shown in me BLASTP data in Table 16E.
PFam analysis predicts that the NOVl 6a protein contains the domams shown in the Table 16F.
Table 16F. Domain Analysis of NOVlδa
Identities/
Pfam Domain NOVl6a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 17.
The NOVl 7 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 17 A.
Table 17A. NOV17 Sequence Analysis
SEQ ID NO: 65 2400 bp
N0V17a, GTGCGCGTTGGGGCGGCCGGCCAATGCCGGACCGCTTCGGCACCGCCCGCCCGATCCC
CG159015-01 DNA TCCACCCGTGGGCCGGCAATGGCGGGCGCAGTTTCGCTCTTGGGTGTGGTGGGGCTGC Sequence TGCTTGTGTCTGCGCTGTCCGGGGTCCTAGGAGACCGCGCCAATCCCGACCTCCGGGC ACACCCAGGGAACGCAGCCCACCCCGGCTCTGGAGCCACGGAACCCCGGCGGCGACCA CCGCTCAAGGATCAACGCGAGCGGACCCGGGCCGGGTCGCTGCCTCTGGGGGCGCTGT ACACCGCGGCCGTCGCGGCTTTTGTGCTGTACAAGTGTTTGCAGGGGAAAGATGAAAC TGCGGTTCTCCACGAGGAGGCAAGCAAGCAGCAGCCACTGCAGTCAGAGCAACAGCTG GCCCAGTTGACACAACAGCTGGCCCAGACAGAGCAGCACCTGAACAACCTGATGGCCC AGCTGGACCCCCTTTTTGAGCGTGTGACTACTCTGGCTGGAGCCCAGCAGGAGCTTCT GAACATGAAGCTATGGACCATCCACGAGCTGCTGCAAGATAGCAAGCCGGACAAGGAT ATGGAGGCTTCAGAACCAGGTGAAGGCTCGGGAGGCGAGTCTGCTGGAGGTGGAGACA AAGTCTCTGAAACTGGAACATTCCTGATCTCTCCCCACACAGAGGCCAGCAGACCTCT TCCTGAGGACTTCTGTTTAAAGGAGGACGAGGAGGAGGTTGGTGACAGTCAGGCCTGG GAGGAGCCCACAAACTGGAGCACAGAGACATGGAACCTAGCTACTTCCTGGGAGGTGG GGCGGGGACTACGGAGAAGGTGCAGCCAGGCTGTGGCAAAGGGCCCCAGTCACAGCCT TGGCTGGGAAGGAGGGACGACAGCTGAAGGTCGACTAAAACAAAGTCTGTTTTCATGA TGGAGTGCTCCTGTGTGTTTTTTCGATCCTAGTTGGTTGTACACACCCATACTAGGTG
CCTAAGGACAACTGGGCCTTCTTGAAGAGCTGTCCTTATTAGGACAAAAAGAGGCTGC
CTTCCAGTGTGACAGCAGAGAAGATAGAGGGAGCTCCAGCTCTTTTCCTCGTATTCCT
GAGGCCACCAGCATGCCCGCGTTCAGGGCCCAAAAATCCCTTTTCTCATAGCAAAACT
GAGACAGAAGGGTCTTTCCCAAAAAAAAGAAAAAAAAACTTTACTCAAATCCAGTGGA
JAAAATAAATGATAGAAACTATACACAACATAAAAATAGCCACATTTACAAAGCTGCAG
CCTTGATAAATGACGGGCCATGGACACAGCACAGAGCTTATCAGTCCCAAATCCCCTC lATCTGTGTTAGGGGCTGGTTCATTTGAGGTTTAGTTGGGTTGGACTTGGTTTCCTGAT!
TCTTCTTTTTTAATAAAATTTCTTAATTATTTTTTCTTAAATAGAGACAGGGTCTCACj
TCACTGTGTTGCCCAGGCTGGTCTTGAACTCCTGGGCTGGAATGATCCTGCCACCTCT!
GCTTCCCAAAGTGCTGGGATTACAGGCATGAGCCACTGTGCCTGGCCGTGATTTTTAAj
GAGTTGGTCAGATGATCTGGAGTAGCTTGGTCCAGGCAAACAGAAAGTGACCTTTGTC!
AAATCATGAAGGGTTCTGTTTTGTTCAGTACTGAAGATTCCTTTGTACTCTTGGCTGT iGACCTATCCCTGAGGTATCCTGAGTTCTGGAATCTATAAGATTCCTCTAGTTTTTCTGj
GCTGCTGATAGCCCAAGTCAGACTGTGGTACCAGCGTGACAGCTCCTCCTGGTCTGTG!
GACATAAGCAGTAGCTTCTCATGAGGGAAGGACAGGTGTGAGCTGTTGATGGTCAGGG!
CTGTTGGGACCTGTGTTTTCAGCCAAAGCTACGACGAGATTCTCATACTGCTGGAGCC iGTTGCAGAGGCAGAGGGAGCAGGTCCTGGAGCTGAAGGCCCCCAAACCCAGGGCGGCC
ITTCCTGAAGCCGTACAAACCTCCGGAAACCTTTATTTTTCTTTAGCTGCTCCTGCAGG
GTGGTCTGGGACCTCTCTGAGTTGGCAGCAAATTGGTTATAGAGCTCCAAGTGGCGGC
AGAAGCCCTCCAGCCCTTGGCCCCAGCATCCTCCTTCCAGGTAGGGAAGCAGCTCCTG iGCTGGCGCCGTAGATGAGCTCCCAGGAGCCAAACAGGGCCTGGCGCTCAGGTGGTCGC lAGGGTCCCCTTGGCTTTCAGGATCCCCAAAAAGTACGTGGCCACCAGCCCCAGCTGTT
CTTGGTAGCGCCGCTCGGTCTCTAGCAGCTCCCGGGCGGTGCAGGCGCGTTTCCGCTCj
CCAGCGGGCACGCTGCTCTTGCACCGGGCACCGCGAACCGGGGCAGGAGAGCTCCATG!
CCCTGGCTGAGGGATCGACACT
ORF Start: ATG at 77 ORF Stop: TGA at 926
SEQ ID NO: 66 3283 aa MW at 30494.7kD
NOVl 7a , MAGAVS LGWG LVSALSGVLGDRANPD RAHPGNAAHPGSGATEPRRRPP KDQR CG159015 - 01 ERTRAGSLPLGA YTAAVAAFV YKCLQGKDETAVLHEEASKQQPLQSEQQLAQ TQQ Protein Sequence LAQTEQHLNNLMAQLDP FERVTT AGAQQELLNMKLWTIHELLQDSKPDKDMEASEP GEGSGGESAGGGD VSETGTFLISPHTEASRPLPEDFCLKEDEEEVGDSQAWEEPTNW STETWN ATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS
SEQ ID NO: 67 1449 bp
NOVl7b, GGTGAGAAAGTTGGTGGCGTGAGATTAAAAAAACCGTTTTCGGGCATAACTTTCTAAG
CG159015- 02 DNA ACTATAGGCTTTCAGAGGCATTGTGGCTAGCAGAATAGCTAATAGACACGAAATGAAC
Sequence AAATACAGGAAAGCTAGAATGACACTATCTTATGCAAATATGGTCTGGCCCCGCCCTA
CGGGGAGTGGGCGTGGCCTCCCCGGAGCCGGCCGGCCTGCTCGCGTGCGCGTGCGCGT TGGGGCGGCCGGCCAATGCCGGACCGCTTCGGCACCGCCCGCCCGATCCCTCCACCCG TGGGCCGGCAATGGCGGGCGCAGTTTCGCTCTTGGGTGTGGTGGGGCTGCTGCTTGTG TCTGCGCTGTCCGGGGTCCTAGGAGACCGCGCCAATCCCGACCTCCGGGCACACCCAG GTAACGCAGCCCACCCCGGCTCTGGAGCCACGGAACCCCGGCGGCGACCACCGCTCAA GGATCAACGCGAGCGGACCCGGGCCGGGTCGCTGCCTCTGGGGGCGCTGTACACCGCG GCCGTCGCGGCTTTTGTGCTGTACAAGTGTTTGCAGGGGAAAGATGAAACTGCGGTTC TCCACGAGGAGGCAAGCAAGCAGCAGCCACTGCAGTCAGAGCAACAGCTGGCCCAGTT GACACAACAGCTGGCCCAGACAGAGCAGCACCTGAACAACCTGATGGCCCAGCTGGAC CCCCTTTTTGAGCGGGTGACTACTCTGGCTGGAGCCCAGCAGGAGCTTCTGAACATGA AGCTATGGACCATCCACGAGCTGCTGCAAGATAGCAAGCCGGACAAGGATATGGAGGC TTCAGAACCAGGTGAAGGCTCGGGAGGCGAGTCTGCTGGAGGTGGAGACAAAGTCTCT GAAACTGGAACATTCCTGATCTCTCCCCACACAGAGGCCAGCAGACCTCTTCCTGAGG ACTTCTGTTTAAAGGAGGACGAGGAGGAGATTGGTGACAGTCAGGCCTGGGAGGAGCC CACAAACTGGAGCACAGAGACATGGAACCTAGCTACTTCCTGGGAGGTGGGGCGGGGA CTACGGAGAAGGTGCAGCCAGGCTGTGGCAAAGGGCCCCAGTCACAGCCTTGGCTGGG AAGGAGGGACGACAGCTGAAGGTCGACTAAAACAAAGTCTGTTTTCATGATGGAGTGC
TCCTGTGTGTTTTTTCGATCCTAGTTGGTTGTACACACCCATACTAGGTGCCTAAGGA
CAACTGGGCCTTCTTGAAGAGCTGTCCTTATTAGGACAAAAAGAGGCTGCCTTCCAGT
GTGACAGCAGAGAAGATAGAGGGAGCTCCAGCTCTTTTCCTCGTATTCCTGAGGCCAC
CAGCATGCCCGCGTTCAGGGCCCAAAAATCCCTTTTCTCATAGCAAAACTGAGACAGA
AGGGTCTTTCCCAAAAAAAAGAAAAAAAACTTTACTCAAATCCAGTGGAAAAATAAA
ORF Start: ATG at 148 :ORF Stop: TGA at 1150
SEQ ID NO: 68 1334 aa MW at 35589.5kD
NOVl7b, MQIWSGPALRGVGVASPEPAGL ACACA GRPANAGP RHRPPDPSTRGPAMAGAVSL CG159015-02 LGWGLLLVSA SGV GDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGS Protein Sequence PLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQ AQ TQQLAQTEQH NN MAQLDP FERVTTLAGAQQE LNMK WTIHEL QDSKPD DMEASEPGEGSGGE SAGGGDKVSETGTF ISPHTEASRPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWN ATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQS FS
SEQ ID NO: 69 539 bp
NOV17C, CCGGCCAATGCCGGACCGCTTCGGCACCGCCCGCCCGATCCCTCCACCCGTGGGCCGG
CG159015-03 DNA CAATGGCGGGCGCAGTTTCGCTCTTGGGTGTGGTGGGGCTGCTGCTTGTGTCTGCGCT Sequence GTCCGGGGTCCTAGGAGACCGCGCCAATCCCGACCTCCGGGCACACCCAGGGAACGCA GCCCACCCCGGCTCTGGAGCCACGGAACCCCGGCGGCGACCACCGCTCAAGGATCAAC GCGAGCGGACCCGGGCCGGGTCGCTGCCTCTGGGGGCGCTGTACACCGCGGCCGTCGC GGCTTTTGTGCTGTACAAGTGTTTGCAGGGGAAAGATGAAACTGCGGTTCTCCACGAG GAGGCAAGCAAGCAGCAGCCACTGCAGTCAGAGCAACAGCTGGCCCAGTTGACACAAC AGCTGGCCCAGACAGAGCAGCACCTGAACAACCTGATGGCCCAGCTGGACCCCCTTTT TGAGCGCCCAGCAGGAGCTTCTGAACATGAAGCTATGGACCATCCACGAGCTGCTGCA AGATAGCAAGCCCGGAC
ORF Start: ATG at 61 ORF Stop: TAG at 526
SEQ ID NO : 70 155 aa MW at 16521 . 5kD
N0V17C , MAGAVS GWG LVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQR CG159015 - 03 ERTRAGSLPLGALYTAAVAAFV Y CLQGKDETAVLHEEASKQQPLQSEQQLAQ TQQ Protein Sequence AQTEQHLNNLMAQ DPLFERPAGASEHEAMDHPRAAAR SEQ ID NO: 71 774 bp
NOV17d, GTGCGCGTTGGGGCGGCCGGCCAATGCCGGACCGCTTCGGCACCGCCCGCCCGATCCC
CG159015-04 DNA TCCACCCGTGGGCCGGCAATGGCGGGCGCAGTTTCGCTCTTGGGTGTGGTGGGGCTGC Sequence TGCTTGTGTCTGCGCTGTCCGGGGTCCTAGGAGACCGCGCCAATCCCGACCTCCGGGC ACACCCAGGGAACGCAGCCCACCCCGGCTCTGGAGCCACGGAACCCCGGCGGCGACCA CCGCTCAAGGATCAACGCGAGCGGACCCGGGCCGGGTCGCTGCCTCTGGGGGCGCTGT ACACCGCGGCCGTCGCGGCTTTTGTGCTGTACAAGTGTTTGCAGGGGAAAGATGAAAC TGCGGTTCTCCACGAGGAGGCAAGCAAGCAGCAGCCACTGCAGTCAGAGCAACAGCTG GCCCAGTTGACACAACAGCTGGCCCAGACAGAGCAGCACCTGAACAACCTGATGGCCC AGCTGGACCCCCTTTTTGAGCGGTGAGGAGAGCAATGATTCTGTGAATTTTTGGGGAA
TTTGTGGCAGGAGGGAGGAATGGGGACATAGGTTGGGAGCCACTGAGTGGACATTTCT
TCAGTGTGACTACTCTGGCTGGAGCCCAGCAGGAGCTTCTGAACATGAAGCTATGGAC
CATCCACGAGCTGCTGCAAGATAGCAAGCCGGACAAGGATATGGAGGCTTCAGAACCA
GGTGAAGGCTCGGGAGGCGAGTCTGCTGGAGGTGGAGACAAAGTCTCTGAAACTGGAA
CATTCCTGATCTCTCCCCCA
ORF Start: ATG at 77 ORF Stop: TGA at 488
SEQ ID NO: 72 137 aa MW at 14665.5kD
NOV17d, GAVSL GWGLLLVSALSGVLGDRANPD RAHPGNAAHPGSGATEPRRRPP DQR CG159015-04 ERTRAGSLP GALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQ AQ TQQ Protein Sequence LAQTEQHLNN MAQ DPLFER
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 17B.
Further analysis of the NOVl 7a protein yielded the following properties shown in Table 17C.
Table 17C. Protein Sequence Properties NOVl 7a
PSort 0.8200 probability located in outside; 0.1000 probability analysis: located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in lysosome (lumen)
SignalP Cleavage site between residues 25 and 26 analysis : A search of the NOVl 7a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 17D.
In a BLAST search of public sequence datbases, e NOVl 7a protein was found to have homology to e proteins shown in the BLASTP data in Table 17E.
PFam analysis predicts mat the NOV17a protein contains the domains shown in me Table 17F.
Table 17F. Domain Analysis of NOV17a
Identities/
Pfam Domain NOV17a Match Region ] Similarities Expect Value for the Matched Region
No Significant Matches Found
Example 18.
The NOVl 8 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 18 A.
Table 18A. NOV18 Sequence Analysis
SEQ ID NO: 73 2463 bp
N0V18a, AACTCTCCTATTCATGGAGGCGAACACTGAGGATGCTTTCCACATGAACCCTGAAGTG
CG173007-01 DNA AACTTCTGATACATTTCCTGCAGCAAGAGAAGGCAGCCAACATGAAGGAAAATGTGGC Sequence ATCTGCAACCGTTTTCACTCTGCTACTTTTTCTCAACACCTGCCTTCTGAATGGACAG TTACCTCCTGGAAAACCTGAGATCTTTAAATGTCGTTCTCCCAATAAGGAAACATTCA CCTGCTGGTGGAGGCCTGGGACAGATGGAGGACTTCCTACCAACTCCTGCCACTTTGG CAAGCAGTACACCTCCATGTGGAGGACATACATCATGATGGTCAATGCCACTAACCAG ATGGGAAGCAGTTTCTCGGATGAACTTTATGTGGACGTGACTTACATAGTTCAGCCAG ACCCTCCTTTGGAGCTGGCTGTGGAAGTAAAACAGCCAGAAGACAGAAAACCCTACCT GTGGATTAAATGGTCTCCACCTACCCTGATTGACTTAAAAACTGGTTGGTTCACGCTC CTGTATGAAATTCGATTAAAACCCGAGAAAGCAGCTGAGTGGGAGATCCATTTTGCTG GGCAGCAAACAGAGTTTAAGATTCTCAGCCTACATCCAGGACAGAAATACCTTGTCCA GGTTCGCTGCAAACCAGACCATGGATACTGGAGTGCATGGAGTCCAGCGACCTTCATT CAGATACCTAGTGACTTCACCATGAATGATACAACCGTGTGGATCTCTGTGGCTGTCC TTTCTGCTGTCATCTGTTTGATTATTGTCTGGGCAGTGGCTTTGAAGGGCTATAGCAT GGTGACCTGCATCTTTCCGCCAGTTCCTGGGCCAAAAATAAAAGGATTTGATGCTCAT CTGTTGGAGAAGGGCAAGTCTGAAGAACTACTGAGTGCCTTGGGATGCCAAGACTTTC CTCCCACTTCTGACTATGAGGACTTGCTGGTGGAGTATTTAGAAGTAGATGATAGTGA GGACCAGCATCTAATGTCAGTCCATTCAAAAGAACACCCAAGTCAAGGTATGAAACCC ACATACCTGGATCCTGACACTGACTCAGGCCGGGGGAGCTGTGACAGCCCTTCCCTTT TGTCTGAAAAGTGTGAGGAACCCCAGGCCAATCCCTCCACATTCTATGATCCTGAGGT CATTGAGAAGCCAGAGAATCCTGAAACAACCCACACCTGGGACCCCCAGTGCATAAGC ATGGAAGGCAAAATCCCCTATTTTCATGCTGGTGGATCCAAATGTTCAACATGGCCCT TACCACAGCCCAGCCAGCACAACCCCAGATCCTCTTACCACAATATTACTGATGTGTG TGAGCTGGCTGTGGGCCCTGCAGGTGCACCGGCCACTCTGTTGAATGAAGCAGGTAAA GATGCTTTAAAATCCTCTCAAACCATTAAGTCTAGAGAAGAGGGAAAGGCAACCCAGC AGAGGGAGGTAGAAAGCTTCCATTCTGAGACTGACCAGGATACGCCCTGGCTGCTGCC CCAGGAGAAAACCCCCTTTGGCTCCGCTAAACCCTTGGATTATGTGGAGATTCACAAG GTCAACAAAGATGGTGCATTATCATTGCTACCAAAACAGAGAGAGAACAGCGGCAAGC CCAAGAAGCCCGGGACTCCTGAGAACAATAAGGAGTATGCCAAGGTGTCCGGGGTCAT GGATAACAACATCCTGGTGTTGGTGCCAGATCCACATGCTAAAAACGTGGCTTGCTTT GAAGAATCAGCCAAAGAGGCCCCACCATCACTTGAACAGAATCAAGCTGAGAAAGCCC TGGCCAACTTCACTGCAACATCAAGCAAGTGCAGGCTCCAGCTGGGTGGTTTGGATTA CCTGGATCCCGCATGTTTTACACACTCCTTTCACTGATAGCTTGACTAATGGAATGAT
TGGTTAAAATGTGATTTTTCTTCAGGTAACACTACAGAGTACGTGAAATGCTCAAGAA
TGTAGTCAGACTGACACTACTAAAGCTCCCAGCTCCTTTCATGCTCCATTTTTAACCA
CTTGCCTCTTTCTCCAGCAGCTGATTCCAGAACAAATCATTATGTTTCCTAACTGTGA
TTTGTAGATTTACTTTTTGCTGTTAGTTATAAAACTATGTGTTCAATGAAATAAAAGC
ACACTGCTTAGTATTCTTGAGGGACAATGCCAATAGGTATATCCTCTGGAAAAGGCTT
TCATGATTTGGCATGGGACAGACGGAAATGAAATTGTCAAAATTGTTTACCATAGAAA
GATGACAAAAGAAAATTTTCCACATAGGAAAATGCCATGAAAATTGCTTTTGAAAAAC iAACTGCATAACCTTTACACTCCTCGTCCATTTTATTAGGATTACCCAAATATAACCAT
TTAAAGAAAGAATGCATTCCAGAACAAATTGTTTACATAAGTTCCTATACCTTACTGA
CACATTGCTGATATGCAAGTAAGAAAT
ORF Start: ATG at 100 ORF Stop: TGA at 1891
SEQ ID NO: 74 597 aa MW at 66638.8kD
NOVl8a, MKENVASATVFTLLLFLNTCLLNGQ PPGKPEIFKCRSPNKETFTCWWRPGTDGG PT CG173007-01 NSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPE Protein Sequence DRKPYLWIKWSPPTLIDLKTGWFTL YEIR KPEKAAEWEIHFAGQQTEFKILS HPG Q Y VQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVA LKGYSMVTCIFPPVPGPKIKGFDAHLLEKG SEELLSALGCQDFPPTSDYEDL VEYL EVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPST FYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWP PQPSQHNPRSSYH NITDVCELAVGPAGAPATL NEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQD TPWLLPQEKTPFGSAKPLDYVEIHKVNKDGAIJSLLPKQRENSGKPKKPGTPENNKEYA KVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ LGGLDYLDPACFTHSFH
Further analysis of me NOVl 8a protein yielded me following properties shown in Table 18B.
Table 18B. Protein Sequence Properties NOV18a
PSort 0.4600 probability located in plasma membrane; 0.1447 analysis: probability located in microbody (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Cleavage site between residues 25 and 26 analysis ; A search of the NOVl 8a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 18C.
In a BLAST search of public sequence datbases, e NOVl 8a protein was found to have homology to the proteins shown in me BLASTP data in Table 18D.
PFam analysis predicts that the NOVl 8a protein contains the domains shown in the Table 18E.
Table 18E. Domain Analysis of NOV18a
Identities/
Pfa Domain i NOVlδa Match Region Similarities Expect Value for the Matched Region fn3 102..194 23/94 (24%) 0 . 051 58/94 (62%)
Example 19.
The NOVl 9 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 19A.
Table 19A. NOV19 Sequence Analysis
SEQ ID NO: 75 2221 bp
NOVl9a, AGCGGGCCGGGCGGCGGCGGGGAGATGCGGCTGCTGGCACTGGCGGCGGCCGCGCTGC
CG173357-01 DNA TGGCGCGGGCTCCGGCTCCGGAGGTCTGTGCGGCCCTCAATGTCACTGTGTCCCCGGG Sequence GCCCGTGGTTGACTACCTGGAGGGGGAGAATGCCACTCTCCTCTGCCACGTCTCCCAG AAAAGGCGGAAGGACAGCTTGCTGGCCGTGCGCTGGTTCTTTGCACACTCCTTCGACT CCCAGGAGGCCTTGATGGTGAAGATGACCAAGCTCCGGGTGGTGCAGTACTATGGGAA TTTCAGCCGCAGCGCCAAACGGCGGAGGCTGCGCCTGCTGGAGGAGCAGCGGGGGGCG CTCTACAGGCTCTCCGTCTTGACACTGCAGCCCTCCGATCAAGGGCATTACGTCTGCA GAGTCCAGGAAATCAGCAGGCACAGGAACAAGTGGACGGCCTGGTCCAATGGCTCCTC AGCCACGGAAATGAGAGTCATTTCCCTCAAAGCTTCTGAAGAGTCATCCTTTGAGAAA ACAAAAGAGACTTGGGCATTTTTTGAAGATCTCTATGTGTATGCTGTCCTCGTGTGCT GCATGGGGATCCTCAGCATTCTGCTCTTCATGCTGGTCATCGTCTGGCAGTCTGTGTT TAACAAGCGGAAATCCAGAGTGAGACATTATTTGGTGAAATGCCCTCAGAACAGCTCA GGGGAGAGCTGTCACTAGCGTGACCAGCTTGGCCCCACTACAGCCCAAGAAGGGCAAG
AGGCAGAAGGAGAAGCCTGACATTCCTCCCGCAGTCCCTGCCAAAGCTCCGATAGCCC
CCACGTTCCATAAACCGAAGCTGCTGAAACCACAGAGAAAAGTCACGCTGCCAAAGAT
TGCTGAGGAAAACTTAACCTATGCCGAGCTGGAGCTGATCAAACCCCACCGGGCTGCC
AAAGGCGCCCCCACCAGCACTGTCTACGCCCAGATCCTCTTCGAGGAGAACAAGCTGT
AGTACAGCGTCCACCTCCAGGTTCTATTTAATACCTGCCACCCAGTGATTTATGAAGC CTTGGAGACAAAGCCCTTATGTCTGTATTTTCACTCATGCCTTCTGAGTGGTGGGGAG
CCCCTTTTCAGCAGCATTCTGGGTGCCTTTGAAGAGGTACAAGCCTGCTCTCCCCAAA
AGAATCAGGGCCACAGCTCTTGACAGATCTCCCGGGACAAGATGCGCCTGGGTTTGAG CCCTGAGCGTAAGGATTCTGATCCTGAGAGCAGCCAAGGAGATTTTCTGCTGAGCCAA
ACCCCTTCACATTTTTCTCCTCTTTCCCCAGGTTTTCTTTAAAATCGTTTTTAAATCT TAATTTTACTCTCTACTCTTCCTGTATCCACGATACAAGCTCACAGTATATAGCTAGA
GGAAATGCCATTATGGACCCAACTGTAAGATGGCACATATGTTGGTTTTCCAAGGATC
AGATGGCATTGCAGGGCCACAGCCAACTGCTGATTGCCAGCACCACCTGAGATGGCAT CTCTTGTTTTAAATAGATGCACTAACCCTGAAGATTAAGGCCAGAGGGGCAGACTGAC
TAGAGAAGTATAAGGTCTGTCTCTGAATGCCATGGTGCCCACCTATGAGACCCTGAGG
CCGCAGACAAAGAAGAACACCATTCTAGAGGGCTTCCAGCCCTTTCACAAGGTGGACC
TGTACTGATAGAGAAACACACTCTCTAAGAAGTGCTTACTCACCCTTTTCCAAAGGAG
CACAGGTGTTGGCCATCAGAAGACACACTGGAGCGCATGGGCCTCTTCACTGTGTGCC lAAGCTCAGTCACCTCTGATTCAGCCCCTGAGGGTGTCTGCTGCCAGGTGCCCTCAGGGi iTAGGAGAGTGGGAAGTACACGCCAAGCTGGAAAGTGTGTTCTGAAGACCCTCCTCTTG
CCAAGTGCCTTGCCCATTGCAACCTTGTGTGTGAATTCTAATGGGTTTGAATGGGGGT
CAGGGTGCATGGGGAAGTTGCTCTGTGGACCTTTGGGACACAGGAATCTTGGACTTAC
TGGCAGGGGATCCATTCTGAAAGCACCATCCTGTCAACTGTGTTATTGAGGACATTTC
TTGATGTGAGTATAGTCTGGGTGGCTATTTACTGCCCACTATAGAAATTGTTTGACTA
TGTAGTGGACCATGTATATATGATAAATTATCTATTTTAAACACAAAAAAAAAAAAAA
AAAAAAAGGGCGGCCGC
IORF Start: ATG at 25 ORF Stop: TAG at 712
SEQ ID NO: 76 229 aa MW at 26166. lkD
NOVl9a, MRLLALAAAALLARAPAPEVCAALNVTVSPGPWDYLEGENATLLCHVSQKRRKDSLL CG173357-01 AVRWFFAHSFDSQEALMVKMTKLRWQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLT Protein Sequence LQPSDQGHYVCRVQEISRHRNKWTAWSNGSSATEMRVISLKASEESSFEKTKETWAFF EDLYVYAVLVCCMGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGESCH
Further analysis of me NOVl 9a protein yielded me following properties shown in Table 19B.
Table 19B. Protein Sequence Properties NOV19a
PSort 0 .4600 probability located in plasma membrane ; 0 .2000 analysis : probability located in lysosome (membrane) ; 0 . 1000 probability located in endoplasmic reticulum (membrane) ; 0 . 1000 probability located in endoplasmic reticulum (lumen)
SignalP Cleavage site between residues 23 and 24 analysis ;
A search of the NOVl 9a protein against the Geneseq database, a proprietary database at contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 19C.
In a BLAST search of public sequence datbases, me NOVl 9a protein was found to have homology to the proteins shown in e BLASTP data in Table 19D.
PFam analysis predicts that the NOVl 9a protein contains the domains shown in me Table 19E.
Table 19E. Domain Analysis of NOV19a
P am Domain J NOV19a Match Region 1 Identities/ Expect Value
Example 20.
The NOV20 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 20A.
Table 20A. NOV20 Sequence Analysis
SEQ ID NO: 77 1704 bp
NOV20a, ATGGGCGACTGGAGCTTTCTGGGAAGACTCTTAGAAAATGCACAGGAGCACTCCACGG
CG50387-01 DNA TCATCGGCAAGGTTTGGCTGACCGTGCTGTTCATCTTCCGCATCTTGGTGCTGGGGGC Sequence CGCGGCGGAGGACGTGTGGGGCGATGAGCAGTCAGACTTCACCTGCAACACCCGGCCG CCCGCCGTTGCCATCGGGTTCCCACCCTACTATGCGCACACCGCTGCGCCCCTGGGAC AGGCCCGCGCCGTGGGCTACCCCGGGGCCCCGCCACCAGCCGCGGACTTCAAAATGCT AGCCCTGACCGAGGCGCGCGGAAAGGGCCAGTCCGCCAAGCTCTACAACGGCCACCAC CACCTGCTGATGACTGAGCAGAACTGGGCCAACCAGGCGGCCGAGCGGCAGCCCCCGG CACTCAAGGCTTACCCGGCAGCGTCCACGCCTGCAGCCCCCAGCCCCGTCGGCAGCAG CTCCCCGCCACTCGCGCACGAGGCTGAGGCGGGCGCGGCGCCCCTGCTGCTGGATGGG AGCGGCAGCAGTCTGGAGGGGAGCGCCCTGGCAGGGACCCCCGAGGAGGAGGAGCAGG CCGTGACCACCGCGGCCCAGATGCACCAGCCGCCCTTGCCCCTCGGAGACCCAGGTCG GGCCAGCAAGGCCAGCAGGGCCAGCAGCGGGCGGGCCAGACCGGAGGACTTGGCCATC TAGTGCCC
ORF Start: ATG at 1 1 ORF Stop: TAG at 697
SEQ ID NO: 78 232 aa MW at 24185.8kD
NOV20a, MGDWSFLGRLLENAQEHSTVIGK-VWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTRP CG50387-01 PAVAIGFPPYYAHTAAPLGQARAVGYPGAPPPAADFKMLALTEARGKGQSAKLYNGHH Protein Secjuence HLLMTEQNWANQAAERQPPALKAYPAASTPAAPSPVGSSSPPLAHEAEAGAAPLLLDG SGSSLEGSALAGTPEEEEQAVTTAAQMHQPPLPLGDPGRASKASRASSGRARPEDLAI
SEQ ID NO: 79 1308 bp
NOV20b, ATGGGCGACTGGAGCTTTCTGGGAAGACTCTTAGAAAATGCACAGGAGCACTCCACGG
CG50387-03 DNA TCATCGGCAAGGTTTGGCTGACCGTGCTGTTCATCTTCCGCATTTTGGTGCTGGGGGC
Sequence CGCGGCCGAGGACGTGTGGGGCGATGAGCAGTCAGACTTCACCTGCAACACCCAGCAG CCGGGCTGCGAGAACGTCTGCTACGACAGGGCCTTCCCCATCTCCCACATCCGCTTCT GGGCGCTGCAGATCATCTTCGTGTCCACGCCCACCCTCATCTACCTGGGCCACGTGCT GCACATCGTGCGCATGGAGGAGAAGAAGAAAGAGAGGGAGGAGGAGGAGCAGCTGAAG AGAGAGAGCCCCAGCCCCAAGGAGCCACCGCAGGACAATCCCTCGTCGCGGGACGACC GCGGCAGGGTGCGCATGGCCGGCGCGCTGCTGCGGACCTACGTCTTCAACATCATCTT CAAGACGCTGTTCGAGGTGGGCTTCATCGCCGGCCAGTACTTTCTGTACGGCTTCGAG CTGAAGCCGCTCTACCGCTGCGACCGCTGGCCCTGCCCCAACACGGTGGACTGCTTCA TCTCCAGGCCCACGGAGAAGACCATCTTCATCATCTTCATGCTGGCGGTGGCCTGCGC GTCACTGCTGCTCAACATGCTGGAGATATACCACCTGGGCTGGAAGAAGCTCAAGCAG GGCGTGACCAGCCGCCTCGGCCCGGACGCCTCCGAGGCCCCGCTGGGGACAGCCGATC CCCCGCCCCTGCCCCCCAGCTCCCGGCCGCCCGCCGTTGCCATCGGGTTCCCCCCCTA CTATGCGCACACCGCTGCGCCCCTGGGACAGGCCCGCGCCGTGGGCTACCCCGGGGCC CCGCCACCAGCCGCGGACTTCAAAATGCTAGCCCTGACCGAGGCGCGCGGAAAGGGCC AGTCCGCCAAGCTCTACAACGGCCACCACCACCTGCTGATGACTGAGCAGAACTGGGC CAACCAGGCGGCCGAGCGGCAGCCCCCGGCGCTCAAGGCTTACCCGGCAGCGTCCACG CCTGCAGCCCCCAGCCCCGTCGGCAGCAGCTCCCCGCCACTCGCGCACGAGGCTGAGG CGGGCGCGGCGCCCCTGCTGCTGGATGGGAGCGGCAGCAGTCTGGAGGGGAGCGCCCT GGCAGGGACCCCCGAGGAGGAGGAGCAGGCCGTGACCACCGCGGCCCAGATGCACCAG CCGCCCTTGCCCCTCGGAGACCCAGGTCGGGCCAGCAAGGCCAGCAGGGCCAGCAGCG GGCGGGCCAGACCGGAGGACTTGGCCATCTAG
ORF Start: ATG at 1 ORF Stop: TAG at 1306
SEQ ID NO: 80 435 aa MW at 47427.5kD
NOV20b, MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQ CG50387-03 PGCENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLK Protein Sequence RESPSPKEPPQDNPSSRDDRGRVRMAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFE LKPLYRCDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHLGWKKLKQ GVTSRLGPDASEAPLGTADPPPLPPSSRPPAVAIGFPPYYAHTAAPLGQARAVGYPGA PPPAADFKMLALTEARGKGQSA LYNGHHHLLMTEQNWANQAAERQPPALKAYPAAST PAAPSPVGSSSPPLAHEAEAGAAPLLLDGSGSSLEGSALAGTPEEEEQAVTTAAQMHQ PPLPLGDPGRAS ASRASSGRARPEDLAI
SEQ ID NO: 81 954 bp
NOV20c, ATGGGCGACTGGAGCTTTCTGGGAAGACTCTTAGAAAATGCACAGGAGCACTCCACGG
CG50387-02 DNA TCATCGGCAAGGTTTGGCTGACCGTGCTGTTCATCTTCCGCATTTTGGTGCTGGGGGC Sequence CGCGGCCGAGGACGTGTGGGGCGATGAGCAGTCAGACTTCACCTGCAACACCCAGCAG CCGGGCTGCGAGAACGTCTGCTACGACAGGGCCTTCCCCATCTCCCACATCCGCTTCT GGGCGCTGCAGATCATCTTCGTGTCCACGCCCACCCTCATCTACCTGGGCCACGTGCT GCACATCGTGCGCATGGAGGAGAAGAAGAAAGAGAGGGAGGAGGAGGAGCAGCTGAAG AGAGAGAGCCCCAGCCCCAAGGAGCCACCGCAGGACAATCCCTCGTCGCGGGACGACC GCGGCAGGGTGCGCATGGCCGGCGCGCTGCTGCGGACCTACGTCTTCAACATCATCTT CAAGACGCTGTTCGAGGTGGGCTTCATCGCCGGCCAGTACTTTCTGTACGGCTTCGAG CTGAAGCCGCTCTACCGCTGCGACCGCTGGCCCTGCCCCAACACGGTGGACTGCTTCA TCTCCAGGCCCACGGAGAAGACCATCTTCATCATCTTCATGCTGGCGGTGGCCTGCGC GTCACTGCTGCTCAACATGCTGGAGATATACCACCTGGGCTGGAAGAAGCTCAAGCAG GGCGTGACCAGCCGCCTCGGCCCGGACGCCTCCGAGGCCCCGCTGGGGACAGCCGATC CCCCGCCCCTGCTGCTGGATGGGAGCGGCAGCAGTCTGGAGGGGAGCGCCCTGGCAGG GACCCCCGAGGAGGAGGAGCAGGCCGTGACCACCGCGGCCCAGATGCACCAGCCGCCC TTGCCCCTCGGAGACCCAGGTCGGGCCAGCAAGGCCAGCAGGGCCAGCAGCGGGCGGG CCAGACCGGAGGACTTGGCCATCTAG
ORF Start: ATG at 1 ORF Stop: TAG at 952
SEQ ID NO: 82 317 aa MW at 35397. lkD
NOV20C, MGDWSFLGRLLENAQEHSTVIGKVWLTVLFIFRILVLGAAAEDVWGDEQSDFTCNTQQ CG50387-02 PGCENVCYDRAFPISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLK Protein Sequence RESPSPKEPPQDNPSSRDDRGRVRMAGALLRTYVFNIIFKTLFEVGFIAGQYFLYGFE LKPLYRCDRWPCPNTVDCFISRPTEKTIFIIFMLAVACASLLLNMLEIYHLGWKKLKQ GVTSRLGPDASEAPLGTADPPPLLLDGSGSSLEGSALAGTPΞEEEQAVTTAAQMHQPP LPLGDPGRASKASRASSGRARPEDLAI
Sequence comparison of the above protein sequences yields me following sequence relationships shown in Table 20B.
Table 20B. Comparison of NOV20a against NOV20b and NOV20c.
NOV20a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOV20b 55..232 176/178 (98%) 258..435 178/178 (99%)
Further analysis of the NOV20a protein yielded the following properties shown in Table 20C.
Table 20C. Protein Sequence Properties NOV20a
PSort 0.7900 probability located in plasma membrane ; 0 .3748 analysis : probability located in microbody (peroxisome) ; 0.3000 probability located in Golgi body; 0.2000 probability located in endoplasmic reticulum (membrane)
SignalP Cleavage site between residues 42 and 43 analysis :
A search of the NOV20a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 20D.
In a BLAST search of public sequence datbases, the NOV20a protein was found to have homology to the proteins shown in the BLASTP data in Table 20E.
PFam analysis predicts mat e NOV20a protein contains the domains shown in me
Table 20F.
Table 20F. Domain Analysis of NOV20a
Identities/
Pfam Domain NOV20a Match Region Similarities Expect Value for the Matched Region connexin 1..118 65/247 (26%) 1 .4e- 09 89/247 (36%)
Example 21.
The NOV21 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 21 A.
Sequence comparison of e above protem sequences yields the following sequence relationships shown in Table 2 IB.
Further analysis of me NOV2 la protem yielded the following properties shown in Table 21C.
Table 21C. Protein Sequence Properties NOV21a
PSort 0.5500 probability located in endoplasmic reticulum analysis: (membrane); 0.1900 probability located in lysosome (lumen); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
SignalP Cleavage site between residues 23 and 24 analysis: A search of the N0V2 la protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 2 ID.
In a BLAST search of public sequence datbases, the NOV21a protein was found to have homology to me proteins shown in me BLASTP data in Table 2 IE.
aa.
CAC38966 Sequence 17 from Patent 1. .273 234/273 (85%) e-136
WO0119856 - Homo sapiens 1. .234 234/273 (85%)
(Human) , 234 aa.
Q9QXT5 NOTCH4-like protein 1. .272 214/274 (78%) e-129
(Vascular endothelial zinc 4. .277 232/274 (84%) finger 1) - Mus musculus
(Mouse) , 278 aa.
Q9DCP5 Vascular endothelial zinc 1. .272 203/274 (74%) e-119 finger 1 - Mus musculus 4. .264 220/274 (80%)
(Mouse) , 265 aa.
PFam analysis predicts at the NOV21a protein contains the domains shown in the Table 21F.
Example 22.
The NOV22 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 22A.
Table 22A. NOV22 Sequence Analysis
SEQ ID NO : 103 11303 bp
NOV22a , lATATCCAATGGGCTGATTTATCTGACGGTCATGGCCATGGATGCTGGCAACCCCCCTC
CG57542 - 01 DNA TCAACAGCACCGTCCCTGTCACCATCGAGGTGTTTGATGAGAATGACAACCCTCCCAC Sequence CTTCAGCAAGCCCGCCTACTTCGTCTCCGTGGTGGAGAACATCATGGCAGGAGCCACG GTGCTGTTCCTGAATGCCACAGACCTGGACCGCTCCCGGGAGTACGGCCAGGAGTCCA TCATCTACTCCTTGGAAGGCTCCACCCAGTTTCGGATCAATGCCCGCTCAGGGGAAAT CACCACCACGTCTCTGCTTGACCGAGAGACCAAGTCTGAATACATCCTCATJCGTTCGC
GCAGTGGACGGGGGTGTGGGCCACAACCAGAAAACTGGCATCGCCACCGTAAACATCA CCCTCCTGGACATCAACGACAACCACCCCACGTGGAAGGACGCACCCTACTACATCAA CCTGGTGGAGATGACCCCTCCAGACTCTGACGTGACCACGGTGGTGGCTGTTGACCCA GACCTGGGGGAGAATGGCACCCTGGTGTACAGCATCCAGCCACCCAACAAGTTCTACA GCCTCAACAGCACCACGGGCAAGATCCGCACCACCCACGCCATGCTGGACCGGGAGAA CCCCGACCCCCATGAGGCCGAGCTGATGCGCAAAATCGTCGTCTCTGTTACTGACTGT GGCAGGCCCCCTCTGAAAGCCACCAGCAGTGCCACAGTGTTTGTGAACCTCTTGGATC TCAATGACAATGACCCCACCTTTCAGAACCTGCCTTTTGTGGCCGAGGTGCTTGAAGG CATCCCGGCGGGGGTCTCCATCTACCAAGTGGTGGCCATCGACCTCGATGAGGGCCTG AACGGCCTGGTGTCCTACCGCATGCCGGTGGGCATGCCCCGCATGGACTTCCTCATCA ACAGCAGCAGCGGCGTGGTGGTCACCACCACCGAGCTGGACCGCGAGCGCATCGCGGA GTACCAGCTGCGGGTGGTGGCCAGTGATGCAGGCACGCCCACCAAGAGCTCCACCAGC ACGCTCACCATCCATGTGCTGGATGTGAACGACGAGACGCCCACCTTCTTCCCGGCCG TGTACAATGTGTCTGTGTCCGAGGACGTGCCACGCGAGTTCCGGGTGGTCTGGCTGAA CTGCACGGACAACGACGTGGGCCTCAATGCAGAGCTCAGCTACTTCATCACAGGTGCT GCCCCGGCCTCCGCCCACCTGTGCAGGCCTCCTGGGGCCCTGCCTCCACCCCTCCCAG ATGGACAGCCAGACTAGGTGGGGGCAG
ORF Start: ATG at 31 ORF Stop: TAG at 1291
SEQ ID NO: 104 420 aa MW at 45678.7kD
N0V22a, MAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSWENIMAGATVLFLNATDLD CG57542-01 RSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ Protein Sequence KTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTWAVDPDLGENGTLVY SIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIWSVTDCGRPPLKATSS ATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQWAIDLDEGLNGLVSYRMPV GMPRMDFLINSSSGVWTTTELDRERIAEYQLRWASDAGTPTKSSTSTLTIHVLDVN DETPTFFPAVYNVSVSEDVPREFRWWLNCTDNDVGLNAELSYFITGAAPASAHLCRP PGALPPPLPDGQPD
SEQ ID NO: 105 1113 bp
NO 2 b, GGATCCGCCACAGACCTGGACCGCTCCCGGGAGTACGGCCAGGAGTCCATCATCTACT 169258612 DNA CCTTGGAAGGCTCCACCCAGTTTCGGATCAATGCCCGCTCAGGGGAAATCACCACCAC Sequence GTCTCTGCTTGACCGAGAGACCAAGTCTGAATACATCCTCATCGTTCGCGCAGTGGAC GGGGGTGTGGGCCACAACCAGAAAACTGGCATCGCCACCGTAAACATCACCCTCCTGG ACATCAATGACAACCACCCCACGTGGAAGGACGCACCCTACTACATCAACCTGGTGGA GATGACCCCTCCAGACTCTGATGTGACCACGGTGGTGGCTGTTGACCCAGACCTGGGA GAGAATGGCACCCTGGTGTACAGCATCCAGCCACCCAACAAGTTCTACAGCCTCAACA GCACCACGGGCAAGATCCGCACCACCCACGCCATGCTGGACCGGGAGAACCCCGACCC CCATGAGGCCGAGCTGATGCGCAAAATCGTCGTCTCTGTTACTGACTGTGGCAGGCCC CCTCTGAAAGCCACCAGCAGTGCCACAGTGTTTGTGAACCTCTTGGATCTCAATGACA ATGACCCCACCTTTCAGAACCTGCCTTTTGTGGCCGAGGTGCTTGAAGGCATCCCGGC GGGGGTCTCCATCTACCAAGTGGTGGCCATCGACCTCGATGAGGGCCTGAACGGCCTG GTGTCCTACCGCATGCCGGTGGGCATGCCCCGCATGGACTTCCTCATCAGCAGCAGCA GCGGCGTGGTGGTCACCACCACCGAGCTGGACCGCGAGCGCATCGCGGAGTACCAGCT GCGGGTGGTGGCCAGTGATGCAGGCACGCCCACCAAGAGCTCCACCAGCACGCTCACC ATCCATGTGCTGGATGTGAACGACGAGACGCCCACCTTCTTCCCGGCCGTGTACAATG TGTCCGTGTCCGAGGACGTGCCACGCGAGTTCCGGGTGGTCTGGCTGAACTGCACGGA CAACGACGTGGGCCTCAATGCAGAGCTCAGCTATTTCATCACAGGTGCTGCCCCGGCC TCCGCCCACCTGTGCAGGCCTCCTGGGGCCCTGCCTCCACCCCTCCCAGATGGACAGC CAGACCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 106 JMW at 40369.7kD
N0V22b, GSATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVD 169258612 GGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTWAVDPDLG Protein Sequence ENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIWSVTDCGRP PLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQWAIDLDEGLNGL VSYRMPVGMPRMDFLISSSSGVWTTTELDRERIAEYQLRWASDAGTPTKSSTSTLT IHVLDVNDETPTFFPAVYNVSVSEDVPREFRWWLNCTDNDVGLNAELSYFITGAAPA SAHLCRPPGALPPPLPDGQPDLE
SEQ ID NO: 107 1114 bp
N0V22c, GGATCCGCCACAGACCTGGACCGCTCCCGGGAGTACGGCCAGGAGTCCATCATCTACT 169258615 DNA CCTTGGAAGGCTCCACCCAGTTTCGGATCAATGCCCGCTCCAGGGGAAATCACCACCA Sequence CGTCTCTGCTTGACCGAGAGACCAAGTCTGAATACATCCTCATCGTTCGCGCAGTGGA CGGGGGTGTGGGCCACAACCAGAAAACTGGCATCGCCACCGTAAACATCACCCTCCTG GACATCAATGACAACCACCCCACGTGGAAGGACGCACCCTACTACATCAACCTGGTGG AGATGACCCCTCCAGACTCTGATGTGACCACGGTGGTGGCTGTTGACCCAGACCTGGG GGAGAATGGCACCCTGGTGTACAGCATCCAGCCACCCAACAAGTTCTACAGCCTCAAC AGCACCACGGGCAAGATCCGCACCACCCACGCCATGCTGGACCGGGAGAACCCCGACC CCCATGAGGCCGAGCTGATGCGCAAAATCGTCGTCTCTGTTACTGACTGTGGCAGGCC CCCTCTGAAAGCCACCAGCAGTGCCACAGTGTTTGTGAACCTCTTGGATCTCAATGAC AATGACCCCACCTTTCAGAACCTGCCTTTTGTGGCCGAGGTGCTTGAAGGCATCCCGG CGGGGGTCTCCATCTACCAAGTGGTGGCCATCGACCTCGATGAGGGCCTGAACGGCCT GGTGTCCTACCGCATGCTGGTGGGCATGCCCCACATGGACTTCCTCATCAACAGCAGC AGCGGCGTGGTGGTCACCACCACCGAGCTGGACCGCGAGCGCATCGCGAAGTACCAGC TGCGGGTGGTGGCCAGTGATGCAGGCACGCCCACCAAGAGCTCCACCAGCACGCTCAC CATCCATGTGCTGGATGTGAACGACGAGACGCCCACCTTCTTCCCGGCCGTGTACAAT GTGTCTGTGTCCGAGGACGTGCCACGCGAGTTCCGGGTGGTCTGGCTGAACTGCACGG ACAACGACGTGGGCCTCAATGCAGAGCTCAGCTACTTCATCACAGGTGCTGCCCCGGC CTCCGCCCACCTGTGCAGGCCTCCTGGGGCCCTGCCTCCACCCCTCCCAGATGGACAG CCAGACCTCGAG
ORF Start: at 2 ORF Stop: end of sequence
SEQ ID NO: 108 1371 aa MW at 40080.6kD
NOV22C, DPPQTWTAPGSTARSPSSTPWKAPPSFGSMPAPGEITTTSLLDRETKSEYILIVRAVD 169258615 GGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTWAVDPDLG Protein Sequence ENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIWSVTDCGRP PLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQWAIDLDEGLNGL VSYRMLVGMPHMDFLINSSSG WTTTELDRERIAKYQLRWASDAGTPTKSSTSTLT IHVLDVNDETPTFFPAVYNVSVSEDVPREFRWWLNCTDNDVGLNAELSYFITGAAPA SAHLCRPPGALPPPLPDGQPDLE
SEQ ID NO: 109 1114 bp
NOV22d, GGATCCGCCACAGACCTGGACCGCTCCCCGGGAGTACGGCCAGGAGTCCATCATCTAC 169258621 DNA TCCTTGGAAGGCTCCACCCAGTTTCGGATCAATGCCCGCTCAGGGGAAATCACCACCA Sequence CGTCTCTGCTTGACCGAGAGACCAAGTCTGAATACATCCTCATCGTTCGCGCAGTGGA CGGGGGTGTGGGCCACAACCAGAAAACTGGCATCGCCACCGTAAACATCACCCTCCTG GACATCAATGACAACCACCCCACGTGGAAGGACGCACCCTACTACATCAACCTGGTGG AGATGACCCCTCCAGACTCTGATGTGACCACGGTGGTGGCTGTTGACCCAGACCTGGG GGAGAATGGCACCCTGGTGTACAGCATCCAGCCACCCAACAAGTTCTACAGCCTCAAC AGCACCACGGGCAAGATCCGCACCACCCACGCCATGCTGGACCGGGAGAACCCCGACC CCCATGAGGCCGAGCTGATGCGCAAAATCGTCGTCTCTGTTACTGACTGTGGCAGGCC CCCTCTGAAAGCCACCAGCAGTGCCACAGTGTTTGTGAACCTCTTGGATCTCAATGAC AATGACCCCACCTTTCAGAACCTGCCTTTTGTGGCCGAGGTGCTTGAAGGCATCCCGG CGGGGGTCTCCATCTACCAAGTGGTGGCCATCGACCTCGATGAGGGCCTGAACGGCCT GGTGTCCTACCGCATGCCGGTGGGCATGCCCCGCATGGACTTCCTCATCAACAGCAGC AGCGGCGTGGTGGTCACCACCACCGAGCTGGACCGCGAGCGCATCGCGGAGTACCAGC TGCGGGTGGTGGCCAGTGATGCAGGCACGCCCACCAAGAGCTCCACCAGCACGCTCAC CATCCATGTGCTGGATGTGAACGACGAGACGCCCACCTTCTTCCCGGCCGTGTACAAT GTGTCTGTGTCCGAGGACGTGCCACGCGAGTTCCGGGTGGTCTGGCTGAACTGCACGG ACAACGACGTGGGCCTCAATGCAGAGCTCAGCTACTTCATCACAGGTGCTGCCCCGGC CTCCGCCCACCTGTGCAGGCCTCCTGGGGCCCTGCCTCCACCCCTCCCAGATGGACAG CCAGACCTCGAG
ORF Start: at 2 ORF Stop: end of sequence
SEQ ID NO: 110 371 aa MW at 40487.9kD
NOV22d, DPPQTWTAPREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVD 169258621 GGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTWAVDPDLG Protein Sequence ENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIWSVTDCGRP PLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQWAIDLDEGLNGL VSYRMPVGMPRMDFLINSSSGVWTTTELDRERIAEYQLRWASDAGTPTKSSTSTLT IHVLDVNDETPTFFPAVYNVSVSEDVPREFRWWLNCTDNDVGLNAELSYFITGAAPA SAHLCRPPGALPPPLPDGQPDLE Ϊ73* SEQ ID NO: 111 1114 bp
NOV22e, GGATCCGCCACAGACCTGGACCGCTCCCGGGAGTACGGCCAGGAGTCCATCATCTACT 174307774 DNA CCTTGGAAGGCTCCACCCAGTTTCGGATCAATGCCCGCTCAGGGGAAATCACCACCAC Sequence GTCTCTGCTTGACCGAGAGACCAAGTCTGAATACATCCTCATCGTTCGCGCAGTGGAC GGGGGTGTGGGCCACAACCAGAAAACTGGCATCGCCACCGTAAACATCACCCTCCTGG ACATCAACGACAACCACCCCACGTGGAAGGACGCACCCTACTACATCAACCTGGTGGA GATGACCCCTCCAGACTCTGACGTGACCACGGTGGTGGCTGTTGACCCAGACCTGGGG GAGAATGGCACCCTGGTGTACAGCATCCAGCCACCCAACAAGTTCTACAGCCTCAACA GCACCACGGGCAAGATCCGCACCACCCACGCCATGCTGGACCGGGAGAACCCCGACCC CCATGAGGCCGAGCTGATGCGCAAAATCGTCGTCTCTGTTACTGACTGTGGCAGGCCC CCTCTGAAAGCCACCAGCAGTGCCACAGTGTTTGTGAACCTCTTGGATCTCAATGACA ATGACCCCACCTTTCAGAACCTGCCTTTTGTGGCCGAGGTGCTTGAAGGCATCCCGGC GGGGGTCTCCATCTACCAAGTGGTGGCCATCGACCTCGATGAGGGCCTGAACGGCCTG GTGTCCTACCGCATGCCGGTGGGCATGCCCCGCATGGACTTCCTCATCAACAGCAGCA GCGGCGTGGTGGTCACCACCACCGAGCTGGACCGCGAGCGCATCGCGGAGTACCAGCT GCGGGTGGTGGCCAGTGATGCAGGCACGCCCACCAAGAGCTCCACCAGCACGCTCACC ATCCATGTGCTGGATGTGAACGACGAGACGCCCACCTTCTTCCCGGCCGTGTACAATG TGTCTGTGTCCGAGGACGTGCCACGCGAGTTCCGGGTGGTCTGGCTGAACTGCACGGA CAACGACGTGGGCCTCAATGCAGAGCTCAGCTACTTCATCACAGGGTGCTGCCCCGGC CTCCGCCCACCTGTGCAGGCCTCCTGGGGCCTTGCCTCCACCCCTCCCAGATGGACAG CCAGACCTCGAG
|ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 112 372 aa ;MW at 40670.2kD
NOV22e, GSATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVD: 174307774 GGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGJ Protein Sequence ENGTLVYSIQPPNKFYSLNSTTG IRTTHAMLDRENPDPHEAELMRKIWSVTDCGRP PL ATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQWAIDLDEGLNGL SYRMPVGMPRMDFLINSSSGVWTTTELDRERIAEYQLRWASDAGTPTKSSTSTLT! IHVLDVNDETPTFFPAVYNVSVSEDVPREFRWWLNCTDNDVGLNAELSYFITGCCPG! LRPPVQASWGLASTPPRWTARPRX
Sequence comparison of the above protein sequences yields me following sequence relationships shown in Table 22B.
Further analysis of the NOV22a protein yielded the following properties shown in Table 22C.
Table 22C. Protein Sequence Properties NOV22a
PSort 0. 7900 probability located in plasma membrane ; 0.3000 analysis : probability located in microbody (peroxisome) ; 0.3000 probability located in Golgi body; 0 .2000 probability located in endoplasmic reticulum (membrane)
SignalP No Known Signal Sequence Predicted analysis :
A search of the NOV22a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 22D.
In a BLAST search of public sequence datbases, the NOV22a protein was found to have homology to me protems shown in the BLASTP data in Table 22E.
PFam analysis predicts mat the NOV22a protein contams the domains shown in the Table 22F.
Table 22F. Domain Analysis of NOV22a
Identities/
Pfam Domain NOV22a Match Region Similarities Expect Value for the Matched Region cadherin 35..128 41/108 (38%) 6.2e-17 67/108 (62%) cadherin 142..238 36/112 (32%) 3.1e-ll 67/112 (60%) cadherin 254..345 41/107 (38%) 1.9e-24 69/107 (64%)
Example 23.
The NOV23 clone was analyzed, and me nucleotide and encoded polypeptide sequences are shown in Table 23 A.
Table 23A. NOV23 Sequence Analysis
SEQ ID NO: 113 1772 bp
NOV23a, CTTTTGCACTGATCATTTCTCTTAATTGGCAGGTAACAAGGAGGGAGCGCATTCTTCC
CG57774-01 DNA ACCTTCTGGGTGCTGCTGAGTATCTTTCTGGGAGCAGTGGCCATGCTGTGCAAAGAGC Sequence AAGGGATCACTGTGCTGGGTTTAAATGCGGTATTTGACATCTTGGTGATAGGCAAATT CAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCATTAGAGAATCTC GGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCACCTCTGGAGGGG CTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCGGCCTTCACCGA GGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCGTAAACTACAAT TACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCTGTGTTTTGATT GGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGGGTAATTGCACT TGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGTGCTCTGAAGAC GGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTATCCCATTTCTCC CCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAGCGTGTCCTCTACCT CCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCCTGAGCAAACAT ACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATTCATCAACACGC TGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGC TCTGTCTGTGTGTCCCCTCAATGCTAAGGTACACTACAACATTGGCAAAAACCTGGCT GATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATC CCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCT ACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCT GCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGC AAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCT CGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAAT GCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCG ACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAAT ACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAA TACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAA GTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAA GAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAAT TACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCTGATCCTGTT
TCCTTCATGTTTTGAGTTTGAGTGTGTGTGTGCATGAGGCATATCATTAATAGTATGT
GGTTACATTTAACCATTTAAAAGTCTTAGACA
ORF Start: ATG at 101 IORF Stop: TGA at 1673
SEQ ID NO: 114 5 5224 aa MW at 59138.5 D
NOV23a, MLCKEQGITVLGLNAVFDILVIGKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTL CG57774-01 LTSGGAGMLYVRWRIMGTGPPAFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPW Protein Sequence WLCFDWSMGCIPLIKSISDWRVIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFL VIPFLPASNLFFRVGFVVAERVLyLPSVGyCVLLTFGFGALSKHTKKKKLIAAWLGI LFINTLRCVLRSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYRE AVRLNPKYV33AMNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSL R FEAAEQSYRTAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPBHSLAWNN MIILLDNTGNLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAI A NPNAASYHGNLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKK AV
SEQ ID NO: 115 1515 bp NOV23b, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 167200132 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCTGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 116 505 aa iMW at 57228. lkD
NOV23b, EFKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPP 167200132 AFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQL FRSALSVCPLNAKVHYNIGKNL-ADKGNQTAAIRYYREAVRLNPK-YVHAMNNLGNILKΞ RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 117 1515 bp
NOV23C, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 167200144 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCACCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCTGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGGCATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
'ORF Start : at 1 ORF Stop : end of sequence
MW at 57216. OkD
NOV23c, EFKFNVLEIVQ VLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPP 167200144 AFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCTPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSVGYCVLLTFGFGALS HTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQL FRSALSVCPLNAKVHYNIGKNL-ADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 119 1515 bp
N0V23d, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT
169252408 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCTGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAGGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TACACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
;ORF Start: at 1 ORF Stop: end of sequence
SEQ ro JO: 120 [505 aa |M at 57216.OkD
N0V23d, EFKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPP 169252408 AFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQL FRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMITLLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 121 1515 bp
N0V23e, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 169252412 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCCCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCCGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCTGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 122 505 aa MW at 57222. lkD
NOV23e, EFKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPP 169252412 AFTEVDNPAPFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGPICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQL FRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSL RFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 123 1515 bp
NOV23f, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT
169252424 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT SEQ ID NO: 129 1515 bp
N0V23i, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 169252481 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAGCGT GTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCGTGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTCGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 130 505 aa !MW at 57221. OkD
N0V23i, EFKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPP 169252481 AFTΞVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGE^RSEEQL FRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAI HRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSI-ANVLGKSQKY ESEALFLKAIKANPNAASYRGNLAVLYHRWGHL DLAKKHYEISSQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 131 1515 bp
NOV23j , GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 169252485 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATACTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCAGAGCGT GTCCTCTACCTCCCCAGCGTTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAAACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCA^ AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 132 505 aa |M MϊW at 57210. OkD
NOV23j , EFKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGILYVRWRIMGTGPP 169252485 AFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSVGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQL FRS-ALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPK-YVHAMNNLGNIL E RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRR YPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQ YKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 133 1515 bp
NOV23k, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 169252492 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGGCCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCATTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCCGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGGAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 134 1505 aa !MW at 57242. lkD
NOV23k, EFKFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPP 169252492 AFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSIGYCVLLTFGFGALSKHTKK KLIAAWLGILFINTLRCVLRSGEWRSEEQL FRSALSVCPLNAK\mYNIGKHLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLiAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 135 1515 bp
NOV231, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 174104491 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGACCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCATTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 136 MW at 57300.1kD
NOV231, EFKFNVLEIVQKVLHK-DKSLENLGMLRNGDLLFRMTLLTSGGAGMLYVRWRIMGTGPP 174104491 AFTEVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSIGYCVLLTFGFGALSKHTKK-KKLIAAWLGILFINTLRCVLRSGEWRSΞEQL FRSALSVCPLNA VHYNIGK-NLADKGNQTAAIRYYREAVRLNP YVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 137 855 bp
NO 23m, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT 169252509 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAG Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTATCGG AATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATG AAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAATTACGGTCTGCT GAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 142 285 aa !MW at 32515.7kD
NOV23o, EFSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYV 169252519 HAMNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLK-RFEAAEQSYR Protein Sequence TAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTG NLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAI ANPNAASYHG NLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQ KAVLE
SEQ ID NO: 143 855 bp
NOV23p, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT 169252524 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAA Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGTTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGG ACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGT ATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCT GAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGT AATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATC ACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATC TGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGT AATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATG AAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAATTACGGTCTGCT GAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 144 285 aa MW at 32543.8kD
NOV23p, EFSGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYV 169252524 HAMNNLGNILKERNELQEVEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYR Protein Sequence TAIKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTG NLAQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHG NLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 145 855 bp
NOV23q, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT 169252528 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAA Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGG ACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGT ATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCT GAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGT AATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATC ACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATC TGAAGCTTTATCCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGT AATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATG AAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAATTACGGTCTGCT GAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCCTCGAG
ORF Start : at 1 ORF Stop : end of (sequence NLAVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 151 1515 bp
NOV23t, GAATTCAAATTCAATGTTCTGGAAATTGTCCAGAAGGTACTACATAAGGACAAGTCAT 174104491 DNA TAGAGAATCTCGGCATGCTCAGGAACGGGGACCTCCTCTTCAGAATGACCCTGCTCAC Sequence CTCTGGAGGGGCTGGGATGCTCTACGTGCGCTGGAGGATCATGGGCACGGGCCCGCCG GCCTTCACCGAGGTGGACAACCCGGCCTCCTTTGCTGACAGCATGCTGGTGAGGGCCG TAAACTACAATTACTACTATTCATTGAATGCCTGGCTGCTGCTGTGTCCCTGGTGGCT GTGTTTTGATTGGTCAATGGGCTGCATCCCCCTCATTAAGTCCATCAGCGACTGGAGG GTAATTGCACTTGCAGCACTCTGGTTCTGCCTAATTGGCCTGATATGCCAAGCCCTGT GCTCTGAAGACGGCCACAAGAGAAGGATCCTTACTCTGGGCCTGGGATTTCTCGTTAT CCCATTTCTCCCCGCGAGTAACCTGTTCTTCCGAGTGGGCTTCGTGGTCGCGGAGCGT GTCCTCTACCTCCCCAGCATTGGGTACTGTGTGCTGCTGACTTTTGGATTCGGAGCCC TGAGCAAACATACCAAGAAAAAGAAACTCATTGCCGCTGTCGTGCTGGGAATCTTATT CATCAACACGCTGAGATGTGTGCTGCGCAGCGGCGAGTGGCGGAGTGAGGAACAGCTT TTCAGAAGTGCTCTGTCTGTGTGTCCCCTCAATGCTAAGGTTCACTACAACATTGGCA AAAACCTGGCTGATAAAGGCAACCAGACAGCTGCCATCAGATACTACCGGGAAGCTGT AAGATTAAATCCCAAGTATGTTCATGCCATGAATAATCTTGGAAATATCTTAAAAGAA AGGAATGAGCTACAGGAAGCTGAGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAG ACTTTGCCGCTGCGTGGATGAATCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGA AGCAGCAGAGCAAAGTTACCGGACAGCAATTAAACACAGAAGGAAATACCCAGACTGT TACTACAACCTCGGGCGTCTGTATGCAGATCTCAATCGCCACGTGGATGCCTTGAATG CGTGGAGAAATGCCACCGTGCTGAAACCAGAGCACAGCCTGGCCTGGAACAACATGAT TATACTCCTCGACAATACAGGTAATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCA CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGACATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 152 505 aa MW at 57300. lkD
NOV23t, EFKFNVLEIVQKVLHKDKSLENLGMLRNGDLLFRMTLLTSGGAGMLYVRWRIMGTGPP 174104491 AFTΞVDNPASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCIPLIKSISDWR Protein Sequence VIALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAER VLYLPSIGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQL FRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKE RNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDC YYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREA LELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHL DLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAVLE
SEQ ID NO: 153 843 bp
NOV23U, AGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGTGTCCCC
CG57774-02 DNA TCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAACCAGAC Sequence AGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTTCATGCC ATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTGAGGAGC TGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAATCTAGG CATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGGACAGCA ATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGTATGCAG ATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCTGAAACC AGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGTAATTTA GCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATCACTCTC TCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATCTGAAGC TTTATTCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGTAATTTG GCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATGAAATCT CTGGAATTAATACCTAATGATCACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGA AATCCCAGAAATACAAGGAATCTGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCC AAATGCTGCAAGTTACCATGGTAATTTGGCTGTGCTTTATCATCGTTGGGGGCATCTA GACTTGGCCAAGAAACACTATGAAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAA CTAAGGAGAATTACGGTCTGCTGAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGT CCTCGAG
ORF Start: at 7 ORF Stop: at 1510
SEQ ID NO: 160 501 aa MW at 56697.5kD
NOV23X, KFNVLEIVQKVLHKDKSLENLGMLRNGGLLFRMTLLTSGGAGMLYVRWRIMGTGPPAF CG57774-05 TEVDN ASFADSMLVRAVNYNYYYSLNAWLLLCPWWLCFDWSMGCTPLIKSISDWRVI Protein Sequence ALAALWFCLIGLICQALCSEDGHKRRILTLGLGFLVIPFLPASNLFFRVGFWAERVL YLPSVGYCVLLTFGFGALSKHTKKKKLIAAWLGILFINTLRCVLRSGEWRSEEQLFR SALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHAMNNLGNILKERN ELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYY NLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNLAQAEAVGREALE LIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRWGHLDL AKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAV iSEQ ID NO: 161 855 bp
NOV23y, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT
CG57774-06 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAA Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGG ACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGT ATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCT GAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGT AATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATC ACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATC TGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGT AATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATG AAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAATTACGGTCTGCT GAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCCTCGAG
ORF Start: at 7 ORF Stop: at 850
NOV23y, SGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHA CG57774-06 MNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTA Protein Sequence IKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNL AQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNL AVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAV
SEQ ID NO: 163 855 bp
N0V23Z, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT
CG57774-07 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAG Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTATCGG ACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGT ATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCT GAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGT AATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATC ACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATC TGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGT N0 23ab, SGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHA CG57774-09 MNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTA Protein Sequence IKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNL AQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNL AVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAV
SEQ ID NO: 169 855 bp
NOV23ac, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT CG57774-10 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAA Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGTTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGG ACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGT ATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCT GAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGT AATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATC ACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATC TGAAGCTTTATTCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGT AATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATG AAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAATTACGGTCTGCT GAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCCTCGAG
ORF Start: at 7 ORF Stop: at 850
SEQ ID NO: 170 281 aa IMW at 32025.2kD
NOV23ac, SGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHA CG57774-10 MNNLGNILKERNELQEVEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTA Protein Sequence IKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNL AQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNL AVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAV
SEQ ID NO: 171 855 bp
NOV23 d, GAATTCAGCGGCGAGTGGCGGAGTGAGGAACAGCTTTTCAGAAGTGCTCTGTCTGTGT CG57774-11 DNA GTCCCCTCAATGCTAAGGTTCACTACAACATTGGCAAAAACCTGGCTGATAAAGGCAA Sequence CCAGACAGCTGCCATCAGATACTACCGGGAAGCTGTAAGATTAAATCCCAAGTATGTT CATGCCATGAATAATCTTGGAAATATCTTAAAAGAAAGGAATGAGCTACAGGAAGCTG AGGAGCTGCTGTCTTTGGCTGTTCAAATACAGCCAGACTTTGCCGCTGCGTGGATGAA TCTAGGCATAGTGCAGAATAGCCTGAAACGGTTTGAAGCAGCAGAGCAAAGTTACCGG ACAGCAATTAAACACAGAAGGAAATACCCAGACTGTTACTACAACCTCGGGCGTCTGT ATGCAGATCTCAATCGCCACGTGGATGCCTTGAATGCGTGGAGAAATGCCACCGTGCT GAAACCAGAGCACAGCCTGGCCTGGAACAACATGATTATACTCCTCGACAATACAGGT AATTTAGCCCAAGCTGAAGCAGTTGGAAGAGAGGCACTGGAATTAATACCTAATGATC ACTCTCTCATGTTCTCGTTGGCAAACGTGCTGGGGAAATCCCAGAAATACAAGGAATC TGAAGCTTTATCCCTCAAGGCAATTAAAGCAAATCCAAATGCTGCAAGTTACCATGGT AATTTGGCTGTGCTTTATCATCGTTGGGGACATCTAGACTTGGCCAAGAAACACTATG AAATCTCCTTGCAGCTTGACCCCACGGCATCAGGAACTAAGGAGAATTACGGTCTGCT GAGAAGAAAGCTAGAACTAATGCAAAAGAAAGCTGTCCTCGAG
ORF Start: at 7 IORF Stop: at 850
SEQ ID NO: 172 81 aa MW at 31937. lkD
NOV23ad, SGEWRSEEQLFRSALSVCPLNAKVHYNIGKNLADKGNQTAAIRYYREAVRLNPKYVHA CG57774-11 MNNLGNILKERNELQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTA Protein Sequence IKHRRKYPDCYYNLGRLYADLNRHVDALNAWRNATVLKPEHSLAWNNMIILLDNTGNL AQAEAVGREALELIPNDHSLMFSLANVLGKSQKYKESEALSLKAIKANPNAASYHGNL AVLYHRWGHLDLAKKHYEISLQLDPTASGTKENYGLLRRKLELMQKKAV Sequence comparison of me above protein sequences yields the following sequence relationships shown in Table 23B.
Further analysis of the NOV23a protein yielded the following properties shown in Table 23C.
Table 23C. Protein Sequence Properties NOV23a
PSort 0 .6850 probability located in endoplasmic reticulum analysis : (membrane) ; 0.6400 probability located in plasma membrane ; 0 . 4600 probability located in Golgi body; 0 .1000 probability located in endoplasmic reticulum (lumen)
SignalP Cleavage site between residues 24 and 25 analysis : A search of the NOV23a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 23D.
In a BLAST search of public sequence datbases, the NOV23a protem was found to have homology to the proteins shown in the BLASTP data in Table 23E.
PFam analysis predicts that the NOV23a protein contains the domains shown in me Table 23F.
Example 24.
The NOV24 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 24A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 24B.
Further analysis of the NOV24a protein yielded the following properties shown in
Table 24C.
Table 24C. Protein Sequence Properties NOV24a
PSort 0.4600 probability located in plasma membrane; 0.1000 analysis: probability located in endoplasmic reticulum (membrane) ; 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
SignalP Cleavage site between residues 24 and 25 analysis:
A search of the NOV24a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 24D.
In a BLAST search of public sequence datbases, the NOV24a protein was found to have homology to the proteins shown in the BLASTP data in Table 24E.
PFam analysis predicts mat the NOV24a protein contains the domains shown in the
Table 24F.
Table 24F. Domain Analysis of NOV24a
Identities/
Pfam Domain I NOV24a Match Region Similarities Expect Value for the Matched Region serpm 46..420 224/394 (57%) 1.8e-216 345/394 (88%) Example 25.
The NOV25 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 25A.
Table 25A. NOV2S Sequence Analysis
SEQ ID NO: 187
NOV25a, JCGGATCCTCACACGACTGTGATCCGATTCTTTCCAGCGGCTTCTGCAACCAAGCGGGTCTTACCCCC CG57094-01 GGTCCTCCGCGTCTCCAGTCCTCGCACCTGGAACCCCAACGTCCCCGAGAGTCCCCGAATCCCCGCTC
CCAGGCTACCTAAGAGGATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACC DNA Sequence GCCGTGCTACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGA
GATGAATGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGTGCGCGAACACCGGAGCGCACCCGC
AGTCAGCTGAGCGCGCTGGAGCGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCC
ACCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACT
C-AAGGCT<^GAAC-AG( GGATCCAGCAACTCTTCCACAAGGTGGCCC^
AGC-AGCACCTGCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCAC-AAGCAC^^
GAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAA
TGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTG
GACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGA
GGCTGGACaGT-?UiTTCAGAGGCGC(^CGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAA
GGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGG
ACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCC
GTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGG
CGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCC
GC-AGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAAC
CTCAACGGCCAGTACTTCCGCTCCaTCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAA
GACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGG
CAGCCTCCTAGCGTCCTGGCTGGGCCTGGTCCCAGGCCCACGAAAGACGGTGACTCTTGGCTCTGCCC
GAGGATGTGGCCAAGACCaCGACTGGAGAAGCCCCCTTTCTGAGTGCAGGGGGGCTGCATGCGTTGCC
TCCTGAGATCGAGGCTGCAGGATATGCTCAGACTCTAGAGGCGTGGACCAAGGGGCaTGGAGCTTCAC
TCCTTGCTGGCCAGGGAGTTGGGGACTCAGAGGGACCACTTGGGGCCAGCCAGACTGGCCTCAATGGCi
GGACTCAGTCACATTGACTGACGGGGACCAGGGCTTGTGTGGGTCGAGAGCGCCCTCATGGTGCTGGT
GCTGTTGTGTGTAGGTCCCCTGGGGACACAAGCAGGCGCCAATGGTATCTGGGCGGAGCTCACAGAGT
TCTTGGAATAAAAGCAACCTCAGAACAAAAAΑAAA?-AAAAAAAA.GCGGAGCTC-ACAGAGTTCTTGGAA|
TAAΆAGCΆACCTCAGΛACAAΆAAA ORF Start: ATG at 154 ORF Stop: TAG at 1369
SEQ ID NO: 189 1155 bp
NOV25b, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGC JGC] 170075926 ACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCA.GCTGAGCGC GCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCG DNA Sequence TTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCa--AGCCTGC-AGACACAACTCAAGGCTCAGA AC-AGCaGGATCC-AGCAACTCTTC-_aαUiGGTGGCCCΑGCAGCaGCGGCACCTGGAG GCAGC--ACCT GCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCC AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCC GCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATT TGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGG ACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGG GGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGGAGGTGCATAGCATCACGGGGGACCG CAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTG Ca.CCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCG CCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCG CAGGGA--AAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAAC CTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGA AGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGA GGCAGCCTCCCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
NOV25b, RSGPVQSKSPRFAS DEMKVLAHG Q GQGLREHAERTRSQ SA ERR SACGSACQGTEGSTDLP 170075926 L-APESRVDPEVLHS QTQLRAQNSRIQQLFHKVAQQQRH EKQHLRIQHLQSQFGLLDHKHLDHEVA KPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQE FQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGW Protein TVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFW G EEVHSITGDRNSRLAVQLRDWDGNAE LQFSV Sequence HLGGEDTAYSLQ TAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKS SGGW FGTCSHSN LNGQYFRSIPQQRQK K-KGIFWKTWRGRYYPLQATTMLIQP AAEAASLE
SEQ ID NO: 191
NOV25c, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGCA 164225601 CGGACTCCTGC^GCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGCGC
TGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCGTTA DNA Sequence GCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGAACAG
CAGGATCCAGCAACTCTTCC-kC-^GGTGGCCCAGC^GCAGC∞
TTC-AGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCCAAGCCT
GCCCG--^GAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACA&TGTCAGCCGCCTGCA
CCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCC
AGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATT
CAGAGGCGCC-ACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGA
TCCCC-ACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACAGCCGCC
TGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGC
GAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCC
ACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACAAGAACT
GCGCCAAGAGCCTCTCTGaGGCTGGTGGTTTGGCACCTGC^GCCATTCCAACCTCaACGGCCAGTAC
TTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCG
CTACTACCCGCTG-AGGCCACCACCATGTTGATCCAGCCCΛTGGCAGCAGaGGCAGCCTCCCTCGAG
SEQ ID NO: 192 385 aa MW at 43440.6kD
NOV25C, RSGPVQSKSPRFASWDEMNV AHGLLQLGQGLREHAERTRSQ SALERRLSACGSACQGTEGSTDLPL 164225601 APESRVDPEVLHSLQTQLKAQNSRIQQ FHKVAQQQR-ΩEKQH RIQH QSQFG DHKHLDHEVAKP ARRKR PEMAQPVDPAHNVSR HR PRDCQELFQVGERQSGLFEIQPQGSPPFI.VNCKMTSDGGWTVI Protein QRRHDGSVDFNRPWEAYKAGFGDPHGEF LGLEKVHSITGDRNSRI-AVQ RDWDGNAELLQFSVH GG Sequence EDTAYSLQ TAPVAGQ GATTVPPSGLSVPFSTWDQDHDLRRDKNCASLSGGWWFGTCSHSNLNGQY FRSIPQQRQKLKKGIF KTWRGRYYPLQATTMLIQPMAAEAAS E
CTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGA AGACCTGGCGGGGCCGCCACTACCCGCTGCSLGGCCACCACCATGTCGATCCAGCCCATGGCAGCAGA GGCAGCCTCCCTCGAG
ORF Start: at 1 IORF Stop: end of sequence
!MW at 43388.5kD
NOV25d, RSGPVQSKSPRFASWDEMNVAHGLLQLGQGLREHAERTRSQ SALERR SACGSACQGTEGSTDLP 164225637 IAPESRVDPEVLHSLQTQ KAQNSRIQQLFH VAQQQRHI.EKQHLRIQH QSQFGLLDH HLDHEVA KPARRKR PEMAQPVDPAHNVSR HR PRDCQELFQVGERQSGLFEIQPQGSPPFVNCKMTSDGGW Protein TVIQR-^DGSVDFNRP EAY AGFGDPHGEFW GLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSV Sequence HLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSN LNGQYFRSIPQQRQKLKKGIFWKTWRGRHYPLQATTMSIQPMAAEAASLE
SEQ ID NO: 196
|NOV25e, RSGPVQSKSPRFASWDEMNVIAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDI.PL 170075926 APESRVDP-3VLHSLQTQLKAQNSRIQQLFH VAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKP RRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVKC MTSDGGWTVI Protein QRRHDGSVDFKRPWEAYKAGFGDPHGEFWLGLEEVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGG Sequence EDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQY FRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASLE
1239 bp
NOV25f, GACGTTAACATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTGCT 254120574 ACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATG TCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAG DNA Sequence CTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGA
CCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGG
CTCAGAACAGCAGGATCCAG( \ACTCTTCC!AC-AAGGTGGCCCAGCAGCΑ^^
C-ACCTGCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGT
GGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCA
GCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTA
TTTCIΪVIATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTG
GACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGG
GGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGC
AACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCA
CCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCA
CCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGG
GACAAGAACTGCGCO-AGAGCCTCTCTGGAGGCTGGTGGTTTGGC^CCTGC^GCCATTCCAACCTCAA
CGGC-AGTACTTCCGCTCCATCCCACAG--AGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCT
GGCGGGGTC^ ITCCTAGATCGATGGG
ORF Start: at 1 IORF Stop: TAG at 1228
NOV25f, DVNMSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASTTOEMNVLAHGLLQLGQGLREHAERTRSQ 254120574 LSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQ HLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGL Protein FEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDR Sequence NSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFST DQDHDLRR DKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAA s
SEQ IDNO: 199 1233 bp
NOV25g, AGATCTACCATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTGC 254156650 TACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAA TGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGT DNA Sequence CAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCA CCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACT C^^GGCTCAGAACAGCAGGATCCAGCAACTCTTCC-AΑUIGGTGGCCCΑGCΑGCAGCGGCACCTGGAG AAGC-AGCACCTGCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACC ATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCA CAATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAG AGTGGACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAG ATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGC CTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATC ACGGGGGACCGOACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGC AGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGG CCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGAT CACGACCTCCGCAGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCA GCCATTCCAACCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGG AATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCC ATGGCAGCAGAGGCAGCCTCCCTCGAG
ORF Start: at 1 iORF Stop: end of sequence
SEQ ID NO: 201
NOV25h, TCATCCCGGGATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTG 254500366 CTACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGA ATGTCCTGGCGCΑCGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAG DNA Sequence TCAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCC ACCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAAC TCΑAGGCTCAGAACAGC^GGATCCAGC-AACTCTTCCAαΛGGTGGCCCAGCAGCAGCGGCACCTGGA GAAG(^GCaCCTGCG-- TTCAGC-ATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGAC CaTGAGGTGGCGRAGCCTGCCCGAaG-- -AGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTC ACAATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCA GAGTGGACTATTTGAAATCCaGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCA GATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAG CCTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCAT CACGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTG CAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCG GCC&GCTGGGCGCCACC-ACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGA TCACGACCTCCGCAGGGAC-AAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGC
SEQ IDNO: 202 MWat45973.6kD
NOV25h, HPGMSGAPTAGAALMLC-AATAVLLSAQGGPVQSKSPRFASWDE JWLAHGLLQLGQGLREHAERTRS 254500366 QLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFH VAQQQRHLE KQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQ Protein SGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSI Sequence TGDRNSRIAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQD JHDLRRDKNCAKSLSGGWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQP IMAAEAASRRRX
SEQ IDNO: 203 1167bp
NOV25i, GACGTTAACATGGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCT 226679956 GGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGA GCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTC DNA Sequence CCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAA.CTCAAGGCTCA GAACAGCAGGATCCAGCAACTCTTCCACAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACC TGCGAATTCΑGC^TCTGOUUVGCC-AGTTTGGCCTCCTGGACCΑCAAGΑVCCTAGACCATGAGGTGGCC AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCG CCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTG AAATCCSGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACA GTAATTCΆGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTT TGGGGATCCCC^CGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACA GCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTG GGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCAC CGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACA AGAACTGCGCC-U-GAGCCTCTCTGGAGGCTGGTGGTTTGGC-ACCTGC^GCCATTCCAACCTCAACGGC CAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCG GGGCCGCTACTACCCGCTG(^GGC(^CC-AC(^TGTTGATCCAGCCCATGGC-AGCAGAGGCAGCCTCCT AGATCGATGGG
ORF Start: at 1 ORF Stop: TAG at 1156
SEQ ID NO: 204 385 aa MW at 43414.6kD
NOV25i, DVNMGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDL 226679956 LAPESRVDPEVLHSLQTQL AQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVA KP--FFIRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWT Protein VIQRRHDGSVDF- PW-^YKAGFGDPHGEFWLGLEKVHSITGDR SRLAVQLRDWDGNAELLQFSVHL Sequence GGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNG QYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
SEQ ID NO: 205 1187 bp
NOV25J, GACGTTAACATGGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCT 254500319 GGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGA GCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTC DNA Sequence CCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTC-AC^GCCTGC^GACACAACTCAAGGCTCA GAACAGCAGGATCCAGΑVACTCTTCTAΑ^GGTGGCCCSGI^GCAGCGGC^CCTGGAGAAGC-AGCACC TGCG-AATTCAGC-ATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCC
AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCG CCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTG AAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACA GTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTT TGGGGATCCCCaCGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACA GCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTG GGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCAC CGTCCCACCC-ΑGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACA AGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAACCTCAACGGC CAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCG GGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCCTCCT AGATCGATGGGAAGGGCGAATTCTGCAGATA
ORF Start: at 1 JORF Stop; TAG at 1156
SEQ ID NO: 206 385 aa MW at43414.6kD
NOV25J, DVNMGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHB-ERTRSQLSALERRLSACGSACQGTEGSTDL 254500319 PLAPESRVDPEVLHSLQTQLKAQNSRIQQLFH VAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVA KPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWT Protein VIQRRHDGSVDFNRPV.EAYKAGFGDPHGEFWLGLEKVHSITGDRI.SRLAVQLRDWDGNAELLQFSVHL Sequence GGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKHCAKSLSGGWWFGTCSHSNLNG QYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
SEQ ID NO: 207 1167 bp
NOV25k, TCATCCCGGGATGGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTC 254500445 CTGGCGaCGGACTCCTGCAGCTCGGCCaGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGC TGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGA DNA Sequence CCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAG GCTCAGAACAGCAGGATCCAGC^AACTCTTCCAα^GGTGGCCCaGCAGCAGCGGCACCTGGAGAAGC AGCACCTGCGAATTCaGCATCTGCAAAGCCΑGTTTGGCCTCCTGGAC(-ACAAGCACCTAGACCATGA GGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAAT GTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTG GACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGG AGGCTGGAC-AGTAATT(-AGAGGCGCC^CGATGGCTCa.GTGGACTTCAACCGGCCCTGGGAAGCCTAC AAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGG GGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTT CTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAG CTGGGCGCC-ACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACG ACCTCCGCAGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCA TTCC-AACCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATC TTCTGGAAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGG CAGCAGAGGCAGCCTCCCGTCGACGCGT
ORF Start: at 2 iORF Stop: end of sequence
SEQ ID NO: 208 389 aa MW at 43846.1kD
NOV25k, HPGMGPVQSKSPRFAS DEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTD 254500445 LPL-APESRVDPETOHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHE VAKPARRKRLPEMAQPVDPAHWSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLWCKMTSDG Protein GWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQF Sequence SVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSH SNLNGQYFRSIPQQRQ LKKGIFW TWRGRYYPLQATTMLIQPMAAEAASRRRX
SEQIDNO: 209 738 bp
NOV251, AGATCTCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCGCCTGCACCGGCTGCC 248210290 CAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCCAGCCTCAGG GGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATTCAGAGGCGC DNA Sequence CACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGATCCCCACGG CGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACAGCCGCCTGGCCGTGC AGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACG GCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGG CCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACAAGAACTGCGCC-AAGA GCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCC TTCC-AACCTCAACGGCCAGTACTTCCGCTCC ATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCC GCTGCAGGCC-ACC-ACCATGTTGATCΑ^GCCC-ATGGCAGCAGAGGCAGCCTCCCTCGAG
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 210 246 aa MW at27677.9kD
NOV251, RSLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCI MTSDGGWTVIQRR
248210290 HDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDT AYSLQLTAPVAGQLGATWPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRS
Protem IPQQRQ^^GIFWKTVGC?RYYPLQATTMLIQP Sequence
SEQ ID NO: 211 1218 bp
NOV25m, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAA.TGTCCTGGCGC 252514148 DNA ACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGC GCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCG Sequence TTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGA ACΑGCAGGATCCAGCAACTCTTCC CAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACCT GCGAATTC-AGI^TCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCC AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCC GCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCATGTTGGGGAGAGGCAGAGTGGACTATT TGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGG ACAGTAATT(^GAGGCGCCΑCGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTAC-AAGGCGG GGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCG CAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAA.CGCCGAGTTGCTGCAGTTCTCCGTG CACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCG CCaCC-ACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCG CAGGGACAAGAACTGCGCCAAGAGCCTCTCTGCCCCATCGGTGGCTCAAAGACCTGACCATGTTCCC TCTCCCCTGACCCCGGCAGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAACCTCAACGGCCAGT ACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAa.TCTTCTGGAAGACCTGGCGGGG CCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCCTCCCTC GAGAAGGGCGAA
ORF Start: at 1 ORF Stop: end of sequence
SEQ ID NO: 212 406 aa MW at45586.0kD
NOV25m, RSGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLP 252514148 LAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVA KPARR RLPEMAQPVDPAHNVSRLHRLPRDCQELFHVGERQSGLFEIQPQGSPPFLV CKMTSDGGW Protein TVIQRRHDGSVDFNRP EAYKAGFGDPHGEF LGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSV Sequence HLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSAPSVAQRPDHVP SPLTPAGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASL EKGE
SEQ ID NO: 213 1223 bp
NOV25n, CAGAATTCGCCCTTAGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGAT 252514189 GAATGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGC AGTCAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGT DNA Sequence CCACCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACA ACTCAAGGCTCAGAACAGCaGGATCCAGαU^CTCTTCCaC-AAGGTGGCCCAGCΑGCAGCGGCACCTG GAGAAGCAGCACCTGCGAATTCAGCATCTGC-AAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAG ACCATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGC TC-AC-^TGTCaGCCGCCTGα-CCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGG CAGAGTGGACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCT CAGATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGA AGCCTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGC ATCaTGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCSACGCCGAGTTGC TGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGC CGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAG GATCACGACCTCCGC^GGGAG^GAACTGCGCCAAGAGCCTCTCTGCCCCATCGGTGGCTCAAAGAC CTGACCATGTTCCCTCTCCCCTGACCCCGGCAGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAA CCTO^CGGCCAGTACTTCCGCTC(^TCCCA(^GCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGG AAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAG AGGCAGCCTCCCTCGAG
ORF Start: at 3 ORF Stop: end of sequence
SEQ ID NO: 214 J407 aT MW at 45753.2kD
NOV25n, EFALRSGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGS
252514189 TDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLD HEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTS
Protein DGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSIMGDRNSRLAVQLRDWDGNAELL
SEQ ID NO: 216 347 aa J MW at 39173.8kD
NOV25o, RSGPVQSKSPRFASWDEMNVLAHGLLQLGQGLRΞHAERTRΞQLSALERRLSACGSACQGTEGSTDLP 252514198 LAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVA KPARRKRLPEMAQPVDPAHNVSRLHHGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKV Protein HSIMGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTW Sequence DQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTML IQPMAAEAASLE
SEQ ID NO: 218 403 aa JMW a 45262.6kD
NOV25p, RSGPVQS PRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLP 252514202 LAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVA KPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLV CKMTSDGGW Protein TVIQRRHDGSVDFKRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSV Sequence HLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSAPSVAQRPDHVP SPLTPAGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASL E
MW at 46386.0kD
NOV25q, GSAAAPFTMSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHA 228039766 ERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQ QRHLEKQ1---LRIQHLQSQFGLLDHKHLDH-OTAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQ Protein VGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLE Sequence VHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFS TVTOQDHDLRRDKNCS KSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATT MLIQPMAAEAASKGGRA
NOV25r, GACGTTAACATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTGCT 226679952 ACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATG TCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAG DNA Sequence CTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGA CCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGG CTCAGAACAGCAGGATCC-AGα^CTCTTCCAαiAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAG C^CCTGCGAATTCaGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCaCAAGCACCTAGACCATGAGGT GGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCA GCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTA TTTGδAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTG GACiaGT-AaTTCSGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGG GGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGC AACAGCCGCCTGGCCTTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCA CCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCA CCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGG GACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGC-ACCTGC-AGCC-ATTCC-AACCTCAA CGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCT GGCGGGGCCGCTACTACCCGCTGC-AGGCC-AC(^CCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCC TCCTAGATCGATGGG
ORF Start: at 1 ORF Stop: TAG at 1228
SEQ ID NO: 222 409 aa MW at 45556.0kD
NOV25r, DV]^SGAPTAC-AALML(2AATAVLLSAQGGPVQSKSPRFASWDEMNVIιAHGLLQLGQGLREHAERTRSQ 226679952 LSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQ HLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHHVSRLHRLPRDCQELFQVGERQSGL Protem FEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWE-AYKAGFGDPHGEFWLGLEKVHSITGDR Sequence NSRLALQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRR DKNCΑKSLSGGIiWFGTCSH SEQ ID NO: 223 1143 bp
NOV25s, GGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGCACGGACT CG57094-02 CCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGCGCTGGAGC GGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCGTTAGCCCCT DNA Sequence GAGAGCCGGGTGGACCCTGAGGTCCTTCA(^GCCTGC-AGAC-ACAACTCAAGGCTCAGAACAGCAGGAT CCAGCAA.CTCTTCCACAAGGTGGCCC-AGCAGMGCGGCACCTGGAGAAGCAGCACCTGCGAATTCAGC ATCTGCAAAGCCAGTTTGGCCTCCTGGACI^C-AAGCACCTAGACCATGAGGTGGCCAAGCCTGCCCGA AGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCGCCTGCACCGGCT GCCCAGGGΆTTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCCAGCCTC AGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATTCAGAGG CGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGATCCCCA CGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACAGCCGCCTGGCCG TGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGCGAGGAC ACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCCACCCAG
CGGCCTCTCCGTACCCTTCTCOSLCTIGGGACCAGGATCACGACCTCCGCAGGGACAAGAACTGCGCCA
AGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAACCTCAACGGCCAGTACTTCCGC TCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCGCTACTA CCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCCTCC
SEQ ID NO: 224 381 aa !MW at 42955.0kD
NOV25s, GPVQSKSPRFASWDEMNVLAHGI-LQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAP CG57094-02 ESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPAR RKRLPEMAQPVDPAHNVSRLHRI..PRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQR Protein RHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRWSRLAVQLRDWDGNAELLQFSVHLGGED Sequence TAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFR1 S IPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
SEQ ID NO: 225 |1154 bp
NOV25t, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGCA CG57094-03 CGGACTCCTGCaGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGCGC TGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCGTTA DNA Sequence GCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGAACAG CAGGATCCAGCAACTCTTCOi.CAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACCTGCGAA TTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCAC-AAGCACCTAGACCATGAGGTGGCCAAGCCT GCCCGAaGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCGCCTGCA CCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCC AGCCTCaGGGGTCTCCGCCaTTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATT CAGAGGCGCC-ACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGA TCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACAGCCGCC TGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGC GAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCC ACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGATCTCCGCAGGGACAAGAACT GCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGC-ACCTGCAGCCATTCCAACCTCAACGGCCAGTAC TTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCG CTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGGAGCCTCCCTCGAG
JORF Start: at ϊ
SEQ ID NO: 226 384 aa iMW a 4337951-D
NOV25t, RSGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPL CG57094-03 APESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKP ARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVI Protein QRRHDGSVDFNRPWEAYKAGFGDPHGEF LGLE VHSITGDRHSRLAVQLRDWDGNAEIiLQFSVHLGG Sequence EDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQY FRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEEPPS
SEQ IDNO: 227 1155bp NOV25u, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGC CG57094-04 ACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGC GCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCG DNA Sequence TTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGA A(^G(^GGATCCAGC- CTCTTCC-AC-υ_GGTGGCCCAGCΑG<^GCGGCACCTGGAGAAGCAGCACCT GCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCC AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCC GCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATT TGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGG ACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGG GGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCG CAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTG CACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCG CCaCCACCGTCCCACCC GCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCG CAGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAAC CTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGA AGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGA GGCAGCCTCCCTCGAG
ORF Start: at 7 jORF Stop: end of sequence
SEQ ID NO: 228
NOV25u, GPVQSKSPRFASWDEMKVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLA CG57094-04 PESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKP ARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTV Protein IQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHL Sequence GGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGW FGTCSHSNLN GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASLE
NOV25v, GPVQSKSPRFASWDE NVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLA CG57094-05 PESRVDP---VLHSLQTQLRAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKP ARRKRLPEMAQPVDPAHKVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLV CKMTSDGGWTV Protein IQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHL Sequence GGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFST DQDHDLRRDKNCA SLSGGWWFGTCSHSNLN GQYFRSIPQQRQKLKKGIFWKTWRGRHYPLQATTMSIQPMAAEAAS
SEQ ID NO: 231 |U54bp
NOV25W, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGTGTCCTGGGACGAGATGAATGCCCTGGCGC
CG57094-06 ACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGC GCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCG DNA Sequence TTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGA ACAGCAGGATCCAGCAACTCTTCCACAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACCT GCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCC AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCC GCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATT TGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGG ACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGG GGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCATGGGGGACCG CAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTG CACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCG CCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCG C-AGGGAC^^GAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAAC CTOΛCGGCCAGTACTTCCGCTCCaTCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGA AGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGA GGCAGCCTCCTCGAG jORF Stop: at 1150
SEQ ID NO: 232 381 aa
NOV25w, GPVQSKSPRFVSWDEMNALAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLA CG57094-06 PESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKP ARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCIO.TSDGGWTV Protein IQRRHDGSVDFl^PWEAYKAGFGDPHGEFVπjGLEKVHSIMGDRHSRLAVQLEDWDGNAELLQFSVHL Sequence GGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
SEQ ID NO: 234 381 aa MWat 42956.0kD
NOV25x, GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLA CG57094-07 PESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKP ARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTV Protei IQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEEVHSITGDRNSRLAVQLRDWDGNAELLQFSVHL Sequence GGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
MW at 45213.7kD
NOV25y, MSGAPTAGAALMLOUVTAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLS CG57094-08 ALERRIiSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQH LRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGL Protein FEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGD Sequence RNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDL RRDKNCAKSLSGGHWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAA EAAS
NOV25z, GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPIiAP CG57094-09 ESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPAR RKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQR Protein RHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGED Sequence TAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSAPSVAQRPDHVPSPLTPAG GWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
SEQ ID NO: 239 1041 bp
NOV25aa, AGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGC CG57094-10 ACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGTCAGCTGAGCGC GCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCG DNA Sequence TTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGA AI^GCAGGATCCAGCAACTCTTCCACAAGGTGGCCCAGCAGCAGCGGC-ACCTGGAGAAGCAGCACCT GCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCC AAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCC GCCTGCACCATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCC CTGGGAAGCCTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTG CATAGCATCATGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCG AGTTGCTGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACC CGTGGCCGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGG GACCAGGATCACGACCTCCGCAGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTG GCACCTGCAGCC^TTCCAACCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCT TAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTG ATCCAGCCCATGGCAGCAGAGGCAGCCTCCCTCGAG
ORF Start: at 7 |ORF Stop: at 1036
SEQ ID NO: 240
NOV25aa, GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLA CG57094-10 PESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRR1.EKQHLRIQHLQSQFGLLDHKHLDHEVAKP ARR RLPEMAQPVDPAHNVSRLHHGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHS Protein Sequence IMGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFST DQ DHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQ PMAAEAS.S
SEQ ID NO: 241 (l223 bp
NOV25ab, CAGAATTCGCCCTTAGATCTGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGAT CG57094-11 GAATGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGC AGTCAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGT DNA Sequence CCACCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACA ACTO^GGCTCAGAACΑG(2AGGATCCAGα^CTCTTCC-Aα^GGTGGCCCaGCaGCAGCGGCACCTG GAGAAGCAGCACCTGCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAG ACCATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGC TCACaATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGG CAGAGTGGACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCT CAGATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGA AGCCTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGC ATCATGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGC TGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGC CGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAG GATCACGACCTCCGC-AGG-^CAAGAACTGCGCCAAGAGCCTCTCTGCCCCΑTC-raTGGCTCAAAGAC CTGACCATGTTCCCTCTCCCCTGACCCCGGCAGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAA CCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGG AAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAG AGGCAGCCTCCCTCGAG
ORF Start: at 21 JORF Stop: at 1218
MW at47035.7kD
NOV25ac, MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLS CG57094-12 ALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQH LRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGL Protein Sequence FEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGD RNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDL RRDKNCA SLSAPSVAQRPDHVPSPLTPAGGW FGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWR GRYYPLQATTMLIQPMAAEAAS
SEQ ID NO: 245 1233 bp
NOV25ad, lAGATCTACCATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTGC CG57094-13 TACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAA TGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGGAGCGCACCCGCAGT DNA Sequence CAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCA CCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACT CAAGGCTCAGAA(^GCAGGATC(^GCAACTCTTCC-ACAAGGTGGCCL^GCAGCAGCGGCACCTGGAG AAGCAGI^CCTGCGAATTCAGCATCTGC-AAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACC ATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCA CAATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAG AGTGGACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAG ATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGC CTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATC ACGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGC AGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGG CCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGAT CACGACCTCCGCAGGGACΆAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCA GCCATTCCAACCTOUICGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGG AATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCC ATGGCAGCAGAGGCAGCCTCCCTCGAG
ORF Start: ATG at 10 ORF Stop: at 1228
SEQ IDNO: 246 406 aa
NOV25ad, MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLS CG57094-13 ALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFH VAQQQRHLEKQH LRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGL Protein Sequence FEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGD RNSRLAVQLRDVIDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDL JSRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL KGIFWKTWRGRYYPLQATTMLIQPMAA
EAAS
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 25B.
Table 25B. Comparison of NOV25a against NOV25b through NOV25ad.
Further analysis of the NOV25a protein yielded the following properties shown in Table 25C.
A search of the NOV25a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table 25D.
In a BLAST search of public sequence datbases, the NOV25a protein was found to have homology to the proteins shown in the BLASTP data in Table 25E.
PFam analysis predicts that the NOV25a protein contains the domains shown in the Table 25F.
Example 26. NOV26
NOV26 includes a novel endozepine-related precursor-like protem and 17 variants. The disclosed sequences have been named NO V26a-r . NOV26a
NOV26a includes a novel endozepine-related protein disclosed below. A disclosed NOV26a nucleic acid of 1747 nucleotides (also referred to as CG51523-05) encoding a novel endozepine-related protein is shown in Table 26A. An open reading frame was identified beginning with an ATG initiation codon at nucleotides 36-38. A putative untranslated region upstream from the initiation codon is underlined in Table 26A. The start codon is in bold letters.
Table 26A. NOV26a nucleotide sequence (SEQ ID NO: 247).
ATGTACACAAACTAAACTACTGGACAACAAAAAGCAATGTAATCATCACAAACTAAGATT TTCTTGTGAACACCACAATCCAGTTCATTCTGAGGTCATCCAGTTCCAGTAGTCTTCTTG AGGAAAACACCATTTTCCTCAGTTCAGTTTTCTTCTCCTTCTTTGATAGTATAAATACAC CAACCACTGTGCAATAAAAGGCCATATGATGGCAAACGTTAGCACACCAGGAGACATCTC GAAGGGCCACCAAGATGGTCTCTGTGAGGTGGGCTGAGGAGCAGTCTGCAATGTTGATGT TGATGATTTTGCCTGCAAAGCAGTCAGCGTTTCCAGTTTCTGCAGTCTCTGAAGGACATT CTGCATGTCCTCCTGCAGTCTCATCAGCACGAGGGCGATCTGCTCATTGAGGCTGCCTCG GGACCCTCTGTCGGAGCCCCAGCGCTCCCCATCACCTCCACTTCCCACCTGCCGGCCCTT GGTTCCTTCGCTCAAGTGTTGTATCCTATGTCCTCTTCCTCTTCTAACATTAGAGAATTC GTCAGTTTCTCCGCCTCGCTTCTCCCGGTGTGGTGCTCCGCTGTTATTCCTGCCATCTTC TCCTCCATGCTTGACTTCACCTTTTCCTTCAACTGCAACCACCTGCATATTCCCAATGTT GCCATTTCCAGGAGGTACTTGAATATCTTCACGAAATCCAGAATTTTCCATGGGTTGACT GGAATGACCACCCAAGTAATACTGAAATGGTCCATTGTTGGACGTAAAGCTGTCTAAAGA CTCTTCTTGTCCAAATTGTTCCATAGAATCACAGTAAACTTCACTGTCTGAATCGCTTGT CAAATGCTGAATTCCTGTAACATCTTCAACATGATCATCATTTATATCTTGGTGAATGCA AACAGCAGATTTTCCAGTTTGCCCCAAGTTTTCATCAATGGGCTTTACTTCTTCAGTGCT TCTGCCATTCAGGGAAGAACTGGCATGAATGTCATTCTGTATATCCTGAACAAAGCCATC TTTATCATAGCCATTAGTGACAATGACTTCCAAATTCTTATGGTCTGCTGACTTCTTCAT CATTTTCTTATCATTATCACTTTGTTCTGCTCCTTTCACTTCTTCTTGGGCCTCTTCTTC CTCAGACTCGGCTCCACTGTCACTGCTTTCAGCTTTACCATTAACGGTTTTGGCGTTCGG AGCAGAAGTGAGAACATTACCAAGATCTGAGGTTATATCAGAACTCCTGCCACTCTTTTT GTCCTCGACAATTTCATAAAATGGACCTATGACACGCAGCAATTCTTCAACTTTCTCAGT CATTGGCATAGTTTCAATAATCTTTTTCATTTCTTCAACATATGCAATCATGGCTTCCTC TTTGGTCATATCACCCAGTGAACTCCAAGCATCCCATTTATATCTTCCAATAGGATCCCA AAATCCAGGCCTTGAAAGTTTACAGGGTCCTTCAGTTGCCTGCTTATAGAAGCTATAAAA TTTAAGCATCATTTCATTTGTTGGCTGGAATGAACCATTCTTCGGCAAACTCTGGATCAC CTTCACGGCCGCCTCAAACCTAGTCTCGTGCACGGATCTCGTGTCCGCCATCTCCAGCTG CCAGTGTTGGCCCCGGTCCCAAGGTCTGTCGGCGGGAATCAGGCAGCAGCAGCACCAGCT TTCCCAAGAGCCTGCATGAAACTGGAACATGGAGCGCAGCCGCGGATCAACATGCCCCAA AAGGAGA
The disclosed NOV26a polypeptide (SEQ ID NO: 22) encoded by SEQ ID NO: 21 has 523 amino acid residues and is presented in Table 26B using the one-letter amino acid code.
Table 26B. Encoded NOV26a protein sequence (SEQ ID NO: 248).
MFQFHAGSWESWCCCC IPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPK-NGS FQPTNEM LKFYSFY QATEGPCKLSRPGFWDPIGRYK DAWSS GDMTKEEAMIAYVEE MKKIIETMP TE VEELLRVIGPFYEIVEDKKSGRSSDITSDLG VLTSAPNAKTVNGKA ESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKN EVIVTNGYD!KDGFVQDIQND IHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDV GIQHITSDSDSEVYC
DSMEQFGQEES DSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQWAV EGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRIQHLSEGTKGRQVGSGGD GER GSDRGSRGSLNEQIALV MRLQEDMQNVLQRLQK ETLTA QAKSSTSTLQTAPQP TSQRPS WPFEMSPGVLTFAII PFIAQ VΎ YYQRRRRKLN
The full amino acid sequence of the disclosed NOV26a protein was found to have 518 of 534 amino acid residues (97%) identical to, and 520 of 534 amino acid residues (97%) similar to, the 534 amino acid residue ptnr:REMTRMBL-ACC:CAC24877 protein from sequence 23 from patent WO0078802. Public amino acid databases include the GenBank databases, SwissProt, PDB and MR. NOV26a is expressed in at least the following tissues: Brain, Colon, Foreskin, Kidney, Larynx, Lung, Mammary gland/Breast, Ovary, Pancreas, Placenta, Retina, Small Intestine, Spleen, Testis, Thalamus, and Uterus.
The amino acid sequence of NOV26a had high homology to other proteins as shown in Table 26C.
Table 26C. BLASTX results for NOV26a
Smallest Sum
High Prob
Sequences producing High-scoring Segment Pairs: Score PUT) patp:AAM78692 Human protein SEQ ID NO 1354 - Homo sapiens. 274Q 5.3e-285 patp:AAB48379 Human SEC12 protein sequence (clone ID 2093. 2733 2.9e-284 patp:AAU00399 Human secreted protein, POLY11 - Homo sapie. 2733 2.9e-284 patp:AAB48375 Human SEC8 protein sequence (clone ID 20936. 2727 1.3e-283 patp :AAB81816 Human endozepine-like END06 SEQ ID NO: 23 2687 2 .2e-279
The disclosed NOV26a polypeptide also has homology to the amino acid sequences shown in the BLASTP data listed in Table 26D.
The presence of identifiable domains in NOV26a was determined by searches using software algorithms such as PROSITE, DOMAIN, Blocks, Pfam, ProDomain, and Prints, and then determining the Inteφro number by crossing the domain match (or numbers) using the Inteφro website (http:www.ebi.ac.uk/ inteφro). DOMAIN results for NOV2a and its variants as disclosed in Table 30, were collected from the Conserved Domain Database (CDD) with Reverse Position Specific BLAST analyses. This BLAST analysis software samples domains found in theSmart and Pfam collections. For Table 30 and all successive DOMAIN sequence alignments, fully conserved single residues are indicated by black shading or by the sign (|) and "strong" semi-conserved residues are indicated by grey shading or by the sign (+). The "strong" group of conserved amino acid residues may be any one of the following groups of amino acids: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW.
Table 26E lists the domain description from DOMAIN analysis results against NOV26a. This indicates that the NOV26a sequence has properties similar to those of other proteins known to contain this domain.
Table 26E. Domain Analysis of NOV26a
ACBP (InterPro) Acyl CoA binding protein
ACBP: domain 1 of 1, from 41 to 129: score 199.7, E = 4.4e-56
NOV26b In an alternative embodiment, a NOV26 variant is NOV26b of 1432 nucleotides (also referred to as CG51523-05_164786042), shown in Table 26F. A NOV26b variant differs from NOV26a at positions 170, 374, 403, and 493.
Table 26F. NOV26b nucleotide sequence (SEQ ID NO: 249).
AAGCTTGACAGACCTTGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTT
TGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTT
ATAGCTTCTATAAGCAGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAA
TGGGATGCTTGGAGTTCACTGGGTGATATGACC-AAAGAGGARGCCATGATTGCATATGTTGAAGAAATGAAAAAGATTAT
TGAAACTATGCCAATGACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAA
AGAGTGGCAGGAGTTCTGATATAACCTCAGATCTTGGTAATGTTCTCACTTCTACTCCGAACGCCAAAACCGTTAATGGT
AAAGCTGAAAGCaGTGAf^GTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAAAGGAGCAGAACAAAGTGA
TAATGATAAGAAAATGATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATG
GCTTTGTTI^AGGATATAC-AGAATGACATTCATGCCΑGTTCTTCCCTG-z-ATGGaGAAGC-ACTGAAGAAGTAAAGCCCATT
GATGAAAA.CTTGGGGCAAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAAATGATGATCATGTTGAAGATGTTAC
AGGAATTCAGCATTTGACAAGCGATTCAGAC^GTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTT
TAGAC_AGCTTTACGTCCAAα^TGGAC(^TTTCAGTATTACTTGGGTGGTCATTCCAGTCAACCCATGGAAAATTCTGGA
TTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGCAGTTGAAGGAAAAGGTGA
AGTCAAGCATGGAGGAGAAGATGGCGGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAaCTGACGAAT
TCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGA
GGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAACGAGCAGATCGCCCTCGTGCTGATGAGACT
GC&GGAGGACATGCAGAATGTCCTTC&GAGACTGCAGAAACTGGAAACGCTGACT^
CAACATTGCAGACTGCTCCTCAGCCCACCTCACA.GAGACCATCTTGGTGGCCCTTCGAGATGCCCTCTCGAG Table 26G. Encoded NOV26b protein sequence (SEQ ID NO: 250).
KLDRP DRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSPYKQATEGPCKLSRPGFWDPIGRYK D A SSLGDMTKEE-AMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSDLGNVLTSTPNAKTVNGKAES SDSGAESEEEEAQEEVKGAEQSDI^KK MKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQ TGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVP PGNGNIGNMQWAVEGKGEVKHGGEDGGNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDR
GSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETIITALQAKSSTSTLQTAPQPTSQRPSWWPFEMPSR
NOV26c
In an alternative embodiment, a NOV26 variantis NOV26c of 1401 nucleotides (also referred to as CG51523-05_164732479), shown in Table 26H. A NOV26c variant differs fromNOV26a atpositions 71, 170, 313, and 403, andby an insertion of 11 amino acids at positions 161-162.
Table 26H. NOV26c nucleotide sequence (SEQ TD NO: 251).
AAGCTTACTAGGTTTGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAA&TGAAAT
GATGCTTAAATTTTATAGCTTCTATAAGCAGGCAACTGAAGGACCCTGTAARCTTTCAAGGCCTGGATTTTGGGATCCTA
TTGG--^GATATAAATGGGATGCTTGGAGTT<^CTGGGTGATATGACC-FTAAGGGGAAGCCATGATTGCATATGTTGAAGAA
ATGAAAAAGATTATTGAAACTATGCCAATGACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAAT
TGTCGAGGACAAAAAGAGTGGC^GGAGTTCTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATC
TTGGTAATGTTCTCACTTCTACTCCGAACGCCAAAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCT
GAGGAAGAAGAGGCCC-AAGAAGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAAATGATGAAGAAGTCAGCAGA
CCATAAGAATTTGGAAGTC-ATTGT- CTAATGGCTATGAT-?\AGATGGCTTTGTTCAGGATATACAGAATGACATTCATG
CCAGTTCTTCCCTGAATGGCAGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGGCAAACTGGAAAATCTGCT
GTTTGCATTCACO\AGATATAAATGATGATC^TGTTG-^GATGTTACAGGAATT(^GCATTTGACAAGCCATT(AGACAG
TGAAGTTTACTGTGATTCTATGGAAC-AATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGTCCAACAATGGACCATTTC
AGTATTACTTGGGTGGTCATTCCAGTCAΔ.CCCATGGAAAATTCTGGATTTCGTGAATATATTCAAGTACCTCCTGGAAAT
GGO^CATTGGGAATATGI^GGTGGTTGCAGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGGAGAAGATGGCAGGAATAA
CAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGA
TGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGG
TCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACT
GC&G-?IAACTGGAAACGCTC^CTGCTTTGC^GGCAAAAT^TC!AAC^
AGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCXCTCGAG
Table 261. Encoded NOV26c protein sequence (SEQ ID NO: 252).
KLTRFEAAVKVIQSLPKNGSFQPIΉEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYK DA SSLGDMTKGEAMIAYVEE MKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSVRLEKISKCLEDLGJWLTSTPNAKTVNGKAESSDSGAES EEEEAQEEVKGAEQSDNDKK MKKSADHKNLEVIVTNGYDI--DGFVQDIQNDIHASSSIINGRSTEEVKPIDENLGQTGKSA VCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREYIQVPPGN NIGNMQVVAVEGKGEV-KHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGS RGSLNEQIALVLMRLQEDMQNVLQRLQ3SLETLTALQAKSSTSTLQTAPQPTSQRPS PFEMSPLE
NOV26d
In an alternative embodiment, a NOV26 variant is NOV26d of 1401 nucleotides (also referred to as CG51523-05 64732506), shown in Table 26 J. A NOV26d variant differs from NOV26a at positions 170, 292, and 403, and by the insertion of 11 amino acids at position 161-162. Table 26J. NOV26d nucleotide sequence (SEQ ID NO: 253).
-AA.GCTTACTAGGTTTGAGGCGGCCGTG-^GGTGATCCΑGAGTTTGCCGAAGAATGGTTCATTCCAGCCΑACaAA.TGAART
GATGCTTAAATTTTATAGCTTCTATAAGCAGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTA
TTGGAAGATATAAATGGGATGCTTGGAGTTCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGCATATGTTGAAGAA
ATGAAAAAGATTATTGAAACTATGCCAATGACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAAT
TGTCGAGGACAAAAAGAGTGGCAGGAGTTCTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATC
TTGGTAATGTTCTCACTTCTACTCCAAACGCC-AAAACCGTTAATGGTAA--GCTGAAAGCAGTGACAGTGGAGCCGAGTCT
GAGGAAGAAGAGGCCCAAGAAGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAATGATGAAGAAGTCAGCAGA
CCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATG
C(aGTTCTTCCCTGAATGGCAGAAGCACTGAAGAAGTAAAGCCTATTGATGAAAACTTGGGGCAAACTGGAAAA.TCTGCT
GTTTGCATT(^Cα^GATATAAATGATGATCATGTTGAAGATGTTACAGGAATTCAGCATTTGACAAGCGATTCAGACAG
TGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGTCCAACAATGGACAATTTC
AGTATTACTTGGGTGGTCATTCCAGTC ACCCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAAT
GGC-AACATTGGGAATATGCAGGTGGTTGCaGTTGAAGGAAAAGGTGAAGTαiAGCATGGAGGAGAAGATGGCAGGAATAA
CAGCGGAGCGCCACACCGGGAGAAGCGAGGCGGAGAAACTGATGARTTCTCTAATGTTAGAAGAGGAAGAGGACATAGGA
TGCAACACTTGAGCGAA.GGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGG
TCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACT
GCAGA^CTGGAAACGCTGACTGCTTTGCΑGGCΑAAATC-ATC^
AGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTCTCGAG
Table 26K. Encoded NOV26d protein sequence (SEQ ID NO: 254).
KLTRFE-^VKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFVTOPIGRYK DA SSLGDMTKEEAMIAYVEEM KKIIETMPMTE1OTEELLRVIGPFYEIVED3^SGRSSDITSVRLEKISKCLEDLGNVLTSTPNAKTVNGKAESSDSGAESEE EAQEEVKGAEQSD-^KKMMKI SADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIH QDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGQFQYYLGGHSSQPMENSGFREDIQVPPGNNIGNM QWAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGER GSDRGSRGSLNE QIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRPS PFEMSPLE
NOV26e
In an alternative embodiment, a NOV26 variant is NOV26e of 1401 nucleotides (also referred to as CG51523-05_164732693), shown in Table 26L. A NOV26e variant differs from NOV26a at the protein level at positions 170 and 403, and by the insertion of 11 amino acids at position 161-162.
Table 26L. NOV26e nucleotide sequence (SEQ ID NO: 255).
AAGCTTACTAGGTTTGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAGaATGGTTCATTCCAGCCAACAAATGAAAT GATGCTTAAATTTTATAGCTTCTATAAGCAGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTA TTGGAAGATATAAATGGGATGCTTGGAGTTCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGCATATGTTGAAGAA ATGAAAAAGATTATTGAAACTATGCCAATGACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAAT TGTCGAGGACAAAAAGAGTGGCAGGAGTTCTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATC TTGGT.AATGTTCT(^CTTCTACTCCAAACGCαUVAACCGTTAATGGTAAAGCTGAAft.GCAGTGACAGTGGAGCCGAGTCT GAGGAAGAAGAGGCCC-r^GAAGAAGTGAAAGGAGC-AGaACAAAGTGATAATGATAAGAAARTGATGAAGAAGTCAGCAGA CCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATG CCAGTTCTTCCCTGAATGGCΛGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGGCAAACTGGAAAATCTGCT GTTTGCATTCACCAAGATATAAATGATGATCATGTTGAAGATGTTACAGGAATTCAGCATTTGACAAGCGATTCAGACAG TGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGTCCAACAATGGACCATTTC AGTATTACTTGGGTGGTCATTCCAGTCRACCCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAAT GGO^CATTGGGAATATGCAGGTGGTTGCaGTTGAAGGAAAAGGTGAaGTC-AAGCATGGAGGAGAAGATGGmGGAATAA CAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGA TGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGG TCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACT GC&GAAaCTGGAAACGCTGACTGCTTTGC-AGGCAAAATCATCMC^^ AGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTCTCGAG
Table 26M. NOV26e amino acid sequence (SEQ ID NO: 256).
KLTRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGF DPIGRYKWDAWSSLGDMTKEEAMIAYVEE KKIIETMPMTEKVEELLRVIGPFYEIVEDK-KSGRSSDITSVRLEKISKCLEDLEEEEAQEEVKGAEQSDITOK-KMMKKSADH KNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEV YCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNNIGNMQWAVEGKGEVKHGGEDGRNNSGAP HREKRGGETDEFSNVRRGRGHl^QHLSEGTKGRQVGSGGDGER GSDRGSRGSLNEQIALVLMR QEDMQNVLQRLQKLET LTAI-QAKSSTSTLQTAPQPTSQRPSWWPFEMSPLE
NOV26f
In an alternative embodiment, a NOV26 variant is NOV26f of 1368 nucleotides (also referred to as CG51523-05_164732709), shown in Table 26N. A NOV26f variant differs from NOV26a at the protein level at positions 170, 403, 449, and 485.
Table 26N. NO V26f nucleotide sequence (SEQ ID NO: 257).
AAGCTTACTAGGTTTGAGGCGGCCGTGAAGGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAAT GATGCTTAAATTTTATAGCTTCTATAAGCAGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTA TTGG-AaGATATAAATGGGATGCTTGGAGTTCACTGGGTGATATGACOU^GAGGAAGCCATGATTGCATATGTTGAAGAA ATGAAASAGATTATTGAAACTATGCCAATGACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAAT TGTCGAGGACAAAAAGAGTGGCAGGAGTTCTGATATAACCTCAGATCTTGGTAATGTTCTCACTTCTACTCCGAACGCCA AAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAAA.GGA GC^GAAOU\AGTGATAATGATAAGAAAATGATGAAGAAGTCAGCaGACCaTAAGAATTTGGAAGTCATTGTCACTAATGG CTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACTGAAG AAGTAAAGCCCATTGATGAAAACTTGGGGCAAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAAATGATGATCAT GTTGAAGATGTTACAGGAATTCAGCATTTGACGAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGG AC- GAAGAGTCTTTAGACAGCTTTACGTCCaA(^UiTGGACCATTTC-AGTATTACTTGGGTGGTCATTCCAGTCAA.CCCA TGG-AA-UlTTCTGGATTTCGTGAAGATATTαAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGCAGTT GAAGGAA-^GGCG-AAGTCAAGC^TGGAGGAGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGG AGAAACTGACGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGC AGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCCCTC GTGCTGATGAGACTGCAGGAGGAC^TACAGAATGTCCTTCaGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGCAGGC AAAATCATCAACATCAACATTGCAGACTGCTCCTmGCCCACCTCACAGAGATCATCTTGGTGGCCCTTCGAGATGTCTC CTCTCGAG
Table 260. Encoded NOV26f protein sequence (SEQ ID NO: 258).
KLTRFEAAVKVIQSLPKlTGSFQPTNEMMLI FYSFYKQATEGPCKLSRPGFVroPIGRYK DAWSSLGDMTKEEAMIAYVEEM KKIIETMPMTE-WEELLRVIGPFYEIVEDKKSGRSSDITSDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGEQ SDraDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVK-PIDENLGQTGKSAVCIHQDIETODHEDVT GIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQP ENSGFREDIQVPPGNGNIGN QWAVGKGEVK HGGEDGRNNSGAPHREKRGGETDEFSNVRRGRGHR QHLSEGTKGRQVGSGGDGER GSDRGSRGSLNEQIALVL RLQED IQKVLQRLQKLETLTALQAKSSTSTLQTAPQPTSQRSS WPFEMSPLE
NOV26g In an alternative embodiment, a NOV26 variant is NOV26g of 1586 nucleotides (also referred to as CG51523-05_164718189), shown in Table 26P. ANOV26g variant differs from NOV26a by 2 amino acids at positions 170 and 403.
Table 26P. NOV26g nucleotide sequence (SEQ ID NO: 259).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT T^CT∞GTGATATGACOU^GAGGAAGCCATGATTGC-ATATGTTGAAGAAATGAAAAAGATTATTGAAaCTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAA.TTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTC^GATCTTGGTAATGTTCT(aCTTCTACTCCGAACGCCaAAACCGTTAATGGTAAAGCTGAAAGCAGT GACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAaGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAAAT GATG-^GAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATGGCTTTGTTCAGGATA TACAGaATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGG CAAACTGGAAAATCTGCTGTTTGCATTC^Cα iGATATAAaTGATGATC-ATGTTGAAGATGTTACAGGAATTCAGCATTT GAC-AAGCGATTCaGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGT CC-AAC^^TGGACCATTT(^GTATTACTTGGGTGGTCATTC(--AGTα^CCCATGGAAAATTCTGGATTTCGTGAAGATATT CAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGCAGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGG AGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTCTAATGTTAGAA GAGGAAGAGGACaTAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGC TGGGGCTCCGAC-AGAGGGTCCCGAGGC^GCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGAC-ATGCA GAATGTCCTTC^GAGACTGCaGAAACTGGAAACGCTGACTGCTTTGCAGGCAAAATCaTC-AACATCAACATTGCAGACTG CTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTGGTGTGCTAACGTTTGCCATCATATGG CCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAGAAGAAAACTGAACCTCGAG
Table 26Q. Encoded NOV26g protein sequence (SEQ ID NO: 260).
ASTMFQFHAGSWES CCCCLIPADRPWDRGQHWQLE ADTRSVHETRFEAAV VIQSLPKNGSFQPTNEMMLKFYSFYKQ ATEGPCKI.SRPGFVroPIGRYKWDA SSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDK-KSGRSS DITSDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDI QNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTS NNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVRR GRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSIiTEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTSTLQTA PQPTSQRPS WPFEMSPGVLTFAII PFIAQWLVYLYYQRRRRKLNLE
NOV26h
In an alternative embodiment, a NOV26 variant is NOV26h of 1618 nucleotides (also referred to as CG51523-05_164718193), shown in Table 26R. A NOV26h variant differs from NOV26a by the first twenty amino acids, and the 3 amino acids at positions 170, 182 and 403. In addition, NOV26h differs from NOV26a by the insertion of eleven amino acids at position 161-162.
Table 26R. NOV26h nucleotide sequence (SEQ ID NO: 261).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCGCCGACAGACCTT GGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAAG GTGATCCAGAGTTTGCCGAAGAATGGTTC-ATTCCaGCα^CaAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGCA GGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGTT CACTGGGTGATATGACCaAAGAGGAAGCCATGATTG(ATATGTTGAAGAAATGAAAaAGATTATTGAAACTATGCC-AATG ACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTTC TGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATCTTGGTAATGTTCTCACTTCTACTCCAAACG CCAAA&CCGTTAATGGTAAAGCTGAAGGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAAA GGAGCAGAACAAAGTGATAATGATAAGAAAATGATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTAA TGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACTG AAGAAGTAAAGCCCATTGATGAAAACTTGGGGCAAACTGGAAAA.TCTGCTGTTTGCATTCACCAAGATATAAATGATGAT CATGTTGAAGATGTTACAGGAATTCAGCaTTT-^aiGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATT TGGACAAGAAGAGTCTTTAGACaGCTTTACGTCCAACAATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAAC CCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGCA GTTGAS.GGAAAAGGTGAAGTCAAGCATGGAGGAGARGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGG CGGAGAAA.CTGACGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCC GGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCC CTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGCA GGCAAAATCATCAACATCAACATTGCAGACTGCTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGT CTCCTGGTGTGCTAACGTTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAGA AGAAAACTGAACCTCGAG
Table 26S. Encoded NOV26h protein sequence (SEQ ID NO: 262).
SFH-WPVSCRLLGKLVLLLPDS-MJRP DRGQH QLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQA TEGPCKLSRPGF DPIGRYKDA SSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDI TSVRLEKISKCLEDLGNVLTSTPNAKTVNGKAEGSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYD KDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEE SLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGN QWAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDE FSNVrøGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTS TLQTAPQPTSQRPS WPFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLNLE
NOV26i
In an alternative embodiment, a NOV26 variant is NOV26i of 1586 nucleotides (also referred to as CG51523-05_164718197), shown in Table 26T. A NOV26i variant differs from NOV26a by 4 amino acids at positions 170, 403, 422 and 466.
Table 26T. NOV26i nucleotide sequence (SEQ ID NO: 263).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT
TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA
GGTGATCCaGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC
AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT
TC-ACTGGGTGATATGACαiAAGAGGAAGCCATGATTG(^TATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCαU^
GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT
CTGATATAACCTCAGATCTTGGTAATGTTCTCACTTCTACTCCGAACGCCAAAACCGTTAATGGTAAAGCTGAAAGCAGT
GACAGTGGAGCCGAGTCTGAGGAAGAA-ΪAGGCCC-AAGAaGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAAAT
GATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATGGCTTTGTTCAGGATA
TAC^GAATGACATTCaTGCCAGTTCTTCCCTGAATGGCAGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGG
CAAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAA&TGATGATCATGTTGAAGATGTTACAGGAATTCAGCATTT
GACAAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGT
CC-AACAATGGACCATTTCAGTATTACTTGGGTGGT( TTCCAGTCAACCCATGGAAAATTCTGGATTTCGTGAAGATATT
CAAGTACCTCCTGGAAATGG(AACATTGGGAATATGCAGGTGGTTGCAGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGG
AGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTCTAATGTTAGAA
GAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGGGCGC
TGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGACATGCA
GAATGTCCTTI^GAGACTGCaGAAACTGGAAACGCTGACTGCTTTGCGGGCAAAATCATCAACATCAACATTGCAGACTG
CTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTGGTGTGCTAACGTTTGCCATCATATGG
CCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAGAAGAAAACTGAACCTCGAG Table 26TJ. Encoded NOV26i protein sequence (SEQ ID NO: 264).
ASTMFQFHAGS ESWCCCCLIPADRP DRGQH QLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFY QA TEGPCKLSRPGF DPIGRYKDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDI TSD GNV TSTP AKTV GK ESSDSGAESEEEEAQE-WKGAEQSDNDKKΦ1KIS DHKNLEVI TNGYDKDGFVQDIQND IHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGP FQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRHNSGAPHREKRGGETDEFSNVRRGRGHR MQHLSEGTKGRQVGSGGDGGR GSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALRAKSSTSTLQTAPQPTSQ RPSW PFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLNLE
NOV26J
In an alternative embodiment, a NOV26 variant is NOV26J of 1517 nucleotides (also referred to as CG51523-05_164718205), shown in Table 26V. ANOV26J variant differs from NON26a by 4 amino acids at positions 35, 121, 170 and 403, and by a deletion of twenty-three amino acids at position 350.
Table 26V. ΝOV26J nucleotide sequence (SEQ ID NO: 265).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGCCAA.CACTGGCAGCTGGAGATGGTGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCAGAGTTTGCCGAAG-^TGGTTCATTCC-AGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TCACTGGGTGATATGACC-AAAGAGGAAGCCATGATTGC^TATGTTGAAGAAGTGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGT(^-.TAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGATCTTGGTAATGTTCTCACTTCTACGCCAAACGCCAAAACCGTTAATGGTAAAGCTGAAAGCAGT GACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCOUiGAAGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAAAT GATGAAGAAGTCaGCAGACCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATGGCTTTGTTCAGGATA TA^GAATGACATTCATGCCAGTTCTTCCCTGAATGGtøGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGG (^AAACTGGAAAATCTGCTGTTTGCATTi^CC-AAGATATAAATGATGATCATGTTGAAGATGTTACaGG TTC-AGCATTT GAOUiGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGT CO^C^^TGGACCATTTCAGTATTACTTGGGTGGTC-ATTCCAGTCAACCCATGGAAAATTCTGGATTTCGTGAAGATATT CAAGTACCTCCTGGAAATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTC TAATGTTAGAAGAGGAAGAGGAC-ATAGGATGCAAC-ACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTG ATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAG GAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGCAGGCAAAATCATCAACATCAAC ATTGCAGACTGCTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTGGTGTGCTAACGTTTG CCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAGAAGAAAACTGAACCTCGAG
Table 26W. Encoded NOV26J protein sequence (SEQ ID NO: 266).
AST FQFHAGS ES CCCCLIPADRPWDRGQH QLEMVDTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQ ATEGPCKLSRPGFWDPIGRYKDASSLGDMTKEEAMIAYVEEVIOIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSS DITSD GN TSTPNAKT NGK ESSDSGAESEEEEAQEEVKGAEQSDNDKK-^mKKS DHKNI.EVIVTNGYDKDGFVQDI QNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTS NNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGRNNSGAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGD GERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQLETLTALQAKSSTSTLQTAPQPTSQRPS PPEMSPGVLTFA IIWPFIAQWLVYLYYQRRRRKLNLE
NOV26k
In an alternative embodiment, a NOV26 variant is NOV26k of 1361 nucleotides (also referred to as CG51523-05_164718209), shown in Table 26X. A NOV26k variant differs from NOV26a by 68 amino acid deletion at position 208 and 2 amino acid changes. In addition, at position 162, an 11 amino acid sequence replaces an 18 amino acid sequence.
Table 26X. NOV26k nucleotide sequence (SEQ ID NO: 267).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT
TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA
GGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC
AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT
TCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGCATATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT
GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT
CTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAG
GAAGAAGAGGCCCAAGAAGAAGTGAAAGGAGCAGAACAAAGTGATAATGATATAAATGATGATCATGTTGAAGATGTTAC
AGGAATTCaGCATTTGAO^GCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTT
TAGACAGCTTTACGTCCAACAATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAACCCATGGAAAATTCTGGA
TTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCaACATTGGGAATATGCAGGTGGTTGCAGTTGAAGGAAAAGGTGA
AGTCAAGCATGGAGGAGAAGATGGCAGGAATAACAGCGGAGCGCCACACCGGGAGAAGCGAGGCGGAGAAACTGATGAAT
TCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGA
GGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACT
GC^GGAGGACATGCAG-?UiTGTCCTTCAGAGACTGCAGAAACTGGAAACGCT^^
CAACATTGCAGACTGCTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTGGTGTGCTAACG
TTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGCGTATTTATACTATCAAAGAAGGAGAAGAAAACTGAACCTCGA
G
Table 26Y. Encoded NOV26k protein sequence (SEQ ID NO: 268).
ASTMFQFHAGS ES CCCC IPADRPWDRGQH QLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQ ATEGPCIO.SRPGF DPIGRYKraJAWSSLGDMTKEEM.IAYVEEMKKIIETMPMTEKVEE RVIGPFYEIVEDKKSGRSS DITSVR EKISKC E-AESSDSGAESEEEEAQEEVKGAEQSDNDINDDHVEDVTGIQH TSDSDSEVYCDSMEQFGQEESL DSFTSNNGPFQYYLGGHSSQP ENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEF SNVRRGRGHRMQHLSEGTKGRQVGSGGDGER GSDRGSRGSLNEQIALVLMRLQEDMQNVLQR QKLET TALQAKSSTS T QTAPQPTSQRPSW PFEMSPGV TFAII PFIAQ LAY YYQRRRRKLN EG
NOV261
In an alternative embodiment, a NOV26 variant is NOV261 of 1619 nucleotides (also referred to as CG51523-05_164718213), shown in Table 26Z. A NOV261 variant differs from NOV26a by 5 amino acid changes, and an 11 amino acid insertion at position 161-162.
Table 26Z. NOV261 nucleotide sequence (SEQ ID NO: 269).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGGCCT TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TaCTGGGTGATATGACCAAAGAGGAAGCCATAATTGCATATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATCTTGGTAATGTTCTCACTTCTACTCCGAAC GCCaAAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAA AGGAGCaG-?UiCAAAGTGATAATGATAAGAAAATGATGAAGAAGTC^G(^GAC(^TAAGAATTT∞AAGTCaTTGTCACTA ATGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACT G-ωG-^AGTAAAGCCCATTGATGAAAACTTGGGGI^AAACTGGAAAATCTGCTGTTTGCATTI^CCAAGATATAAATGATGA TC-ATGTTGAAGATGTTACAGGAATTCAGCATTTGA(AAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAAT TTGGACAAGAAGAGTCTTTAGA(^GCTTTACGTC(^ACAATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAA CCCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTTGTTGC AGTTGAAGGAAAAGGCGAAGTI^-AGCATGGAGGAGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGGAGCGAG GCGGAGAAACTGACGAATTCTCT-J^TGTTAG GAGG-i^GAGGACATAGGATGCaACaCTTGAGCGAAGGAACCAAGGGC CGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCATATCGC CCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGC AGGCaAAATCATCAACaTCAACATTGCaGACTGCTCCTCAGCCCACCT(^CAGAGACCATCTTGGTGGCCCTTCGAGATG TCTCCTGGTGTGCTAACGTTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAG AAGAAAACTGAACCTCGAG
Table 26AA. Encoded NOV26I protein sequence (SEQ ID NO: 270).
AST FQFHAGS ES CCCCLIPADRP DRGQHWQLEMADTRSVHETRFEAAVKVIQS PiXNGSFQPTNEMM KFYSFY QA TEGPCKLSRPGF DPIGRYKWDA SS GDMTKEEAIIAYVEE KIIETMPMTE VEELBRVIGPFYEIVEDKKSGRSSD ITSVRLEKISKCLEDLGNVLTSTPNKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDND KMMKKSADHKNLEVIVTOGY DKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDI1TDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQ EESLDSFTSNNGPFQYY GGHSSQMENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEDGRNNSGAPHREERGGET DEFSNVRRGRGHRMQH SEGTKGRQVGSGGDGERWGSDRGSRGSLNEHIAV MRLQEDMQNVLQR QKLETLTALQAKS STSTLQTAPQPTSQRPSWWPFEMSPGVLTFAIIWPFIAQ VY YYQRRRRK NLE
NOV26m
In an alternative embodiment, a N0V26 variant is NOV26m of 1619 nucleotides (also referred to as CG51523-05J 66190452), shown in Table 26AB. A NOV26m variant differs from NOV26a by 4 amino acid changes, and an 11 amino acid insertion at position 161-162.
Table 26AB. NOV26m nucleotide sequence (SEQ ID NO: 271).
-AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT
TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA
GGTGATCC^GAGTTTGCCGAAGAATGGTTI^TTCC-AGCf^ΛCAAATGAAGTGATGCTTAAATTTTATAGCTTCTATAAGC
AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT
TCACTGGGTGATATGACCAAAGAGGAAGCCATGATTG^TATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT
GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCI^TTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT
CTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATCTTGGTAATGTTCTCACTTCTACTCCAAAC
GCCAAAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAA
AGGAGCΑGAAOiAAGTGATAATGATAAGAAAATGATGAAGAAGTCAGCAGACCa.TAAGAATTTGGAAGTCATTGTCACTA
ATGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACT
GAAGAAGTAAAGCCTATTGATGAAAACTTGGGGCAAACTGGAAAATCTGCTGTTTGCATTI^CCAAGATATAAATGATGA
TC TGTTGAAGATGTTAC-AGG-AATTC&G--ATTTGACAAGCGATTCAGA^
TTGGACAAGAAGAGTCTTTAGAC-AGCTTTACGTCαUiα^TGGACCATTT^GTATTACTTGGGTGGTCATTCCAGTα^
CCC-ATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGC
AGTTGAAGGAAAAGGTGAAGTCAAGaTGGAGGAGAAGATC5GCΑGGAATAACAGCGGAGCGCαiCACCGGGAGAAGCGAG
GCGGAGAAACTGATGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGC
CGGCaGGTGGGAAGTGGAGATGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGC
CCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGC
AGGCAAAATC!ATCAACATCAACATTGC&GACTGCTCCTCAGCC--A^
TCTCCTGGTGTGCTAACGTTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAG
AAGAAAACTGAACCTCGAG
Table 26AC. Encoded NOV26m protein sequence (SEQ ID NO: 272).
ASTMFQFHAGS ESWCCCCLIPADRPDRGQHWQ EMADTRSVHETRFΞAAV^IQSLPISNGSFQPT--IEV KFYSFYKQA TEGPC SRPGFVTOPIGRYKM.A SSLGD TKEEAMIAYVEEMKKIIETMPMTEKVEE RVIGPFYEIVEDKKSGRSSD ITSVR E ISKCLEDLGNV TSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKI&EVIVΓNG YDKDGFVQDIQNDIHASSSIINGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFG QEESLDSFTSNNGPFQYYLGGHSSQP ENSGFREDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGG ETDEFSNVRRGRGHRMQHI.SEGTKGRQVGSGDDGERWGSDRGSRGSLNEQIA VLMIILQEDMQNV QR QKLETLTALQA KSSTSTLQTAPQPTSQRPSW PFEMSPGVLTFAII PFIAQ JJVYLYYQRRRRKI.NLE
NOV26n In an alternative embodiment, a NOV26 variant is NOV26n of 1619 nucleotides (also referred to as CG51523-05_166190467), shown in Table 26AD. Similarly to a NOV26n variant, a NOV26n variant differs from NOV26a by 4 amino acid changes, and an 11 amino acid insertion at position 161 - 162.
Table 26AD. NOV26n nucleotide sequence (SEQ ID NO: 273).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGCATATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATCTTGGTAATGTTCTCACTTCTACTCCAAAC GCCAAAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAA AGGAGCAGAACAAAGTGATAATC-ATAAGAAAATGATGAAGAAGTCAG(^GACCATAAGAATTTGGAAGTCATTGTCACTA ATGGCTATGATAAAGATGGCTTTGTTCAGGATATGCAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACT GAAGAAGTAAGGCCTATTGATC-UUiAACTTGGGGC-AAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAAATGACGA TC-ATGTTG-z^GATGTTACAGGAATTCAGCATTTGACAAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAAT TTGGAC-AAGAAGAGTCTTTAGACAGCTTTACGTCO^CAATGGACCΑTTTCaGTATTACTTGGGTGGTCATTCCAGTCAA CCCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGC AGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGGAGAAGATGGCAGGAATAACAGCGGAGCGCCACACCGGGAGAAGCGAG GCGGAGAAACTGATGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGC CGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGC CCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGC AGGCAAAATCaTCAACATCAACaTTGCAGACTGCTCCTCaGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATG TCTCCTGGTGTGCTAACGTTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAG AAGAAAACTGAACCTCGAG
Table 26AE. Encoded NOV26n protein sequence (SEQ ID NO: 274).
ASTMFQFHAGSWΞSWCCCCLIPADRPDRGQH Q EMADTRSVHETRFEAAVKVIQS PKNGSFQPTNEM LKFYSFYKQA TEGPCK SRPGFra)PIGRYKVTOA SSLGDMTKEE^miAYVEEMKKIIETMPMTEKVEEL RVIGPFYEIVEDKKSGRSSD ITSVI^EKISKCLED GNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDiroKKMMKKSADHKNLEVIVTNG YDKDGFVQDMQNDIHASSS NGRSTEEVRPIDEN GQTGKSAVCIHQDINDDHVEDVTGIQH TSDSDSEVYCDSMEQFG QEES DSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEDGRNNSGAPHREKRGG ETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIA VLMRLQEDMQNVLQRLQK ET TALQA KSSTST QTAPQPTSQRPS WPFEMSPGV TFAIIWPFIAQWI.VY YYQRRRRKLNLE
NOV26o
In an alternative embodiment, a NOV26 variant is NOV26o of 1619 nucleotides (also referred to as CG51523-05_166190475), shown in Table 26AF. ANOV26o variant differs from NON26a by 3 amino acid changes at positions 170, 372 and 403, and an 11 amino acid insertion at position 161-162.
Table 26AF. ΝOV26o nucleotide sequence (SEQ ID NO: 275).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGCCAACACTGGC-AGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCC^GAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TCACTGGGTGATATGACCAAA-ffiGGAAGCCATGATTGC^TATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATCTTGGTAATGTTCTCACTTCTACTCCGAAC GCCAAAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAA
AGGAGCAGAACAAAGTGATAATGATAAGAAAATGATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTA
ATGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACT
GAAGAAGTAAAGCCC-ATTGATGAAAACTTGGGGCAAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAAATGATGA
TCΛTGTTGAAGATGTTACAGGAATTCAGCATTTGACAAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAAT
TTGGAOVAGAAGAGTCTTTAGAC-AGCTTTACGTCCAACaATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAA
CCCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGC
AGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGGAGAAGAGGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAG
GCGGAGAAACTGACGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACCTGAGCGAAGGAACCAAGGGC
CGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGC
CCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGC
AGGCAAAATCΑTCAAC-ATC^CΑTTGCΑGACTGCTCCTI^GCC^
TCTCCTGGTGTGCTAACGTTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAG
AAGAAAACTGAACCTCGAG
Table 26AG. Encoded NOV26o protein sequence (SEQ ID NO: 276).
ASTMFQFHAGS ESWCCCCLIPADRP DRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQ ATEGPCK SRPGFVTOPIGRYKJTOAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSS DITSVR EKISKC EDLG-W TSTNAKTV GKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMKKSADHK EVIVTN GYDKDGFVQDIQNDIHASSSLNGRSTEEV PIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQF GQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEEGRNNSGAPHREKRG GETDEFSNVRRGRGH-^QHLSEGTKGRQVGSGGDGERWGSDRGSRGS NEQIALVLMRLQEDMQNVLQRLQKLET TALQ AKSSTST QTAPQPTSQRPSW PFEMSPGVLTFAIIWPFIAQW VYLYYQRRRRKLNLE
NOV26p
In an alternative embodiment, a NOV26 variant is NOV26p of 1619 nucleotides (also referred to as CG51523-05_ 166190498), shown in Table 26AH. A NOV26p variant differs from NOV26a by 2 amino acid changes at positions 170 and 403, and an 11 amino acid insertion at position 161-162.
Table 26AH. NOV26p nucleotide sequence (SEQ ID NO: 277).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGC-AACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCIAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGC-ATATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGTCCGACTGGAGAAAATCTCTAAATGTTTAGAAGATCTTGGTAATGTTCTCACTTCTACTCCGAAC GCCAAAACCGTTAATGGTAAAGCTGAAAGCAGTGACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAβAAGAAGTGAA AGGAGf^GAACaAAGTGATAATGATAAGAAAATGATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTA ATGGCTATGATAAAGATGGCTTTGTTCAGGATATACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACT GAAGAAGTAAAGCCCATTGATGAAAACTTGGGGCAAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAAATGATGA TCATGTTGAAGATGTTACAGGAATTCAGCATTTGACAAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAAT TTGGACAAGAAGAGTCTTTAGACAGCTTTACGTCCAACAATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAA CCCATGGAAAATTCTGGATTTCGTGAAGATATTCAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGC AGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGGAGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAG GCGGAGAAACTGACGAATTCTCTAATGTTAGAAGAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGC CGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGCTGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGC CCTCGTGCTGATGAGACTGCAGGAGGACATGCAGAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCTGACTGCTTTGC AGGCAAAATCΑTC--AAC-ATCAACATTGCAGACTGCTCCTCAGCCCACCT(^CAGAGAC(^TCTTGGTGGCCCTTCGAGATG TCTCCTGGTGTGCTAACGTTTGCCATCATATGGCCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAG AAGAAAACTGAACCTCGAG Table 26AI. Encoded NOV26p protein sequence (SEQ ID NO: 278).
ASTMFQFHAGSWESWCCCCLIPADRP DRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMM KFYSFYKQ ATEGPCK SRPGFWDPIGRYKWDAWSS GDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVED KSGRSS DITSVRLEKISKCLEDLGKTV TSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMK-KSADHKNLEVIVT^ GYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQH TSDSDSEVYCDSMEQF GQEESLDSFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEDGRNNSGAPHREKRG GETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGER GSDRGSRGS NEQIAVLMR QEDMQNV QRLQK ETLTALQ AKSSTSTLQTAPQPTSQRPS PFEMSPGVLTFAIIWPFIAQW VYLYYQRRRRKLNLE
NOV26q
In an alternative embodiment, a NOV26 variant is NOV26q of 1586 nucleotides (also referred to as CG51523-05 66190460), shown in Table 26AJ. ANON26q variant differs from ΝON26a by 3 amino acid changes at positions 170, 231 and 463.
Table 26AJ. ΝOV26q nucleotide sequence (SEQ ID NO: 279).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGCATATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAGGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGATCTTGGTAATGTTCTCACTTCTACTCCAAACGCCAAAACCGTTAATGGTAAAGCTGAAAGCAGT GACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAAAT GATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAAATGGCTTTGTTCAGGATA TACAGAATGACATTCΑTGCmGTTCTTCCCTGAATGGCAGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGG C.AAACTGGAAAATCTGCTGTTTGCATT(^CCAAGATATAAATGATGATCATGTTGAAGATGTTACAGGAATTCAGCATTT GACAAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGT CCaACAATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAACCCATGGAAAATTCTGGATTTCGTGAAGATATT αVAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGCAGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGG AGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTCTAATGTTAGAA GAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGC TGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGACATGCA GAATGTCCTTCAGAGACTGCaGAAACTGGAAACGCTGACTGCTTTGCAGGCAAAATCATCAACATCAACATTGCAGACTG CTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTGGTGTGCTAACGTTTGCCATCATATGG CCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAGAAGAAAACTGAACCTCGAG
Table 26AK. Encoded NOV26q protein sequence (SEQ ID NO: 280).
ASTMFQF-^GSWESWCCCC IP.-UDRP DRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMM KFYSFYKQA
TEGPCKLSRPGFWDPIGRYK DA SSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDI
TSD GNV TSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKM ^
I-IASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGP
FQYY GGHSSQPMENSGFREDIQVPPGNGNIGNMQWAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEPSNVRRGRGHR
MQHLSEGTKGRQVGSGGDGER GSDRGSRGSLNEQIA VLMRLQEDMQNVLQR QKLETLTALQAKSSTSTLQTAPQPTSQ
RPS WPFEMSPGVLTFAII PFIAQWLVY YYQRRRRKLNLE
NOV26r In an alternative embodiment, a NOV26 variant is NOV26r of 1586 nucleotides (also referred to as CG51523-05 J 66190483), shown in Table 26AL. A NOV26r variant differs from NOV26a by 5 amino acid changes at positions 170, 342, 396, 403, and 452. Table 26AL. NOV26r nucleotide sequence (SEQ ID NO: 281).
AAGCTTCCACCATGTTCCAGTTTCATGCAGGCTCTTGGGAAAGCTGGTGCTGCTGCTGCCTGATTCCCGCCGACAGACCT TGGGACCGGGGCCAACACTGGCAGCTGGAGATGGCGGACACGAGATCCGTGCACGAGACTAGGTTTGAGGCGGCCGTGAA GGTGATCCAGAGTTTGCCGAAGAATGGTTCATTCCAGCCAACAAATGAAATGATGCTTAAATTTTATAGCTTCTATAAGC AGGCAACTGAAGGACCCTGTAAACTTTCAAGGCCTGGATTTTGGGATCCTATTGGAAGATATAAATGGGATGCTTGGAGT TCACTGGGTGATATGACCAAAGAGGAAGCCATGATTGCATATGTTGAAGAAATGAAAAAGATTATTGAAACTATGCCAAT GACTGAGAAAGTTGAAGAATTGCTGCGTGTCATAGGTCCATTTTATGAAATTGTCGAAGACAAAAAGAGTGGCAGGAGTT CTGATATAACCTCAGATCTTGGTAATGTTCTCACTTCTACTCCGAACGCCAAAACCGTTAATGGTAAAGCTGAAAGCAGT GACAGTGGAGCCGAGTCTGAGGAAGAAGAGGCCCAAGAAGAAGTGAAAGGAGCAGAACAAAGTGATAATGATAAGAAAAT GATGAAGAAGTCAGCAGACCATAAGAATTTGGAAGTCATTGTCACTAATGGCTATGATAAAGATGGCTTTGTTCAGGATA TACAGAATGACATTCATGCCAGTTCTTCCCTGAATGGCAGAAGCACTGAAGAAGTAAAGCCCATTGATGAAAACTTGGGG CaAACTGGAAAATCTGCTGTTTGCATTCACCAAGATATAAATGATGATCATGTTGAAGATGTTACAGGAATTCAGCATTT GACAAGCGATTCAGACAGTGAAGTTTACTGTGATTCTATGGAACAATTTGGACAAGAAGAGTCTTTAGACAGCTTTACGT CC^C-AATGGACCATTTCAGTATTACTTGGGTGGTCATTCCAGTCAACCCATGGAAAATTCTGGATTTCGTGAATATATT CAAGTACCTCCTGGAAATGGCAACATTGGGAATATGCAGGTGGTTGCAGTTGAAGGAAAAGGTGAAGTCAAGCATGGAGG AGAAGATGGCAGGAATAACAGCGGAGCACCACACCGGGAGAAGCGAGGCGGAGAAACTGACGAATTCTCTAATGTTGGAA GAGGAAGAGGACATAGGATGCAACACTTGAGCGAAGGAACCAAGGGCCGGCAGGTGGGAAGTGGAGGTGATGGGGAGCGC TGGGGCTCCGACAGAGGGTCCCGAGGCAGCCTCAATGAGCAGATCGCCCTCGTGCTGATGAGACTGCAGGAGGACATGCA GAATGTCCTTCAGAGACTGCAGAAACTGGAAACGCCGACTGCTTTGCAGGCAAAATC-ATCAACATCAACATTGCAGACTG CTCCTCAGCCCACCTCACAGAGACCATCTTGGTGGCCCTTCGAGATGTCTCCTGGTGTGCTAACGTTTGCCATCATATGG CCTTTTATTGCACAGTGGTTGGTGTATTTATACTATCAAAGAAGGAGAAGAAAACTGAACCTCGAG
Table 26AM. Encoded NOV26r protein sequence (SEQ ID NO: 282).
ASTMFQFHAGS ES CCCCLIPADRPWDRGQHQ EIADTRSVHETRFEAAVKVIQSLPKNGSFQPTNE MLKFYSFYKQ ATEGPCKLSRPGFWDPIGRYKWDA SSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEE RVIGPFYEIVEDKKSGRSS DITSDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDI QNDIHASSS NGRSTEEVKPIDEN GQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTS 1OTGPFQYY GGHSSQPMENSGFREYIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHREKRGGETDEFSNVGR GRGHRMQH SEGTKGRQVGSGGDGERWGSDRGSRGS NEQIALVLMRLQEDMQNV QRLQKLETPTALQAKSSTSTLQTA PQPTSQRPSW PFEMSPGVLTFAIIWPFIAQ LVYLYYQRRRRKLNLE
Example B: Sequencing Methodology and Identification of NOVX Clones
1. GeneCalling™ Technology: This is a proprietary method of performing differential gene expression profiling between two or more samples developed at CuraGen and described by Shimkets, et al., "Gene expression analysis by transcript profiling coupled to a gene database query" Nature Biotechnology 17: 198-803 (1999). cDNA was derived from various human samples representing multiple tissue types, normal and diseased states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, primary cells or tissue cultured primary cells or cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines or steroids. The cDNA thus derived was then digested with up to as many as 120 pairs of restriction enzymes and pairs of linker-adaptors specific for each pair of restriction enzymes were ligated to the appropriate end. The restriction digestion generates a mixture of unique cDNA gene fragments. Limited PCR amplification is performed with primers homologous to the linker adapter sequence where one primer is biotinylated and the other is fluorescently labeled. The doubly labeled material is isolated and the fluorescently labeled single strand is resolved by capillary gel electrophoresis. A computer algorithm compares the electropherograms from an experimental and control group for each of the restriction digestions. This and additional sequence-derived information is used to predict the identity of each differentially expressed gene fragment using a variety of genetic databases. The identity of the gene fragment is confirmed by additional, gene-specific competitive PCR or by isolation and sequencing of the gene fragment.
2. SeqCalling™ Technology: cDNA was derived from various human samples representing multiple tissue types, normal and diseased states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, primary cells or tissue cultured primary cells or cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines or steroids. The cDNA thus derived was then sequenced using CuraGen's proprietary SeqCalling technology. Sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled together, sometimes including public human sequences, using bioinformatic programs to produce a consensus sequence for each assembly. Each assembly is included in CuraGen Coφoration's database. Sequences were included as components for assembly when the extent of identity with another component was at least 95% over 50 bp. Each assembly represents a gene or portion thereof and includes information on variants, such as splice forms single nucleotide polymoφhisms (SNPs), insertions, deletions and other sequence variations. 3. PathCalling™ Technology: The NOVX nucleic acid sequences are derived by laboratory screening of cDNA library by the two-hybrid approach. cDNA fragments covering either the full length of the DNA sequence, or part of the sequence, or both, are sequenced. In silico prediction was based on sequences available in CuraGen Coφoration's proprietary sequence databases or in the public human sequence databases, and provided either the full length DNA sequence, or some portion thereof.
The laboratory screening was performed using the methods summarized below: cDNA libraries were derived from various human samples representing multiple tissue types, normal and diseased states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, primary cells or tissue cultured primary cells or cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines or steroids. The cDNA thus derived was then directionally cloned into the appropriate two-hybrid vector (Gal4-activation domain (Gal4-AD) fusion). Such cDNA libraries as well as commercially available cDNA libraries from Clontech (Palo Alto, CA) were then transferred from E.coli into a CuraGen Coφoration proprietary yeast strain (disclosed in U. S. Patents 6,057,101 and 6,083,693, incoφorated herein by reference in their entireties).
Gal4-binding domain (Gal4-BD) fusions of a CuraGen Coφortion proprietary library of human sequences was used to screen multiple Gal4-AD fusion cDNA libraries resulting in the selection of yeast hybrid diploids in each of which the Gal4-AD fusion contains an individual cDNA. Each sample was amplified using the polymerase chain reaction (PCR) using non-specific primers at the cDNA insert boundaries. Such PCR product was sequenced; sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled together, sometimes including public human sequences, using bioinformatic programs to produce a consensus sequence for each assembly. Each assembly is included in CuraGen Coφoration's database. Sequences were included as components for assembly when the extent of identity with another component was at least 95% over 50 bp. Each assembly represents a gene or portion thereof and includes information on variants, such as splice forms single nucleotide polymoφhisms (SNPs), insertions, deletions and other sequence variations.
Physical clone: the cDNA fragment derived by the screening procedure, covering the entire open reading frame is, as a recombinant DNA, cloned into pACT2 plasmid (Clontech) used to make the cDNA library. The recombinant plasmid is inserted into the host and selected by the yeast hybrid diploid generated during the screening procedure by the mating of both CuraGen Coφoration proprietary yeast strains N1061 and YULH (U. S. Patents 6,057,101 and 6,083,693).
4. RACE: Techniques based on the polymerase chain reaction such as rapid amplification of cDNA ends (RACE), were used to isolate or complete the predicted sequence of the cDNA of the invention. Usually multiple clones were sequenced from one or more human samples to derive the sequences for fragments. Various human tissue samples from different donors were used for the RACE reaction. The sequences derived from these procedures were included in the SeqCalling Assembly process described in preceding paragraphs.
5. Exon Linking: The NOVX target sequences identified in the present invention were subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) of the DNA or protein sequence of the target sequence, or by translated homology of the predicted exons to closely related human sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The PCR product derived from exon linking was cloned into the pCR2.1 vector from Invitrogen. The resulting bacterial clone has an insert covering the entire open reading frame cloned into the pCR2.1 vector. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Coφoration's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component of the assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported herein.
6. Physical Clone: Exons were predicted by homology and the intron/exon boundaries were determined using standard genetic rules. Exons were further selected and refined by means of similarity determination using multiple BLAST (for example, tBlast , BlastX, and BlastN) searches, and, in some instances, GeneScan and Grail. Expressed sequences from both public and proprietary databases were also added when available to further define and complete the gene sequence. The DNA sequence was then manually corrected for apparent inconsistencies thereby obtaining the sequences encoding the full-length protein.
The PCR product derived by exon linking, covering the entire open reading frame, was cloned into the pCR2.1 vector from Invitrogen to provide clones used for expression and screening puφoses.
Example C: Quantitative expression analysis of clones in various cells and tissues
The quantitative expression of various clones was assessed using microtiter plates containing RNA samples from a variety of normal and pathology-derived cells, cell lines and tissues using real time quantitative PCR (RTQ PCR). RTQ PCR was performed on an Applied Biosystems ABI PRISM® 7700 or an ABI PRISM® 7900 HT Sequence Detection System. Various collections of samples are assembled on the plates, and referred to as Panel 1 (containing normal tissues and cancer cell lines), Panel 2 (containing samples derived from tissues from normal and cancer sources), Panel 3 (containing cancer cell lines), Panel 4 (containing cells and cell lines from normal tissues and cells related to inflammatory conditions), Panel 5D/5I (containing human tissues and cell lines with an emphasis on metabolic diseases), AI_comprehensive_panel (containing normal tissue and samples from autoimmune/autoinflammatory diseases), Panel CNSD.01 (containing samples from normal and diseased brains) and CNS_neurodegeneration_panel (containing samples from normal and Alzheimer's diseased brains). RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electiopherograms using 28S and 18S ribosomal RNA staining intensity ratio as a guide (2:1 to 2.5: 1 28s: 18s) and the absence of low molecular weight RNAs that would be indicative of degradation products. Samples are controlled against genomic DNA contamination by RTQ PCR reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.
First, the RNA samples were normalized to reference nucleic acids such as constitutively expressed genes (for example, β-actin and GAPDH). Normalized RNA (5 ul) was converted to cDNA and analyzed by RTQ-PCR using One Step RT-PCR Master Mix Reagents (Applied Biosystems; Catalog No. 4309169) and gene-specific primers according to the manufacturer's instructions.
In other cases, non-normalized RNA samples were converted to single strand cDNA (sscDNA) using Superscript II (Invitrogen Coφoration; Catalog No. 18064-147) and random hexamers according to the manufacturer's instructions. Reactions containing up to 10 μg of total RNA were performed in a volume of 20 μl and incubated for 60 minutes at 42 °C. This reaction can be scaled up to 50 μg of total RNA in a final volume of 100 μl. sscDNA samples are then normalized to reference nucleic acids as described previously, using IX TaqMan® Universal Master mix (Applied Biosystems; catalog No. 4324020), following the manufacturer's instructions.
Probes and primers were designed for each assay according to Applied Biosystems Primer Express Software package (version I for Apple Computer's Macintosh Power PC) or a similar algorithm using the target sequence as input. Default settings were used for reaction conditions and the following parameters were set before selecting primers: primer concentration = 250 nM, primer melting temperature (Tm) range = 58 °-60 °C, primer optimal Tm = 59 °C, maximum primer difference = 2 °C, probe does not have 5'G, probe Tm must be 10 °C greater than primer Tm, amplicon size 75bp to lOObp. The probes and primers selected (see below) were synthesized by Synthegen (Houston, TX, USA). Probes were double purified by HPLC to remove uncoupled dye and evaluated by mass spectroscopy to verify coupling of reporter and quencher dyes to the 5' and 3' ends of the probe, respectively. Their final concentrations were: forward and reverse primers, 900nM each, and probe, 200nM. PCR conditions: When working with RNA samples, normalized RNA from each tissue and each cell line was spotted in each well of either a 96 well or a 384-well PCR plate (Applied Biosystems). PCR cocktails included either a single gene specific probe and primers set, or two multiplexed probe and primers sets (a set specific for the target clone and another gene-specific set multiplexed with the target probe). PCR reactions were set up using TaqMan® One-Step RT-PCR Master Mix (Applied Biosystems, Catalog No. 4313803) following manufacturer's instructions. Reverse transcription was performed at 48°C for 30 minutes followed by amplification/PCR cycles as follows: 95°C 10 min, then 40 cycles of 95 °C for 15 seconds, 60 °C for 1 minute. Results were recorded as CT values (cycle at which a given sample crosses a threshold level of fluorescence) using a log scale, with the difference in RNA concentration between a given sample and the sample with the lowest CT value being represented as 2 to the power of delta CT. The percent relative expression is then obtained by taking the reciprocal of this RNA difference and multiplying by 100. When working with sscDNA samples, normalized sscDNA was used as described previously for RNA samples. PCR reactions containing one or two sets of probe and primers were set up as described previously, using IX TaqMan® Universal Master mix (Applied Biosystems; catalog No. 4324020), following the manufacturer's instructions. PCR amplification was performed as follows: 95 °C 10 min, then 40 cycles of 95 °C for 15 seconds, 60 °C for 1 minute. Results were analyzed and processed as described previously.
Panels 1, 1.1, 1.2, and 1.3D
The plates for Panels 1, 1.1, 1.2 and 1.3D include 2 control wells (genomic DNA control and chemistry control) and 94 wells containing cDNA from various samples. The samples in these panels are broken into 2 classes: samples derived from cultured cell lines and samples derived from primary normal tissues. The cell lines are derived from cancers of the following types: lung cancer, breast cancer, melanoma, colon cancer, prostate cancer, CNS cancer, squamous cell carcinoma, ovarian cancer, liver cancer, renal cancer, gastric cancer and pancreatic cancer. Cell lines used in these panels are widely available through the American Type Culture Collection (ATCC), a repository for cultured cell lines, and were cultured using the conditions recommended by the ATCC. The normal tissues found on these panels are comprised of samples derived from all major organ systems from single adult individuals or fetuses. These samples are derived from the following organs: adult skeletal muscle, fetal skeletal muscle, adult heart, fetal heart, adult kidney, fetal kidney, adult liver, fetal liver, adult lung, fetal lung, various regions of the brain, the spleen, bone marrow, lymph node, pancreas, salivary gland, pituitary gland, adrenal gland, spinal cord, thymus, stomach, small intestine, colon, bladder, trachea, breast, ovary, uterus, placenta, prostate, testis and adipose. In the results for Panels 1 , 1.1 , 1.2 and 1.3D, the following abbreviations are used: ca. = carcinoma, * = established from metastasis, met = metastasis, s cell var = small cell variant, non-s = non-sm = non-small, squam = squamous, pi. eff = pi effusion = pleural effusion, glio = glioma, astro = astiocytoma, and neuro = neuroblastoma. General_screening panel_vl.4, vl.5 and vl.6
The plates for Panels 1.4, vl.5 and vl.6 include two control wells (genomic DNA control and chemistry control) and 94 wells containing cDNA from various samples. The samples in Panels 1.4, vl.5 and vl.6 are broken into 2 classes: samples derived from cultured cell lines and samples derived from primary normal tissues. The cell lines are derived from cancers of the following types: lung cancer, breast cancer, melanoma, colon cancer, prostate cancer, CNS cancer, squamous cell carcinoma, ovarian cancer, liver cancer, renal cancer, gastric cancer and pancreatic cancer. Cell lines used in Panels 1.4, vl.5 and vl.6 are widely available through the American Type Culture Collection (ATCC), a repository for cultured cell lines, and were cultured using the conditions recommended by the ATCC. The normal tissues found on Panels 1.4, vl .5 and vl .6 are comprised of pools of samples derived from all major organ systems from 2 to 5 different adult individuals or fetuses. These samples are derived from the following organs: adult skeletal muscle, fetal skeletal muscle, adult heart, fetal heart, adult kidney, fetal kidney, adult liver, fetal liver, adult lung, fetal lung, various regions of the brain, the spleen, bone marrow, lymph node, pancreas, salivary gland, pituitary gland, adrenal gland, spinal cord, thymus, stomach, small intestine, colon, bladder, trachea, breast, ovary, uterus, placenta, prostate, testis and adipose. Abbreviations are as described for Panels 1, 1.1, 1.2, and 1.3D.
Panels 2D, 2.2, 2.3 and 2.4 The plates for Panels 2D, 2.2, 2.3 and 2.4 generally include two control wells and 94 test samples composed of RNA or cDNA isolated from human tissue procured by surgeons working in close cooperation with the National Cancer Institute's Cooperative Human Tissue Network (CHTN) or the National Disease Research Initiative (NDRI) or from Ardais or Clinomics. The tissues are derived from human malignancies and in cases where indicated many malignant tissues have "matched margins" obtained from noncancerous tissue just adjacent to the tumor. These are termed normal adjacent tissues and are denoted "NAT" in the results below. The tumor tissue and the "matched margins" are evaluated by two independent pathologists (the surgical pathologists and again by a pathologist at NDRI/ CHTN/Ardais/Clinomics). Unmatched RNA samples from tissues without malignancy (normal tissues) were also obtained from Ardais or Clinomics. This analysis provides a gross histopathological assessment of tumor differentiation grade. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical stage of the patient. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery (designated "NAT", for normal adjacent tissue, in Table RR). In addition, RNA and cDNA samples were obtained from various human tissues derived from autopsies performed on elderly people or sudden death victims (accidents, etc.). These tissues were ascertained to be free of disease and were purchased from various commercial sources such as Clontech (Palo Alto, CA), Research Genetics, and Invitrogen. General oncology screening panel_v_2.4 is an updated version of Panel 2D.
HASS Panel v 1.0
The HASS panel v 1.0 plates are comprised of 93 cDNA samples and two controls. Specifically, 81 of these samples are derived from cultured human cancer cell lines that had been subjected to serum starvation, acidosis and anoxia for different time periods as well as controls for these treatments, 3 samples of human primary cells, 9 samples of malignant brain cancer (4 medulloblastomas and 5 glioblastomas) and 2 controls. The human cancer cell lines are obtained from ATCC (American Type Culture Collection) and fall into the following tissue groups: breast cancer, prostate cancer, bladder carcinomas, pancreatic cancers and CNS cancer cell lines. These cancer cells are all cultured under standard recommended conditions. The treatments used (serum starvation, acidosis and anoxia) have been previously published in the scientific literature. The primary human cells were obtained from Clonetics (Walkersville, MD) and were grown in the media and conditions recommended by Clonetics. The malignant brain cancer samples are obtained as part of a collaboration (Henry Ford Cancer Center) and are evaluated by a pathologist prior to CuraGen receiving the samples . RNA was prepared from these samples using the standard procedures. The genomic and chemistry control wells have been described previously.
ARDAIS Panel v 1.0 The plates for ARDAIS panel v 1.0 generally include 2 control wells and 22 test samples composed of RNA isolated from human tissue procured by surgeons working in close cooperation with Ardais Coφoration. The tissues are derived from human lung malignancies (lung adenocarcinoma or lung squamous cell carcinoma) and in cases where indicated many malignant samples have "matched margins" obtained from noncancerous lung tissue just adjacent to the tumor. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery (designated "NAT", for normal adjacent tissue) in the results below. The tumor tissue and the "matched margins" are evaluated by independent pathologists (the surgical pathologists and again by a pathologist at Ardais). Unmatched malignant and non-malignant RNA samples from lungs were also obtained from Ardais. Additional information from Ardais provides a gross histopathological assessment of tumor differentiation grade and stage. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical state of the patient.
Panels 3D, 3.1 and 3.2
The plates of Panel 3D, 3.1, and 3.2 are comprised of 94 cDNA samples and two control samples. Specifically, 92 of these samples are derived from cultured human cancer cell lines, 2 samples of human primary cerebellar tissue and 2 contiols. The human cell lines are generally obtained from ATCC (American Type Culture Collection), NCI or the German tumor cell bank and fall into the following tissue groups: Squamous cell carcinoma of the tongue, breast cancer, prostate cancer, melanoma, epidermoid carcinoma, sarcomas, bladder carcinomas, pancreatic cancers, kidney cancers, leukemias/lymphomas, ovarian/uterine/cervical, gastric, colon, lung and CNS cancer cell lines. In addition, there are two independent samples of cerebellum. These cells are all cultured under standard recommended conditions and RNA extracted using the standard procedures. The cell lines in panel 3D, 3.1, 3.2, 1, 1.1., 1.2, 1.3D, 1.4, 1.5, and 1.6 are of the most common cell lines used in the scientific literature. Panels 4D, 4R, and 4.1D
Panel 4 includes samples on a 96 well plate (2 control wells, 94 test samples) composed of RNA (Panel 4R) or cDNA (Panels 4D/4.1D) isolated from various human cell lines or tissues related to inflammatory conditions. Total RNA from control normal tissues such as colon and lung (Stiatagene, La Jolla, CA) and thymus and kidney (Clontech) was employed. Total RNA from liver tissue from cirrhosis patients and kidney from lupus patients was obtained from BioChain (Biochain Institute, Inc., Hayward, CA). Intestinal tissue for RNA preparation from patients diagnosed as having Crohn's disease and ulcerative colitis was obtained from the National Disease Research Interchange (NDRI) (Philadelphia, PA). Astrocytes, lung fϊbroblasts, dermal fibroblasts, coronary artery smooth muscle cells, small airway epithelium, bronchial epithelium, microvascular dermal endothelial cells, microvascular lung endothelial cells, human pulmonary aortic endothelial cells, human umbilical vein endothelial cells were all purchased from Clonetics (Walkersville, MD) and grown in the media supplied for these cell types by Clonetics. These primary cell types were activated with various cytokines or combinations of cytokines for 6 and/or 12-14 hours, as indicated. The following cytokines were used; IL-1 beta at approximately l-5ng/ml, TNF alpha at approximately 5-10ng/ml, IFN gamma at approximately 20-50ng/ml, IL-4 at approximately 5-10ng ml, IL-9 at approximately 5-10ng/ml, IL-13 at approximately
5-10ng/ml. Endothelial cells were sometimes starved for various times by culture in the basal media from Clonetics with 0.1% serum.
Mononuclear cells were prepared from blood of employees at CuraGen Coφoration, using Ficoll. LAK cells were prepared from these cells by culture in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco/Life Technologies, Rockville, MD), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco) and Interleukin 2 for 4-6 days. Cells were then either activated with 10-20ng/ml PMA and l-2μg/ml ionomycin, IL-12 at 5-10ng/ml, IFN gamma at 20-50ng/ml and IL-18 at 5-10ng/ml for 6 hours. In some cases, mononuclear cells were cultured for 4-5 days in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco) with PHA (phytohemagglutinin) or PWM (pokeweed mitogen) at approximately 5μg/ml. Samples were taken at 24, 48 and 72 hours for RNA preparation. MLR (mixed lymphocyte reaction) samples were obtained by taking blood from two donors, isolating the mononuclear cells using Ficoll and mixing the isolated mononuclear cells 1 : 1 at a final concentration of approximately 2xl06cells/ml in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol (5.5xl0"5M) (Gibco), and lOmM Hepes (Gibco). The MLR was cultured and samples taken at various time points ranging from 1- 7 days for RNA preparation. Monocytes were isolated from mononuclear cells using CD 14 Miltenyi Beads, +ve
VS selection columns and a Vario Magnet according to the manufacturer's instructions. Monocytes were differentiated into dendritic cells by culture in DMEM 5% fetal calf serum (FCS) (Hyclone, Logan, UT), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco), 50ng/ml GMCSF and 5ng/ml IL-4 for 5-7 days. Macrophages were prepared by culture of monocytes for 5-7 days in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), lOmM Hepes (Gibco) and 10% AB Human Serum or MCSF at approximately 50ng/ml. Monocytes, macrophages and dendritic cells were stimulated for 6 and 12-14 hours with lipopolysaccharide (LPS) at lOOng/ml. Dendritic cells were also stimulated with anti-CD40 monoclonal antibody (Pharmingen) at lOμg/ml for 6 and 12-14 hours.
CD4 lymphocytes, CD8 lymphocytes and NK cells were also isolated from mononuclear cells using CD4, CD8 and CD56 Miltenyi beads, positive VS selection columns and a Vario Magnet according to the manufacturer's instructions. CD45RA and CD45RO CD4 lymphocytes were isolated by depleting mononuclear cells of CD8, CD56, CD14 and CD19 cells using CD8, CD56, CD14 and CD19 Miltenyi beads and positive selection. CD45RO beads were then used to isolate the CD45RO CD4 lymphocytes with the remaining cells being CD45RA CD4 lymphocytes. CD45RA CD4, CD45RO CD4 and CD8 lymphocytes were placed in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco) and plated at 106cells/ml onto Falcon 6 well tissue culture plates that had been coated overnight with 0.5μg/ml anti-CD28 (Pharmingen) and 3ug/ml anti-CD3 (OKT3, ATCC) in PBS. After 6 and 24 hours, the cells were harvested for RNA preparation. To prepare chronically activated CD8 lymphocytes, we activated the isolated CD8 lymphocytes for 4 days on anti-CD28 and anti-CD3 coated plates and then harvested the cells and expanded them in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco) and IL-2. The expanded CD8 cells were then activated again with plate bound anti-CD3 and anti-CD28 for 4 days and expanded as before. RNA was isolated 6 and 24 hours after the second activation and after 4 days of the second expansion culture. The isolated NK cells were cultured in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5x10"5M (Gibco), and lOmM Hepes (Gibco) and IL-2 for 4-6 days before RNA was prepared.
To obtain B cells, tonsils were procured from NDRI. The tonsil was cut up with sterile dissecting scissors and then passed through a sieve. Tonsil cells were then spun down and resupended at 106 cells/ml in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco). To activate the cells, we used PWM at 5μg/ml or anti-CD40
(Pharmingen) at approximately lOμg/ml and IL-4 at 5-10ng/ml. Cells were harvested for RNA preparation at 24, 48 and 72 hours. To prepare the primary and secondary Thl/Th2 and Trl cells, six-well Falcon plates were coated overnight with lOμg/ml anti-CD28 (Pharmingen) and 2μg/ml OKT3 (ATCC), and then washed twice with PBS. Umbilical cord blood CD4 lymphocytes (Poietic Systems, German Town, MD) were cultured at 105-l 06cells/ml in DMEM 5% FCS (Hyclone), 1 OOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol
5.5xlO"5M (Gibco), lOmM Hepes (Gibco) and IL-2 (4ng ml). IL-12 (5ng/ml) and anti-IL4 (lμg/ml) were used to direct to Thl, while IL-4 (5ng/ml) and anti-IFN gamma (lμg/ml) were used to direct to Th2 and IL-10 at 5ng/ml was used to direct to Trl . After 4-5 days, the activated Thl, Th2 and Trl lymphocytes were washed once in DMEM and expanded for 4-7 days in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), lOmM Hepes (Gibco) and IL-2 (lng/ml). Following this, the activated Thl, Th2 and Trl lymphocytes were re-stimulated for 5 days with anti-CD28/OKT3 and cytokines as described above, but with the addition of anti-CD95L (lμg/ml) to prevent apoptosis. After 4-5 days, the Thl, Th2 and Trl lymphocytes were washed and then expanded again with IL-2 for 4-7 days. Activated Thl and Th2 lymphocytes were maintained in this way for a maximum of three cycles. RNA was prepared from primary and secondary Thl, Th2 and Trl after 6 and 24 hours following the second and third activations with plate bound anti-CD3 and anti-CD28 mAbs and 4 days into the second and third expansion cultures in Interleukin 2. The following leukocyte cells lines were obtained from the ATCC: Ramos, EOL-1,
KU-812. EOL cells were further differentiated by culture in O.lmM dbcAMP at 5xl05cells/ml for 8 days, changing the media every 3 days and adjusting the cell concentration to 5xl05cells/ml. For the culture of these cells, we used DMEM or RPMI (as recommended by the ATCC), with the addition of 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), lOmM Hepes (Gibco). RNA was either prepared from resting cells or cells activated with PMA at lOng/ml and ionomycin at lμg/ml for 6 and 14 hours. Keratinocyte line CCD106 and an airway epithelial tumor line NCI-H292 were also obtained from the ATCC. Both were cultured in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco). CCD1106 cells were activated for 6 and 14 hours with approximately 5 ng/ml TNF alpha and lng/ml IL-1 beta, while NCI-H292 cells were activated for 6 and 14 hours with the following cytokines: 5ng/ml IL-4, 5ng/ml IL-9, 5ng/ml IL-13 and 25ng/ml IFN gamma. For these cell lines and blood cells, RNA was prepared by lysing approximately 107cells/ml using Trizol (Gibco BRL). Briefly, 1/10 volume of bromochloropropane (Molecular Research Coφoration) was added to the RNA sample, vortexed and after 10 minutes at room temperature, the tubes were spun at 14,000 rpm in a Sorvall SS34 rotor. The aqueous phase was removed and placed in a 15ml Falcon Tube. An equal volume of isopropanol was added and left at -20 °C overnight. The precipitated RNA was spun down at 9,000 φm for 15 min in a Sorvall SS34 rotor and washed in 70% ethanol. The pellet was redissolved in 300μl of RNAse-free water and 35μl buffer (Promega) 5μl DTT, 7μl RNAsin and 8μl DNAse were added. The tube was incubated at 37 °C for 30 minutes to remove contaminating genomic DNA, extracted once with phenol chloroform and re-precipitated with 1/10 volume of 3M sodium acetate and 2 volumes of 100% ethanol. The RNA was spun down and placed in RNAse free water. RNA was stored at -80 °C.
AI_comprehensive panel_vl.0
The plates for AI_comprehensive panel_vl.O include two control wells and 89 test samples comprised of cDNA isolated from surgical and postmortem human tissues obtained from the Backus Hospital and Clinomics (Frederick, MD). Total RNA was extracted from tissue samples from the Backus Hospital in the Facility at CuraGen. Total RNA from other tissues was obtained from Clinomics.
Joint tissues including synovial fluid, synovium, bone and cartilage were obtained from patients undergoing total knee or hip replacement surgery at the Backus Hospital.
Tissue samples were immediately snap frozen in liquid nitrogen to ensure that isolated RNA was of optimal quality and not degraded. Additional samples of osteoarthritis and rheumatoid arthritis joint tissues were obtained from Clinomics. Normal control tissues were supplied by Clinomics and were obtained during autopsy of trauma victims. Surgical specimens of psoriatic tissues and adjacent matched tissues were provided as total RNA by Clinomics. Two male and two female patients were selected between the ages of 25 and 47. None of the patients were taking prescription drugs at the time samples were isolated.
Surgical specimens of diseased colon from patients with ulcerative colitis and Crohns disease and adjacent matched tissues were obtained from Clinomics. Bowel tissue from three female and three male Crohn's patients between the ages of 41-69 were used. Two patients were not on prescription medication while the others were taking dexamethasone, phenobarbital, or tylenol. Ulcerative colitis tissue was from three male and four female patients. Four of the patients were taking lebvid and two were on phenobarbital.
Total RNA from post mortem lung tissue from trauma victims with no disease or with emphysema, asthma or COPD was purchased from Clinomics. Emphysema patients ranged in age from 40-70 and all were smokers, this age range was chosen to focus on patients with cigarette-linked emphysema and to avoid those patients with alpha- lanti-trypsin deficiencies. Asthma patients ranged in age from 36-75, and excluded smokers to prevent those patients that could also have COPD. COPD patients ranged in age from 35-80 and included both smokers and non-smokers. Most patients were taking corticosteroids, and bronchodilators. In the labels employed to identify tissues in the AI_comprehensive panel_vl .0 panel, the following abbreviations are used: Al = Autoimmunity Syn = Synovial Normal = No apparent disease Rep22 /Rep20 = individual patients
RA = Rheumatoid arthritis Backus = From Backus Hospital OA = Osteoarthritis (SS) (BA) (MF) = Individual patients Adj = Adjacent tissue
Match control = adjacent tissues
-M = Male
-F = Female
COPD = Chronic obstructive pulmonary disease AI.05 chondrosarcoma
The AI.05 chondrosarcoma plates are comprised of SW1353 cells that had been subjected to serum starvation and treatment with cytokines that are known to induce MMP (1, 3 and 13) synthesis (eg. ILlbeta). These treatments include: IL-lbeta (10 ng/ml), IL-lbeta + TNF-alpha (50 ng/ml), IL-lbeta + Oncostatin (50 ng/ml) and PMA (100 ng/ml). The SW1353 cells were obtained from the ATCC (American Type Culture Collection) and were all cultured under standard recommended conditions. The SW1353 cells were plated at 3 xlO5 cells/ml (in DMEM medium-10 % FBS) in 6-well plates. The treatment was done in triplicate, for 6 and 18 h. The supernatants were collected for analysis of MMP 1, 3 and 13 production and for RNA extraction. RNA was prepared from these samples using the standard procedures.
Panels 5D and 51
The plates for Panel 5D and 51 include two control wells and a variety of cDNAs isolated from human tissues and cell lines with an emphasis on metabolic diseases. Metabolic tissues were obtained from patients enrolled in the Gestational Diabetes study. Cells were obtained during different stages in the differentiation of adipocytes from human mesenchymal stem cells. Human pancreatic islets were also obtained.
In the Gestational Diabetes study subjects are young (18 - 40 years), otherwise healthy women with and without gestational diabetes undergoing routine (elective) Caesarean section. After delivery of the infant, when the surgical incisions were being repaired/closed, the obstetrician removed a small sample (<1 cc) of the exposed metabolic tissues during the closure of each surgical level. The biopsy material was rinsed in sterile saline, blotted and fast frozen within 5 minutes from the time of removal. The tissue was then flash frozen in liquid nitrogen and stored, individually, in sterile screw-top tubes and kept on dry ice for shipment to or to be picked up by CuraGen. The metabolic tissues of interest include uterine wall (smooth muscle), visceral adipose, skeletal muscle (rectus) and subcutaneous adipose. Patient descriptions are as follows:
Patient 2 Diabetic Hispanic, overweight, not on insulin
Patient 7-9 Nondiabetic Caucasian and obese (BMI>30) Patient 10 Diabetic Hispanic, overweight, on insulin Patient 11 Nondiabetic African American and overweight
Patient 12 Diabetic Hispanic on insulin Adipocyte differentiation was induced in donor progenitor cells obtained from Osirus (a division of Clonetics/BioWhittaker) in triplicate, except for Donor 3U which had only two replicates. Scientists at Clonetics isolated, grew and differentiated human mesenchymal stem cells (HuMSCs) for CuraGen based on the published protocol found in Mark F. Pittenger, et al., Multilineage Potential of Adult Human Mesenchymal Stem Cells Science Apr 2 1999: 143-147. Clonetics provided Trizol lysates or frozen pellets suitable for mRNA isolation and ds cDNA production. A general description of each donor is as follows:
Donor 2 and 3 U: Mesenchymal Stem cells, Undifferentiated Adipose Donor 2 and 3 AM: Adipose, AdiposeMidway Differentiated Donor 2 and 3 AD: Adipose, Adipose Differentiated
Human cell lines were generally obtained from ATCC (American Type Culture Collection), NCI or the German tumor cell bank and fall into the following tissue groups: kidney proximal convoluted tubule, uterine smooth muscle cells, small intestine, liver HepG2 cancer cells, heart primary stromal cells, and adrenal cortical adenoma cells. These cells are all cultured under standard recommended conditions and RNA extracted using the standard procedures. All samples were processed at CuraGen to produce single stranded cDNA.
Panel 51 contains all samples previously described with the addition of pancreatic islets from a 58 year old female patient obtained from the Diabetes Research Institute at the University of Miami School of Medicine. Islet tissue was processed to total RNA at an outside source and delivered to CuraGen for addition to panel 51.
In the labels employed to identify tissues in the 5D and 51 panels, the following abbreviations are used:
GO Adipose = Greater Omentum Adipose SK= Skeletal Muscle UT = Uterus
PL = Placenta
AD = Adipose Differentiated AM = Adipose Midway Differentiated U = Undifferentiated Stem Cells Panel CNSD.01
The plates for Panel CNSD.01 include two control wells and 94 test samples comprised of cDNA isolated from postmortem human brain tissue obtained from the Harvard Brain Tissue Resource Center. Brains are removed from calvaria of donors between 4 and 24 hours after death, sectioned by neuroanatomists, and frozen at -80°C in liquid nitrogen vapor. All brains are sectioned and examined by neuropathologists to confirm diagnoses with clear associated neuropathology.
Disease diagnoses are taken from patient records. The panel contains two brains from each of the following diagnoses: Alzheimer's disease, Parkinson's disease, Huntington's disease, Progressive Supernuclear Palsy, Depression, and "Normal controls". Within each of these brains, the following regions are represented: cingulate gyrus, temporal pole, globus palladus, substantia nigra, Brodman Area 4 (primary motor strip), Brodman Area 7 (parietal cortex), Brodman Area 9 (prefrontal cortex), and Brodman area 17 (occipital cortex). Not all brain regions are represented in all cases; e.g., Huntington's disease is characterized in part by neurodegeneration in the globus palladus, thus this region is impossible to obtain from confirmed Huntington's cases. Likewise Parkinson's disease is characterized by degeneration of the substantia nigra making this region more difficult to obtain. Normal control brains were examined for neuropathology and found to be free of any pathology consistent with neurodegeneration.
In the labels employed to identify tissues in the CNS panel, the following abbreviations are used:
PSP = Progressive supranuclear palsy Sub Nigra = Substantia nigra Glob Palladus= Globus palladus
Temp Pole = Temporal pole Cing Gyr = Cingulate gyrus BA 4 = Brodman Area 4
Panel CNS_Neurodegeneration_V1.0 The plates for Panel CNS_Neurodegeneration_Vl .0 include two contiol wells and 47 test samples comprised of cDNA isolated from postmortem human brain tissue obtained from the Harvard Brain Tissue Resource Center (McLean Hospital) and the Human Brain and Spinal Fluid Resource Center (VA Greater Los Angeles Healthcare System). Brains are removed from calvaria of donors between 4 and 24 hours after death, sectioned by neuroanatomists, and frozen at -80°C in liquid nitrogen vapor. All brains are sectioned and examined by neuropathologists to confirm diagnoses with clear associated neuropathology. Disease diagnoses are taken from patient records. The panel contains six brains from Alzheimer's disease (AD) patients, and eight brains from "Normal controls" who showed no evidence of dementia prior to death. The eight normal control brains are divided into two categories: Controls with no dementia and no Alzheimer's like pathology (Controls) and controls with no dementia but evidence of severe Alzheimer's like pathology, (specifically senile plaque load rated as level 3 on a scale of 0-3; 0 = no evidence of plaques, 3 = severe AD senile plaque load). Within each of these brains, the following regions are represented: hippocampus, temporal cortex (Brodman Area 21), parietal cortex (Brodman area 7), and occipital cortex (Brodman area 17). These regions were chosen to encompass all levels of neurodegeneration in AD. The hippocampus is a region of early and severe neuronal loss in AD; the temporal cortex is known to show neurodegeneration in AD after the hippocampus; the parietal cortex shows moderate neuronal death in the late stages of the disease; the occipital cortex is spared in AD and therefore acts as a "control" region within AD patients. Not all brain regions are represented in all cases.
In the labels employed to identify tissues in the CNS_Neurodegeneration_Vl-0 panel, the following abbreviations are used: AD = Alzheimer's disease brain; patient was demented and showed AD-like pathology upon autopsy
Control = Control brains; patient not demented, showing no neuropathology
Control (Path) = Control brains; pateint not demented but showing sever AD-like pathology SupTemporal Ctx = Superior Temporal Cortex
Inf Temporal Ctx = Inferior Temporal Cortex
A. CG103322-02: CD82 ANTIGEN. Expression of gene CG103322-02 was assessed using the primer-probe set Ag6858, described in Table AA. Results of the RTQ-PCR runs are shown in Table AB. Please note that CG103322-02 represents a full-length physical clone.
Table AA. Probe Name Ag6858
Table AB. General screening panel vl.6
General screening panel vl.6 Summary: Ag6858
The gene is expressed at low levels in most of the cancer cell lines on this panel with the highest expression in a renal cancer cell line UO-31 (CT=30.03). It may be used as a marker for expression.
CG103322-02 is a deletion splice variant of CD82/KAI1, a gene which was first described in the literature as a metastasis suppressor for prostate cancer (Dong, J.-T.; Lamb, P. W.; Rinker-Schaeffer, C. W.; Vukanovic, J.; Ichikawa, T.; Isaacs, J. T.; Barrett, J. C. : KAIl , a metastasis suppressor gene for prostate cancer on human chromosome 1 lpl 1.2. Science 268: 884-886, 1995.)
B. CG151575-02: Novel Multi-pass Membrane Protein. Expression of gene CGI 51575-02 was assessed using the primer-probe set Ag7621, described in Table BA. Results of the RTQ-PCR runs are shown in Table BB.
Table BA. Probe Name Ag7621
Start SEQ ID
Primers Sequences JLengt Position No
Forward: 5 ' -cccagagtatctcaagggactt-3 ' 22 219 286
TET-5 ' -aagctgtctctgctgatagactccttcc-3 ' -
Probe 28 257 287 TAMRA
Reverse|5 ' -gtgagatcctgctgtgttgg-3 ' 20 304 288
Table BB. Panel 4.1D
CNS_neurodegeneration_vl.O Summary: Ag7621 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
Panel 4.1D Summary: Ag7621 Low expression of this gene is detected mainly in EFN gamma treated NCI-H292 (CT=34.6). NCI-H292 cell line is a human airway epithelial cell line that produces mucins. Expression of this gene is higher in IFN gamma stimulated NCI-H292 compared to resting cells. Thus, this gene may be important in the proliferation or activation of airway epithelium. Mucus overproduction is an important feature of bronchial asthma and chronic obstructive pulmonary disease samples. Therefore, therapeutics designed with the protein encoded by the gene may reduce or eliminate symptoms caused by inflammation in lung epithelia in chronic obstructive pulmonary disease, asthma, allergy, and emphysema.
C. CG153011-01: Sushi Domain-Containing Membrane Protein.
Expression of gene CG153011-01 was assessed using the primer-probe set Ag6966, described in Table CA. Results of the RTQ-PCR runs are shown in Table CB. Please note that CGI 53011-01 represents a full-length physical clone.
Table CA. Probe Name Ag6966
Table CB. General_screening_panel_vl.6
General screening panel vl.6 Summary: Ag6966 Highest expression of this gene is detected in a renal cancer 786-0 cell line (CT=30.8). Moderate levels of expression of this gene is also seen in cluster of cancer cell lines derived from gastric, colon, lung, renal, breast, ovarian, and brain cancers. Thus, expression of this gene could be used as a marker to detect the presence of these cancers. Furthermore, therapeutic modulation of the expression or function of this gene maybe effective in the treatment of gastric, colon, lung, renal, breast, ovarian, and brain cancers.
In addition, this gene is expressed at moderate to low levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, therapeutic modulation of this gene product may be useful in the treatment of central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
D. CG153179-01: Membrane Protein.
Expression of gene CG153179-01 was assessed using the primer-probe set Ag6863, described in Table DA. Results of the RTQ-PCR runs are shown in Table DB. Please note that CG153179-01 represents a full-length physical clone.
Table DA. Probe Name Ag6863
Table DB. General_screening_panel_vl.6
Generaljscreening^j ne^vl.ό Summary: Ag6863 Expression is limited to a sample derived from fetal skeletal muscle (CT=34.7). Interestingly, this gene is expressed at much higher levels in fetal (CT = 34.7) when compared to adult skeletal muscle (CT = 40). This observation suggests that expression of this gene can be used to distinguish fetal from adult skeletal muscle and other samples in this panel. In addition, the relative overexpression of this gene in fetal skeletal muscle suggests that the protem product may enhance muscular growth or development in the fetus and thus may also act in a regenerative capacity in the adult. Therefore, therapeutic modulation of the protein encoded by this gene could be useful in treatment of muscle related diseases. More specifically, treatment of weak or dystrophic muscle with the protein encoded by this gene could restore muscle mass or function.
E. CG153403-02: Dickkopf related protein-4 precursor. Expression of gene CG153403-02 was assessed using the primer-probe set Ag7176, described in Table EA. Please note that CGI 53403-01 represents a full-length physical clone.
Table EA. Probe Name Ag7176
CNS_neurodegeneration_vl.O Summary: Ag7176 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
Panel 4.1D Summary: Ag7176 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
F. CG157760-02: PLAC1.
Expression of gene CGI 57760-02 was assessed using the primer-probe set Ag7153, described in Table FA. Please note that CGI 57760-02 represents a full-length physical clone.
Table FA. Probe Name Ag7153
CNS_neurodegeneration_vl.O Summary: Ag7153 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
Panel 4.1D Summary: Ag7153 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
G. CG158114-01: splice variant of melanoma associated antigen gplOO.
Expression of gene CG158114-01 was assessed using the primer-probe set Ag5335, described in Table GA. Results of the RTQ-PCR runs are shown in Tables GB and GC.
Table GA. Probe Name Ag5335
Table GB. General_screening panel_vl.5
Table GC. Panel 4.1D
CNS_neurodegeneration_vl.0 Summary: Ag5335 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
General_screeningj»anel_vl.5 Summary: Ag5335 This gene is very highly expressed in two melanoma cancer cell line samples (CTs=22). This novel gene encodes a protein that is homologous to Melanocyte protein Pmel 17 which plays an important role in melanogenesis and is actively investigated as targets for melanoma immunotherapy (Martinez-Esparza M, Pigment Cell Res 2000 Apr; 13(2): 120-6). Thus, expression of this gene could be used to differentiate between these samples and other samples on this panel and as a marker to detect the presence of melanoma. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of melanoma.
Among tissues with metabolic function, this gene is expressed at low but significant levels in pancreas, and adult and fetal and liver. This expression among these tissues suggests that this gene product may play a role in normal neuroendocrine and metabolic function and that disregulated expression of this gene may contribute to neuroendocrine disorders or metabolic diseases, such as obesity and diabetes.
Panel 4.1D Summary: Ag5335 Highest expression is seen in a sample derived from IL-9 treated NCI-H292 goblet cells (CT=33.5). Low but significant expression is also seen in NCI-H292 cells treated with IL-4, IL-13, or untreated cells, as well as in PMA/ionomycin treated LAK cells, untreated NK cells, primary activated Thl and Tr2 cells, CD45RO CD4 lymphocytes and resting secondary CD8 lymphocytes. This expression suggests that this gene product may be involved in inflammatory conditions of the lung, including asthma, emphysema, and allergy.
H. CG158553-01: ERYTHROPOIETIN RECEPTOR PRECURSOR.
Expression of gene CG158553-01 was assessed using the primer-probe set Ag5446, described in Table HA.
Table HA. Probe Name Ag5446
AI_comprehensive panel_vl.0 Summary: Ag5446 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
General_screeningj)anel_vl.5 Summary: Ag5446 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
Panel 4.1D Summary: Ag5446 Expression of this gene is low/undetectable in all samples on this panel (CTs>35). I. CG158983-01, CG158983-02 and CG158983-03: chloride channel.
Expression of gene CGI 58983-01, CGI 58983-02, and CGI 58983-03 was assessed using the primer-probe sets Ag5892 and Ag6186, described in Tables IA and IB. Results of the RTQ- PCR runs are shown in Tables IC, ID, IE, IF, IG and IH. Please note that CG158983-03 represents a full-length physical clone of the CG158983-02 gene, validating the prediction of the gene sequence.
Table IA. Probe Name Ag5892
Table IB. Probe Name Ag6186 Primers Sequences fcength Start Position SEQ ID No
Forward 5 ' -ctgcagatcgaggactttctg-3 ' hi 242 310
Probe TET-5 ' -ccgcccgaggagtccaaca-3 -TAMRA 19 278 311
Reverse 5 ' -gatgaacgcggagaacttgt-3 ' |20 318 J312
Table IC. AI.05 chondrosarcoma
Table TD. AI_comprehensive panel_vl.0
Table IE. Generaljscreeningjane^vl.S
Table IF. Panel 4.1D
Table IG. Panel 5 Islet
Table IH. general oncology screening panel_y_2.4
AI.05 chondrosarcoma Summary: Ag5892 Highest expression of this gene is detected in untreated serum starved chondrosarcoma cell line (S 1353) (CT=32.2). Interestingly, expression of this gene appears to be slightly down regulated upon treatment with IL-1 (CTs=334-35), a potent activator of pro-inflammatory cytokines and matrix metalloproteinases that participate in the destruction of cartilage observed in osteoarfhritis (OA). Modulation of the expression of this transcript in chondrocytes may therefore be important for preventing the degeneration of cartilage observed in OA.
AI_comprehensive panel_vl.O Summary: Ag5892 Highest expression is seen in a sample derived from normal tissue adjacent to ulcerative colitis (CT=27.7). In addition, prominent levels of expression are seen in a cluster of samples derived from rheumatoid arthritis, as well as in an OA sample. Thus, expression of this gene could be used to differentiate these samples from other samples and as a marker of these diseases. Furthermore, therapeutic modulation of the expression or function of this gene may be useful in the treatment of these diseases. Ag5892 Results from a second experiment with this probe and primer, run 247842321, are not included. The amp plot indicates that there were experimental difficulties with this run. Ag6186 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
General_screening_panel_vl.5 Summary: Ag5892 Highest expression is seen in a gastric cancer cell line (CT=28). Moderate levels of expression are also seen in a cluster of cell lines derived from breast, ovarian, and melanoma cancers, as well as in normal thyroid, fetal lung and placenta. In addition, this gene is expressed at much higher levels in fetal lung tissue (CT=30) when compared to expression in the adult counterpart (CT=40). Thus, expression of this gene may be used to differentiate between the fetal and adult source of this tissue. Panel 4.1D Summary: Ag5892 Prominent expression of this gene is seen in untreated small airway epithelium, as well as in small airway epithelium treated with TNF-a and IL-1 b (CTs=28-29). In addition, low but significant levels of expression are seen in clusters of samples derived from lung and dermal fibroblasts, as well as in CI-H292 goblet cells. Thus, expression of this gene could be used as as a marker of small airway epithelium. Furthermore, modulation of the expression or function of this gene may be useful in the treatment of inflammatory conditions of the lung, including allergy, emphysema, and asthma. Ag6186 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
Panel 5 Islet Summary: Ag5892 Expression of this gene is prominent in placenta, consistent with expression in Panel 1.5 (CTs=28-30). Thus, expression of this gene could be used as a marker of this tissue. general oncology screening panel_v_2.4 Summary: Ag5892 Highest expression of this gene is seen in a prostate cancer (CT=30). Moderate levels of expression of this gene are seen in colon, lung, kidney, melanoma, and skin cell carcinoma cancers. Thus, expression of this gene may be useful of a marker of these or other cancers, particularly hormone dependent cancers like breast cancers. In addition, modulation of the expression or function of this gene may be useful in the treatment of cancers.
J. CG159015-01, CG159015-02, and CG159015-03: Novel secreted protein. Expression of gene CG159015-01, CG159015-02, and CG159015-03 was assessed using the primer-probe set Ag5962, described in Table JA. Results of the RTQ-PCR runs are shown in Tables JB and JC. Please note that CGI 59015-03 represents a full-length physical clone.
Table JA. Probe Name Ag5962
Table JB. General_screening_panel_vl.5
Table JC. Panel 5 Islet
Tissue Name Rel. Exp. (%) Tissue Name Rel . Ex . (%) Ag5962, Run JAg5962, Run
General_screeningj)anel_vl.5 Summary: Ag5962 Highest expression of this gene is detected in brain cancer SNB-75 cell line (CT=25.2). Moderate to high levels of expression of this gene is also seen in cluster of cancer cell lines derived from pancreatic, gastric, colon, lung, liver, renal, breast, ovarian, prostate, squamous cell carcinoma, melanoma and brain cancers. Thus, expression of this gene could be used as a marker to detect the presence of these cancers. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of pancreatic, gastric, colon, lung, liver, renal, breast, ovarian, prostate, squamous cell carcinoma, melanoma and brain cancers.
Among tissues with metabolic or endocrine function, this gene is expressed at moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
In addition, this gene is expressed at moderate levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, therapeutic modulation of this gene product may be useful in the treatment of central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression. Panel 5 Islet Summary: Ag5962 Highest expression of this gene is detected in islet cells (CT=27.7). This gene shows wide spread expression in this panel, with moderate expressions in adipose, skeletal muscle, uterus, placenta, small intestine, cardiac stromal cells and kidney. Therefore, therapeutic modulation of this gene may be useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes, including type II diabetes.
K. CG50387-03: connexin 46.
Expression of gene CG50387-03 was assessed using the primer-probe sets Ag2597, Ag5234 and Ag5235, described in Tables KA, KB and KC. Results of the RTQ-PCR runs are shown in Tables KD and KE. Table KA. Probe Name Ag2597
Table KB. Probe Name Ag5234
Table KC. Probe Name Ag5235
Table KD. General_screeningjpanel_vl.5
Table KE. Panel 4.1D
CNS_neurodegeneration_vl.O Summary: Ag2597/Ag5234/Ag5235 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
General screening panel vl.5 Summary: Ag5234/Ag5235 Two experiments with two different probe-primer sets are in excellent agreement. Highest expression of this gene is detected in a sample derived from a colon cancer cell line (SW480)(CTs=30). In addition, there is substantial expression associated with two other colon cancer cell lines, a pancreatic cancer cell line, two lung cancer cell lines, a breast cancer cell line, two melanoma cell lines and a cluster of several ovarian cancer cell lines. Thus, the expression of this gene could be used to distinguish the above samples from the other samples in the panel. Moreover, therapeutic modulation of this gene, through the use of small molecule drugs, antibodies or protein therapeutics might be of benefit in the treatment of ovarian, colon, pancreatic, lung, breast cancers or melanoma.
This gene is also expressed at moderate levels in fetal heart (CT=31.1) and at lower levels in the adult heart (CT=34.5). Thus, expression of this gene may be used to differentiate between fetal and adult heart tissue. Furthermore, the higher levels of expression in fetal heart suggest that the protein encoded by this gene may be important for the pathogenesis, diagnosis, and/or treatment of diseases of the heart.
Panel 4.1D Summary: Ag5234/Ag5235 Two experiments with two different prob- primer sets are in excellent agreement. Highest expression of this gene is detected mainly in monocytes stimulated with LPS (CTs=32). Upon activation with pathogens, including bacterial LPS, monocytes contribute to the innate and specific immunity by migrating to the site of tissue injury and releasing inflammatory cytokines. This release contributes to the inflammation process. This transcript encodes for a connexin like protein, a family of proteins that is involved in gap junction and intercellular communication. Thus, the protein encoded by this transcript may play a role in the interaction of activated monocytes with the endothelium. This is the first step necessary for the migration of these cells to injured tissue. Therefore, modulation of the expression or the function of the protein encoded by this gene, by antibodies or small molecules can prevent the recruitment of monocytes and the inflammatory process, and lead to improvement of the symptoms of patients suffering from autoimmune and inflammatory diseases such as asthma, allergies, inflammatory bowel disease, lupus erythematosus, or rheumatoid arthritis.
L. CG52113-01, CG52113-03, CG52113-04, CG52113-05, and CG52113-06: Notch 4 like protein.
Expression of gene CG52113-01 was assessed using the primer-probe sets Ag2665 and Ag2778, described in Tables LA and LB. Results of the RTQ-PCR runs are shown in Tables LC, LD, LE and LF. Please note that CG52113-05 represents a full-length physical clone of the CG52113-01 gene, validating the prediction of the gene sequence.
Table LA. Probe Name Ag2665
Table LB. Probe Name Ag2778
Table LC. CNS_neurodegeneration_vl.O
Table LD. Panel 1.3D
Table LE. Panel 2D
Table LF. Panel 4D
CNS_neurodegeneration_vl.O Summary: Ag2665/Ag2778 Four experiments with two different probe-primer sets are in good agreement. This panel confirms the expression of this gene at low levels in the brain in an independent group of individuals. This gene is found to be slightly down-regulated in the temporal cortex of Alzheimer's disease patients. Therefore, up-regulation of this gene or its protein product, or treatment with specific agonists for this receptor may be of use in reversing the dementia, memory loss, and neuronal death associated with this disease.
Panel 1.3D Summary: Ag2665/Ag2778 Two experiments with two different probe- primer sets are in good agreement. Highest expression of this gene is detected in hippocampus and fetal skeletal muscle (CTs=26-28.7). This gene is expressed at moderate levels in all regions of the central nervous system exammed, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, therapeutic modulation of this gene product may be useful in the treatment of central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Moderate levels of expression of this gene is also seen in cluster of cancer cell lines derived from pancreatic, gastric, colon, lung, liver, renal, breast, ovarian, prostate, melanoma and brain cancers. Thus, expression of this gene could be used as a marker to detect the presence of these cancers. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of pancreatic, gastric, colon, lung, liver, renal, breast, ovarian, prostate, squamous cell carcinoma, melanoma and brain cancers.
Among tissues with metabolic or endocrine function, this gene is expressed at moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
Panel 2D Summary: Ag2665/Ag2778 Two experiments with two different probe- primer sets are in good agreement. Highest expression of this gene is detected in normal lung and a metastatic breast cancer sample (CTs=27-28). This gene show significant expression in both cancer and normal tissue samples derived from colon, ovary, bladder, prostate, liver, breast, thyroid, uterus, kidney and lung. Moderate levels of expression of this gene is also seen in metastatic melanoma. Interestingly, higher expression of this gene is consistently associated with normal lung as compared to corresponding cancer sample. Therefore, expression of this gene may be used to distinguish between cancer and normal lung.
Furthermore, therapeutic modulation of this gene or its protein product may be useful in the treatment of metastatic melanoma, colon, ovary, bladder, prostate, liver, breast, thyroid, uterus, kidney and lung cancers
Panel 4D Summary: Ag2665/Ag2778 Two experiments with two different probe- primer sets are in good agreement. Highest expression of this gene in lung microvascular endothelial cells (CTs=27-28). Moderate to high levels of expression of this gene is mainly seen in endothelial cells. IL-1 beta and TNFalpha treatment reduce the expression of this gene consistently in endothelium samples including HPAEC, HUVEC and lung microvascular EC. Therefore, therapies designed with the protein encoded by this gene may be important in regulating endothelium function including leukocyte extravasation, a major component of inflammation during asthma, IBD, and psoriasis.
In addition, moderate to low levels of expression of this gene is also seen in eosinophils, dendritic cells, resting macrophage, activated CD45RA CD4 lymphocyte, lung and dermal fibroblasts and normal tissues represent by colon, lung, thymus and kidney. Therefore, therapeutic modulation of this gene product may ameliorate symptoms/conditions associated with autoimmune and inflammatory disorders including psoriasis, allergy, asthma, inflammatory bowel disease, rheumatoid arthritis and osteoarthritis
M. CG57542-01: Cadherin. Expression of gene CG57542-01 was assessed using the primer-probe sets Ag3234, Ag3279 and Ag616, described in Tables MA, MB and MC. Results of the RTQ-PCR runs are shown in Tables MD, ME, MF, MG, MH, MI, MJ, MK and ML.
Table MA. Probe Name Ag3234
Table MB. Probe Name Ag3279
Table MC. Probe Name Ag616
Table MD. CNS_neurodegeneration_vl.O
Table ME. General_screeningjpanel_vl.4
Table MF. Panel 1.1
Table MG. Panel 1.2
Table MH. Panel 1.3D
Table MI. Panel 2.2
Table MJ. Panel 4D
Table ML. general oncology screening panel_v_2.4
CNS_neurodegeneration_vl.O Summary: Ag3234/Ag3279 Two experiments with the same probe and primer set produce results that are in excellent agreement. Both experiments show a difference in expression of this gene between Alzheimer's diseased postmortem brains and controls for this gene. Expression is increased in the temporal cortex of patients with AD (p = 0.016 for ag3234 and p = 0.024 for ag3279) and in the hippocampus. Both the temporal cortex and hippocampus are regions that show severe neurodegeneration in AD. In contrast, expression in the occipital cortex, a region that does not degenerate in Alzheimer's disease, is not disregulated. Together, these data suggest that the Cadherin protein encoded by this gene may be involved in the pathology or response to Alzheimer's disease. Therefore, this may be a useful drug target for the treatment of this disease.
General_screeningjjanel_vl.4 Summary: Ag3279 Highest expression of this gene is in the cerebellum (CT=25.9). Significant levels of expression are also seen in other regions of the brain including the amygdala, hippocampus, cerebral cortex, substantia nigra, and thalamus. Cadherins can act as axon guidance and cell adhesion proteins, specifically during development and in the response to injury (ref 1). Manipulation of levels of this protein may be of use in inducing a compensatory synaptogenic response to neuronal death in Alzheimer's disease, Parkinson's disease, Huntington's disease, spinocerebellar ataxia, progressive supranuclear palsy, ALS, head trauma, stroke, or any other disease/condition associated with neuronal loss. In addition, this gene is highly expressed in pituitary gland, adrenal gland, thyroid, pancreas, adult and fetal skeletal muscle, heart and liver, reflecting the widespread role of cadherins in cell-cell adhesion. This observation may suggest that this gene plays a role in normal metabolic and neuroendocrine function and that disregulated expression of this gene may contribute to metabolic diseases (such as obesity and diabetes) or neuroendocrine disorders.
Overall, gene expression is associated with normal tissues rather than cancer cell lines. Loss of function of the related E-cadherin protein has been described in many tumors, along with an increased invasiveness and a decreased prognosis of many carcinomas, including tumors of endocrine glands and their target systems (ref 2). Thus, this gene product might similarly be useful as a protein therapeutic to treat a variety of tumors, since it is found , in normal cells but missing from cancer cells.
References:
1. Ranscht B. (2000) Cadherins: molecular codes for axon guidance and synapse formation. Int. J. Dev. Neurosci. 18: 643-651. PMID: 10978842 2. Potter E., Bergwitz C, Brabant G. (1999) The cadherin-catenin system: implications for growth and differentiation of endocrine tissues. Endocr. Rev.20: 207-239. PMID: 10204118 Panel 1.1 Summary: Ag616 Highest expression of this gene, a cadherin homolog, is seen in pancreas (CT=23.2). Significant expression is also seen in adrenal gland, fetal and adult skeletal muscle, liver and heart. This widespread expression among tissues with metabolic function is consistent with expression seen in General_screening_panel_vl.4. Please see that panel for further discussion of utility of this gene in metabolic disorders.
In addition, there is higher expression in adult liver (CT=27) when compared to expression in fetal liver (CT=34.8). Thus, expression of this gene could be used to differentiate between fetal and adult liver.
Overall, expression in this panel is in agreement with expression in the previous panel. Please see that panel for further discussion of utility of this gene.
Panel 1.2 Summary: Ag616 The expression of this gene in this panel is in agreement with expression in the panels 1.1 and 1.4. Please see these panels for further discussion of utility of this gene.
Panel 1.3D Summary: Ag3234 The expression of this gene in this panel is in agreement with expression in the panels 1.4. See panel 1.4 for further discussion.
Panel 2.2 Summary: Ag3234 The expression of this gene appears to be highest in a sample derived from a normal ovarian tissue (CT=32.3). In addition, there appears to be substantial expression in other samples derived from liver cancers. Furthermore, there appears to be expression specific to normal lung tissue when compared to malignant lung tissue. Thus, the expression of this gene could be used to distinguish normal ovarian tissue from other samples in the panel. Moreover, therapeutic modulation of this gene, through the use of small molecule drugs, protein therapeutics or antibodies could be of benefit in the treatment of liver cancer, ovarian cancer or lung cancer.
Panel 4D Summary: Ag3234/Ag3279 The this gene, a cadherin 23-like molecule, is expressed selectively at moderate levels (CTs=28.1 -30.1) in resting and activated dendritic cells, and in resting and activated macrophages. Thus, small molecule antagonists or therapeutic antibodies that block the function of the cadherin 23-like molecule encoded by this gene may be useful in the reduction or elimination of the symptoms in patients with autoimmune and inflammatory diseases in which dendritic cells and macrophages play an important role in antigen presentation and other functions, such as, but not limited to, including Crohn's disease, ulcerative colitis, multiple sclerosis, chronic obstructive pulmonary disease, asthma, emphysema, rheumatoid arthritis, lupus erythematosus, or psoriasis.
Panel CNS_1 Summary: Ag3279 This panel confirms expression of this gene in the brain. See Panel 1.4 for discussion of utility of this gene in the central nervous system. general oncology screening panel_v_2.4 Summary: Ag3234/Ag3279 Two experiments with same probe-primer sets are in excellent agreement. Highest expression of this gene is detected in metastatic melanoma sample (CTs=27-29). High expression of this gene is detected in metastic melanoma and prostate adenocarcinoma. Therefore, expression of this gene may be used as diagnostic marker to detect the presence of prostate cancer and metastatic melanoma. In addition, moderate to low levels of expression of this gene is also detected in normal and cancer samples derived from colon, lung and kidney. Therefore, therapeutic modulation of this gene or its protein product through the use of protem therapeutics, antibodies or small molecules may be useful in the treatment of metastatic melanoma, prostate, colon, lung and kidney cancers.
N. CG89285-03: Alpha-1-antichymotrypsin.
Expression of gene CG89285-03 was assessed using the primer-probe set Ag5223, described in Table NA. Results of the RTQ-PCR runs are shown in Table NB.
Table NA. Probe Name Ag5223
Table NB. General_screening _panel_vl.5
CNS_neurodegeneration_vl.O Summary: Ag5223 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
General_screening_panel_vl.5 Summary: Ag5223 Expression of this gene is restricted to a sample derived from a liver cancer cell line (CT=34.5) and normal bladder. Thus, expression of this gene could be used to differentiate between this sample and other samples on this panel and as a marker to detect the presence of liver cancer. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of liver cancer.
Panel 4.1D Summary: Ag5223 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
O. CG89285-04: Alpha-1-antichymotrypsin.
Expression of gene CG89285-04 was assessed using the primer-probe set Ag5231, described in Table OA. Results of the RTQ-PCR runs are shown in Table OB.
Table OA. Probe Name Ag5231
Table OB. General_screening_panel_vl.5
Tissue Name Rel . Exp . (%) Tissue Name IRel . Exp . (%)
CNS_neurodegeneration_vl.O Summary: Ag5231 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
General_screeningj)anel_vl.5 Summary: Ag5231 Expression of this gene is restricted to a sample derived from a liver cancer cell line and normal bladder (CT=34.2 - 34.6). Thus, expression of this gene could be used to differentiate between this sample and other samples on this panel and as a marker to detect the presence of liver cancer. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of liver cancer.
Panel 4.1D Summary: Ag5231 Expression of this gene is low/undetectable in all samples on this panel (CTs>35).
P. CG57094-01: PPAR-gamma. Expression of gene CG57094-01 was assessed using the primer-probe sets Ag2012 and Ag383, described in Tables PA and PB. Results of the RTQ-PCR runs are shown in Tables PC, PD, PE, PF, PG, PH, PI, PJ and PK.
Table PA. Probe Name Ag2012
Table PB. Probe Name As383
Table PC. Al comprehensive panel yl.O
Table PD. Ardais Panel 1.1
Table PE. CNS neurodegeneration yl.O
Table PF. Panel 1
Table PG. Panel 1.3D
Table PH. Panel 2D
Table PI. Panel 3D
Table PJ. Panel 4D
Table PK. Panel 5 Islet
AI_comprehensive panel_vl.O Summary: Ag2012 This gene shows a wide spread expression in this panel, with moderate to low expression in samples derived from normal and orthoarthitis/rheumatoid arthritis bone and adjacent bone, cartilage, synovium and synovial fluid samples, from normal lung, COPD lung, emphysema, atopic asthma, asthma, allergy, Crohn's disease (normal matched control and diseased), ulcerative colitis(normal matched control and diseased), and psoriasis (normal matched control and diseased). This gene appears to be upregulated in samples of bone, cartilage and synovium from patients with osteorarthritis when compared to expression in corresponding normal samples. Thus, therapeutic modulation of the expression or function of this gene may be effective in the treatment of oseoarthritis.
Ardais Panel 1.1 Summary: Ag2012 Highest expression of this gene is detected in lung cancer (358) sample (CT=26.6). This gene is expressed both in normal and cancer lung tissues. Higher expression of this gene is associated with the cancer as compared to normal lung. Therefore, expression of this gene may be used as a diagnostic marker for lung cancer and also, therapeutic modulation of this gene through the use of antibodies may be useful in the treatment of lung cancer.
CNS_neurodegeneration_vl.O Summary: Ag2012 This gene is present in the brain as evidenced by expression in this panel and panel 1.3D. No apparent association with Alzheimer's disease is seen. However, Thus, therapeutic modulation of the expression or function of this gene may be effective in the treatment of neurologic diseases.
Panel 1 Summary: Ag383 Highest expression of this gene is detected in placenta (CT=21.7). This gene shows a widespread expression in this panel, which corelates with the expression seen in panel 1.3D. Please see panel 1.3D for further discussion.
Panel 1.3D Summary: Ag2012 Two experiments with same probe and primer sets are in good agreement. Highest expression of this gene is seen in a renal cancer cell line and adipose tissue (CTs=28.7-29). Significant expression is also seen in breast, brain, colon, liver, renal and melanoma cancer cell lines. Thus, expression of this gene could be used to differentiate between the lung cancer cell line and other samples on this panel and as a marker for these cancers. This gene is identical to angiopoeitin related protein 4 (ARP4), which is know to be angiogenic [1]. Since angiogenesis is essential for the growth and metastasis of solid tumors, therapeutic modulation of the expression or function of this ARP protein encoded by this gene, through the use of protein therapeutics or antibodies, may be effective in the treatment of melanoma, brain, colon, renal and liver cancers.
Among tissues with metabolic function, this gene is expressed most highly in adipose with moderate levels in pituitary, adipose, adrenal gland, pancreas, thyroid, and adult and fetal skeletal muscle, heart, and liver. This widespread expression among these tissues suggests that this gene product may play a role in normal neuroendocrine and metabolic and that disregulated expression of this gene may contribute to neuroendocrine disorders or metabolic diseases, such as obesity and diabetes. ARP4 has been widely studied in the context of adipose biology [2]. The mouse gene, known as fasting-induced adipose factor, is predominantly expressed in adipose tissue and is strongly upregulated by fasting in white adipose tissue and liver[3]. The N-terminal and C-terminal portions contain the characteristic coiled-coil domains and fϊbrinogen-like domams that are conserved in angiopoietins. In human and mouse tissues, it is specifically expressed in the liver and they are mainly present in the hepatocytes [4]. Recombinant protein expressed in COS-7 cells is secreted and glycosylated. Furthermore, Angiopoietin-2 has been implicated in adipose tissue regression O 03/040330
[5]. Since this molecule is an angiopoietin homolog that is highly expressed in adipose, this molecule may also play a role in initiation of apoptosis in adipose. Thus, therapeutic modulation of the expression or function of this gene may be effective in the treatment of obesity. In addition, expression of this gene is higher in fetal kidney (CTs=30-31) when compared to expression in adult kidney (CTs35-37). Thus, expression of this gene could be used to differentiate between adult and fetal kidney.
Furthermore, expression of this gene in fetal kidney and renal cell carcinoma-derived cell lines but not in adult kidney, suggests that it may be involved in kidney development and organogenesis and also, in kidney tumorgenesis.
References:
1. Kim I, Kim HG, Kim H, Kim HH, Park SK, Uh CS, Lee ZH, Koh GY. Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis. Biochem J 2000 Mar 15;346 Pt 3:603-10. PMID: 10698685.
2. Yoon JC, Chickering TW, Rosen ED, Dussault B, Qin Y, Soukas A, Friedman JM, Holmes WE, Spiegelman BM. Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation. Mol Cell Biol 2000 Jul;20(14):5343-9. PMID: 10866690 3. Kersten S, Mandard S, Tan NS, Escher P, Metzger D, Chambon P, Gonzalez FJ,
Desvergne B, Wahli W. Characterization of the fasting-induced adipose factor FIAF, a novel peroxisome proliferator-activated receptor target gene. J Biol Chem 2000 Sep 15;275(37):28488-93. PMID: 10862772.
4. Reinmuth N, Stoeltzing O, Liu W, Ahmad SA, Jung YD, Fan F, Parikh A, Ellis LM.Endothelial survival factors as targets for antineoplastic therapy. Cancer J 2001
Nov-Dec;7 Suppl 3:S109-19. PMID: 11779081
5. Cohen B, Barkan D, Levy Y, Goldberg I, Fridman E, Kopolovic J, Rubinstein M. Leptin induces angiopoietin-2 expression in adipose tissues. PMID: 11152449
Panel 2D Summary: Ag2012 Two experiments with two different probe and primer sets produce results that are in excellent agreement, with highest expression in kidney cancer (CTs=22-24). Thus, expression of this gene could be used to differentiate between this sample and other samples on this panel and as a marker to detect the presence of kidney cancer. Furthermore, therapeutic modulation of the expression or function of ARP encoded by this gene through the use of protein therapeutics or antibodies, may be effective in the treatment of kidney cancer.
Panel 3D Summary: Ag2012 Two experiments with two different probe and primer sets produce results that are in excellent agreement, with highest expression in gastric, bladder, renal, pancreatic, and lung cancer cell lines. Thus, expression of this gene could be used to differentiate between these samples and other samples on this panel.
Panel 4D Summary: Ag2012 Two experiments with two different probe and primer sets produce results that are in excellent agreement, with highest expression in small airway epithelium treated with TNF-alpha and IL-lbeta (CTs=24.4). Thus, expression of this gene could be used as a marker of activated epithelium. Interestingly, expression of this gene is upregulated upon immune-stimulation of the airway epithelial cells and lung fibroblasts by cytokines as compared to corresponding resting cells. Furthermore, expression of this gene in LAK cells treated with PMA/ionomycin is also upregulated relative to the expression in resting cells. These data indicate that ARP plays a role in inflammation related to the above cells of the pulmonary system and is thereby implicated as a target for therapeutic intervention by protein and antibody therapeutics, as well as, small molecule pharmaceuticals. A wholly human antibody directed at ARP, for example, may diminish the symptoms of patients with allergy, asthma or emphysema. In addtion, the gene is expressed at significant levels in a wide range of cell types of significance in the immune response in health and disease. These cells include members of the T-cell, B-cell, endothelial cell, macrophage/monocyte, and peripheral blood mononuclear cell family, as well as epithelial and fibroblast cell types from lung and skin, and normal tissues represented by colon, lung, thymus and kidney. Therefore, modulation of the gene product with a functional therapeutic may lead to the alteration of functions associated with these cell types and lead to improvement of the symptoms of patients suffering from autoimmune and inflammatory diseases such as asthma, allergies, inflammatory bowel disease, lupus erythematosus, psoriasis, rheumatoid arthritis, and osteoarthritis.
Panel 5 Islet Summary: Ag2012 Highest expression of this gene is detected in midway differentiated adipose tissue. This gene shows a wide spread expression in this panel, with moderate expressions in adipose, placenta, skeletal muscle, uterus, kidney and small intestine. Interestingly, higher levels of expression of this gene is seen in midway differentiated adipose as compared to undifferentiated and differentiated adipose. Angiopoietin-related protein is shown to be associated with adipose differentiation. Therefore, therapeutic modulation of this gene or ARP encoded by this gene may be useful in the treatment of obesity and diabetes.
Example D: Identification of Single Nucleotide Polymorphisms in NOVX nucleic acid sequences
Variant sequences are also included in this application. A variant sequence can include a single nucleotide polymorphism (SNP). A SNP can, in some instances, be referred to as a "cSNP" to denote that the nucleotide sequence containing the SNP originates as a cDNA. A SNP can arise in several ways. For example, a SNP may be due to a substitution of one nucleotide for another at the polymorphic site. Such a substitution can be either a transition or a transversion. A SNP can also arise from a deletion of a nucleotide or an insertion of a nucleotide, relative to a reference allele. In this case, the polymorphic site is a site at which one allele bears a gap with respect to a particular nucleotide in another allele. SNPs occurring within genes may result in an alteration of the amino acid encoded by the gene at the position of the SNP. bitragenic SNPs may also be silent, when a codon including a SNP encodes the same amino acid as a result of the redundancy of the genetic code. SNPs occurring outside the region of a gene, or in an intron within a gene, do not result in changes in any amino acid sequence of a protein but may result in altered regulation of the expression pattern. Examples include alteration in temporal expression, physiological response regulation, cell type expression regulation, intensity of expression, and stability of transcribed message.
SeqCalling assemblies produced by the exon linking process were selected and extended using the following criteria. Genomic clones having regions with 98% identity to all or part of the initial or extended sequence were identified by BLASTN searches using the relevant sequence to query human genomic databases. The genomic clones that resulted were selected for further analysis because this identity indicates that these clones contain the genomic locus for these SeqCalling assemblies. These sequences were analyzed for putative coding regions as well as for similarity to the known DNA and protein sequences. Programs used for these analyses include Grail, Genscan, BLAST, HMMER, FASTA, Hybrid and other relevant programs.
Some additional genomic regions may have also been identified because selected SeqCalling assemblies map to those regions. Such SeqCalling sequences may have overlapped with regions defined by homology or exon prediction. They may also be included because the location of the fragment was in the vicinity of genomic regions identified by similarity or exon prediction that had been included in the original predicted sequence. The sequence so identified was manually assembled and then may have been extended using one or more additional sequences taken from CuraGen Corporation's human SeqCalling database. SeqCalling fragments suitable for inclusion were identified by the CuraTools™ program SeqExtend or by identifying SeqCalling fragments mapping to the appropriate regions of the genomic clones analyzed.
The regions defined by the procedures described above were then manually integrated and corrected for apparent inconsistencies that may have arisen, for example, from miscalled bases in the original fragments or from discrepancies between predicted exon junctions, EST locations and regions of sequence similarity, to derive the final sequence disclosed herein. When necessary, the process to identify and analyze SeqCalling assemblies and genomic clones was reiterated to derive the full length sequence (Alderborn et al., Determination of Single Nucleotide Polymorphisms by Real-time Pyrophosphate DNA Sequencing. Genome Research. 10 (8) 1249-1265, 2000).
Variants are reported individually but any combination of all or a select subset of variants are also included as contemplated NOVX embodiments of the invention. Table Dl: Variants of nucleotide sequence CG52113-01
Table D2: Variants of nucleotide sequence CG103322-02
Table D3: Variants of nucleotide sequence CG151575-02
Table D4: Variants of nucleotide sequence CG152323-01
Table D5: Variant of nucleotide sequence CG153011-01
Table D6: Variant of nucleotide sequence CG153042-01
Table D7: Variant of nucleotide sequence CG153179-01
Table D8: Variants of nucleotide sequence CG157760-02
Table D9: Variants of nucleotide sequence CG158114-01
Table D10: Variant of nucleotide sequence CG158553-01
Table Dll: Variants of nucleotide sequence CG158983-01
Table D12: Variants of nucleotide sequence CG159015-01
Table D13: Variants of nucleotide sequence CG173007-01
Table D14: Variants of nucleotide sequence CG173357-01
Table D15: Variant of nucleotide sequence CG50387-03
Table D16: Variants of nucleotide sequence CG103134-02
Table D17: Variants of nucleotide sequence CG57542-01
Table D18: Variants of nucleotide sequence CG57774-01
Table D20: Variants of nucleotide sequence CG57094-01
Example E: Molecular cloning of NOV26 variants
For NOV26b, the cDNA coding for the DOMAIN of NOV26a (CG51523-05) from residue 21 to 493 was targeted for "in-frame" cloning by PCR. The PCR template was based on the previously identified plasmid, when available, or on human cDNA(s). For NONs 26c- 26f, the cDΝA coding for the DOMAIN of CG51523-05 from residue 43 to 494 was targeted for "in-frame" cloning by PCR. The PCR template was based on human cDNA(s). For NOVs 26g-r, the cDNA coding for the full-length of CG51523-05 from residue 1 to 523 was targeted for "in-frame" cloning by PCR. The PCR template was based on human cDNA(s).
Table El: Oligonucleotide primers used to clone the target cDNA sequence:
For downstream cloning purposes, the forward primer includes an in-frame Hind III restriction site and the reverse primer contains an in-frame Xho I restriction site.
Two parallel PCR reactions were set up using a total of 0.5-1.0 ng human pooled cDNAs as template for each reaction. The pool is composed of 5 micrograms of each of the following human tissue cDNAs: adrenal gland, whole brain, amygdala, cerebellum, thalamus, bone marrow, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, liver, lymphoma, Burkitt's Raji cell line, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small Intestine, spleen, stomach, thyroid, trachea, uterus. When the tissue of expression is known and available, the second PCR was performed using the above primers and 0.5ng-1.0 ng of one of the following human tissue cDNAs: skeleton muscle, testis, mammary gland, adrenal gland, ovary, colon, normal cerebellum, normal adipose, normal skin, bone marrow, brain amygdala, brain hippocampus, brain substantia nigra, brain thalamus, thyroid, fetal lung, fetal liver, fetal brain, kidney, heart, spleen, uterus, pituitary gland, lymph node, salivary gland, small intestine, prostate, placenta, spinal cord, peripheral blood, trachea, stomach, pancreas, hypothalamus.
The reaction mixtures contained 2 microliters of each of the primers (original concentration: 5 pmol/ul), 1 microliter of lOmM dNTP (Clontech Laboratories, Palo Alto CA) and 1 microliter of 50xAdvantage-HF 2 polymerase (Clontech Laboratories) in 50 microliter-reaction volume. The following reaction conditions were used: PCR condition 1: a) 96°C 3 minutes b) 96°C 30 seconds denaturation c) 60°C 30 seconds, primer annealing d) 72°C 6 minutes extension
Repeat steps b-d 15 times e) 96°C 15 seconds denaturation f) 60°C 30 seconds, primer annealing g) 72°C 6 minutes extension
Repeat steps e-g 29 times e) 72°C 10 minutes final extension
PCR condition 2: a) 96°C 3 minutes b) 96°C 15 seconds denaturation c) 76°C 30 seconds, primer annealing, reducing the temperature by 1 °C per cycle d) 72°C 4 minutes extension Repeat steps b-d 34 times e) 72°C 10 minutes final extension
An amplified product was detected by agarose gel electrophoresis. The fragment was gel-purified and ligated into the pCR2.1 vector (Invitrogen, Carlsbad, CA) following the manufacturer's recommendation. Twelve clones per PCR reaction were picked and sequenced. The inserts were sequenced using vector-specific Ml 3 Forward and Ml 3 Reverse primers and the gene-specific primers in Table .
Table E2: Gene-specific Primers
Example Fl: Angiopoietin-Related Protein (ARP) and Methods of Using ARP
The present invention relates to ARP, a gene surprisingly found to be differentially expressed in clear cell Renal cell carcinoma tissues vs the normal adjacent kidney tissues. Furthermore, this invention demonstrates that ARP is surprisingly differentially expressed in small airway epithelium activated by TNF alpha and IL-1 beta, as well as by lung fibroblasts stimulated by IL-4, IL-9, IL-13 and Interferon gamma relative to untreated lung fibroblasts. Finally, a striking, unexpected upregulation of expression of ARP was observed in Lymphokine-activated killer (LAK) cells treated with the phorbol ester: phorbol-12, 13- myristate acetate (PMA) in combination with ionomycin, relative to the resting cells. The present invention discloses a method of using ARP as a clinical marker for staging clear cell Renal cell carcinomas. Furthermore, increased expression of ARP by stimulated LAK cells may play a role in reduced susceptibility of tumor cells to depletion by LAK cells. For the first time, we are disclosing that ARP may be involved with asthma, allergy and emphysema and that regulating ARP by protein therapeutics, antibodies directed against ARP or by small molecule antagonists may alleviate the symptoms of these pulmonary disorders. The invention also discloses a method of treating a pathology treatable by modulating ARP expression, specifically clear cell Renal cell carcinomas.
Example F2. Differential Gene Expression in clear cell Renal cell carcinomas vs normal adjacent tissues
In order to obtain a comprehensive profile of those genes whose expression is modulated in clear cell Renal cell carcinomas, GeneCalling™ technology, described in detail in Shimkets et al. (1999) and in US Patent No. 5871697, was used to distinguish the gene expression profile of clear cell Renal cell carcinoma tissues with the normal adjacent tissues, obtained from the same patient, during surgical nephrectomy. The tissues were provided to CuraGen from the NDRI under an IRB approved protocol. GeneCalling™ technology relies on Quantitative Expression Analysis to generate the gene expression profile of a given sample and then generates differential expression analysis of pair-wise comparison of these profiles to controls. The comparison in this example is a pool of all tumor tissues vs. a pool of all normal tissues. Polynucleotides exhibiting differential expression were confirmed by conducting a PCR reaction according to the GeneCalling™ protocol, with the addition of a competing unlabelled primer that prevents the amplification from being detected.
Angiopoetin Related Protein (ARP) is overexpressed in 3/5 clear cell renal cell carcinomas, 0/2 papillary renal cell carcinomas and 0/2 uncharacterized renal cell carcinomas (panel 2D). Furthermore ARP is expressed in fetal kidney and renal cell carcinoma- derived cell lines but not in adult kidney (panel 1.3D), an indication of an oncofetal expression pattern often associated with genes involved in kidney development and organogenesis and kidney tumorgenesis.
Data from Panel 4D, indicates that upon immune-stimulation of the airway epithelial cells and lung fibroblasts, ARP is expressed at increased levels. Specifically, we show that expression of ARP in small airway epithelial cells treated with TNF alpha and IL-1 beta is up-regulated ca. 5.4 fold relative to untreated cells. In addition, expression in normal human lung fibroblast cells treated with IL-4, IL-9, IL-9, IL-13 and Interferon gamma is upregulated 7.4, 2, 3.5 and 6.5 fold, respectively, compared to that in resting cells. Finally, expression of ARP in LAK cells treated with PMA/ionomycin is upregulated over 350 fold relative to the expression in resting cells. These data indicate that ARP plays a role in inflammation related to the above cells of the pulmonary system and is thereby implicated as a target for therapeutic intervention by protein and antibody therapeutics as well as small molecule pharmaceuticals. A wholly human antibody directed at ARP, for example, may diminish the symptoms of patients with allergy, asthma or emphysema. A reference (and references therein) for relating airway epithelial cells to asthma and inflammation is: J. Exp. Med. Volume 193, ρρ339-351 by Michael J. Walter et al. (2001). Another, reference for lung fibroblasts and a discussion of asthma and allergy may be found in the review: (abstract included) 1: J Allergy Clin Immunol 1999 Dec;104(6):l 139-46 Genetic and environmental interaction in allergy and asthma. Holgate ST Respiratory Cell and Molecular Biology Research Division, Southampton General Hospital, Southampton, United Kingdom. The upregulation of stimulated LAK cells as seen in Panel 4D-Figure 4 (greater than 350 fold) was remarkable and surprising. The following references about PMA activation of LAK cells are relevant to the present invention:
1.) Correale P, Procopio A, Celio L, Caraglia M, Genua G, Coppola N, Pepe S, Νormanno Ν, Necchio I, Palmieri G, et al.
Phorbol 12-myristate 13 -acetate induces resistance of human melanoma cells to natural-killer- and lymphokine-activated-killer-mediated cytotoxicity. Cancer Immunol Immunother. 1992;34(4):272-8. PMID: 1371427 2.) Maleci A, Alterman RL, Sundstrom D, Kornblith PL, Moskal JR.
Effect of phorbol esters on the susceptibility of a glioma cell line to lymphokine-activated killer cell activity. JΝeurosurg. 1990 Jul;73(l):91-7. PMID: 2352027 3.) Νishimura T, Burakoff S J, Herrmann SH.
Inhibition of lymphokine-activated killer cell-mediated cytotoxicity by phorbol ester.
J Immunol. 1989 Mar 15;142(6):2155-61. PMID: 2646377 Work discussed in 3) indicates that PMA induces down-regulation of LAK cell- mediated cytotoxicity (by inactivation of protein kinase C activity in LAK cells). The exact role of ARP is not known as yet in LAK cells, however, based on the TaqMan data presented in this invention, ARP plays a role in inflammation and may be implicated in the ability of LAK cells to effectively destroy tumor cells as well. Therefore a therapeutic antibody directed against ARP (and thereby preventing ARP from being upregulated), may be therapeutic in treating cancer because of the resulting increased activity of LAK cells.
Example F3. Comparing expression of ARP with vascular endothelial growth factor (VEGF) expression. Paradis and coworkers assessed NEGF expression in a large series of renal tumors with a long follow-up, correlated with the usual histo-prognostic factors and survival. Their study revealed that in the group of clear cell RCCs, NEGF expression was positively correlated with both nuclear grade (P=0.05) and size of the tumor (P=0.05). Furthermore, a significant correlation was observed between NEGF expression and microvascular count (P=0.04). Finally, cumulative survival rate was significantly lower in the group of patients with clear cell RCCs expressing NEGF (log rank test, P=0.01). In the Cox model, VEGF expression was a significant independent predictor of outcome, as well as stage and nuclear grade. (Paradis V, Lagha ΝB, Zeimoura L, Blanchet P, Eschwege P, Ba Ν, Benoit G, Jardin A, Bedossa P. Expression of vascular endothelial growth factor in renal cell carcinomas. Nirchows Arch 2000 Apr;436(4):351-6). The expression profile of NEGF was compared with the expression profile of ARP. As shown in figure 3, ARP overexpression is higher and more specific than NEGF, indicating that it could be used as a better clinical marker and that more efficacious and specific therapeutics can be directed at regulating ARP expression. These results also indicate that a treatment that modulates the expression of NEGF and ARP at the same time may achieve synergistic effects. An example of a treatment that can mitigate the effects of the expression of both VEGF and ARP is a bispecific antibody directed both these targets. The bi-specific antibody contemplated to be within the scope of claims for this invention may be an antibody generated by quadroma technology, or by chemical cross- linking of mono-specific antibodies (one directed against VEGF, the other against ARP) or a bi-specific single chain antibody dimer. Formulations of single chain antibodies may include, but not limited to: VL(a)-Limcer-VH(a)-Linker-VL(b)-Linker-NH(b). For examples of bispecific antibodies see: US Patent 6,030,792 by Otterness et al., the references therein included here, Multivalent single chain antibodies, US Patents 5,892,020, 5,877,291 by
Mezes et al., US Patent 6,071,515: Dimer and multimer forms of single chain polypeptides by Mezes et al., and US Patent 6,121,424: Multivalent antigen-binding proteins by Whitlow et al.
Example F4: Human PPAR gamma angiopoietin related protein
Human PPAR gamma angiopoietin related protein is also known as angiopoietin related protein (GenBank ED AF 153606), human hepatic angiopoietin-related protein (GeneBank ID AF169312) or angiopoietin-like protein PP1158 (GeneBank ID AF202636). Recombinant HFARP acts as an apoptosis survival factor for vascular endothelial cells, but does not bind to Tiel or Tie2 (endothelial-cell tyrosine kinase receptors). These results suggest that HFARP may exert a protective function on endothelial cells through an endocrine action. (Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin- related protein that prevents endothelial-cell apoptosis. Kim I, Kim HG, Kim H, Kim HH, Park SK, Uhm CS, Lee ZH, Koh GY Biochem J 2000 Mar 15; 346 Pt 3:603-10 .). The transcriptional induction of PGAR follows a rapid time course typical of immediate-early genes and occurs in the absence of protein synthesis. The expression of PGAR is predominantly localized to adipose tissues and placenta and is consistently elevated in genetic models of obesity. Hormone-dependent adipocyte differentiation coincides with a dramatic early induction of the PGAR transcript. Alterations in nutrition and leptin administration are found to modulate the PGAR expression in vivo. Taken together, these data suggest a possible role for PGAR in the regulation of systemic lipid metabolism or glucose homeostasis. (Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation. Yoon JC, Chickering TW, Rosen ED, Dussault B, Qin Y, Soukas A, Friedman JM, Holmes WE, Spiegelman BM Mol Cell Biol 2000 Jul;20(14):5343-9). The mouse ortholog gene is known as fasting-induced adipose factor FIAF is strongly up-regulated by fasting in white adipose tissue and liver. Moreover, FIAF mRNA is decreased in white adipose tissue of PPARgamma +/- mice. FIAF protein can be detected in various tissues and in blood plasma, suggesting that FIAF has an endocrine function. Its plasma abundance is increased by fasting and decreased by chronic high fat feeding.
AF153606.1 Homo sapiens angiopoietin-related protein mRNA
GCGGATCCTCACACGACTGTGATCCGATTCTTTCCAGCGGCTTCTGCAACCAAGCGGGTCTTACCCCCGG TCCTCCGCGTCTCCAGTCCTCGCACCTGGAACCCCAACGTCCCCGAGAGTCCCCGAATCCCCGCTCCCAG GCTACCTAAGAGGATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTG
CTACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATG TCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGTGCGCGAACACCGGAGCGCACCCGCAGTCAGCTGA GCGCGCTGGAGCGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAGGGGTCCACCGACCTCCCG TTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGAACA GCAGGATCCAGCAACTCTTCCACAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACCTGCGAAT
TCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCCAAGCCTGCC CGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCACAATGTCAGCCGCCTGCACCGGC TGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCCAGCCTCA GGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATTCAGAGGCGC CACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGATCCCCACGGCG
AGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCT GCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTAT AGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCG TACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACAAGAACTGCGCCAAGAGCCTCTCTGG AGGCTGGTGGTTTGGCACCTGCAGCCATTCCAACCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAG CGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCCGCTGCAGGCCACCA CCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCCTCCTAGCGTCCTGGCTGGGCCTGGTCCCAGGCCCA CGAAAGACGGTGACTCTTGGCTCTGCCCGAGGATGTGGCCAAGACCACGACTGGAGAAGCCCCCTTTCTG AGTGCAGGGGGGCTGCATGCGTTGCCTCCTGAGATCGAGGCTGCAGGATATGCTCAGACTCTAGAGGCGT GGACCAAGGGGCATGGAGCTTCACTCCTTGCTGGCCAGGGAGTTGGGGACTCAGAGGGACCACTTGGGGC CAGCCAGACTGGCCTCAATGGCGGACTCAGTCACATTGACTGACGGGGACCAGGGCTTGTGTGGGTCGAG AGCGCCCTCATGGTGCTGGTGCTGTTGTGTGTAGGTCCCCTGGGGACACAAGCAGGCGCCAATGGTATCT GGGCGGAGCTCACAGAGXTCTTGGAATAAAAGCAACCTCAGAACAAAAAAAAAAAAAAAAAAGCGGAGCT CACAGAGTTCTTGGAATAAAAGCAACCTCAGAACAAAAAA (SEQ ID NO:, 388)
AF169312 hepatic angiopoietin-related protein (ANGPT 2)
TCGCACCTGGAACCCCAACGTCCCCGAGAGTCCCCGAATCCCCGCTCCCAGGCTACCTAAGAGGATGAGC GGTGCTCCGACGGCCGGGGCAGCCCTGATGCTCTGCGCCGCCACCGCCGTGCTACTGAGCGCTCAGGGCG GACCCGTGCAGTCCAAGTCGCCGCGCTTTGCGTCCTGGGACGAGATGAATGTCCTGGCGCACGGACTCCT GCAGCTCGGCCAGGGGCTGCGCGAA.CACGCGGAGCGCACCCGCAGTCAGCTGAGCGCGCTGGAGCGGCGC CTGAGCGCGTGCGGGTCCGCCTGTCAGGGAACCGAQGGGTCCACCGACCTCCCGTTAGCCCCTGAGAGCC GGGTGGACCCTGAGGTCCTTCACAGCCTGCAGACACAACTCAAGGCTCAGAACAGCAGGATCCAGCAACT CTTCCACAAGGTGGCCCAGCAGCAGCGGCACCTGGAGAAGCAGCACCTGCGAATTCAGCATCTGCAAAGC CAGTTTGGCCTCCTGGACCACAAGCACCTAGACCATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGC CCGAGATGGCCCAGCCAGTTGACCCGCCTCACAATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCA GGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTGGACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTT TTGGTGAACTGCAAGATGACCTCAGATGGAGGCTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGG ACTTCAACCGGCCCTGGGAAGCCTACAAGGCGGGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCT GGAGAAGGTGCATAGCATCATGGGGGACCGCAACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGC AACGCCGAGTTGCTGCAGTTCTCCGTGCACCTGGGTGGCGAGGACACGGCCTATAGCCTGCAGTTCACTG' CACCCGTGGCCGGCCAGCTGGGCGCCACCACCGTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTG GGACCAGGATCACGACCTCCGCAGGGACAAGAACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGC ACCTGCAGCCATTCCAACCTCAACGGCCAGTACTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGA AGGGAATCTTCTGGAAGACCTGGCGGGGCCGCTACTACTCGCTGCAGGCCACCACCATGTTGATCCAGCC CATGGCAGCAGAGGCAGCCTCCTAGCGTCCTGGCTGGGCCTGGTCCCAGGCCCACGAAAGACGGTGACTC TTGGCTCTGCCCGAGGATGTGGCCGTTCCCTGCCTGGGCAGGGGCTCCAAGGAGGGGCCATCTGGAAACT TGTGGACAGAGAA (SEQ ID NO: 389)
AF2o2636 angiopoietin-like protein PP1158
GGAGAAGAAGCCGAGCTGAGCGGATCCTCACACGACTGTGATCCGATTCTTTCCAGCGGCTTCTGCAACC AAGCGGGTCTTACCCCCGGTCCTCCGCGTCTCCAGTCCTCGCACCTGGAACCCCAACGTCCCCGAGAGTC CCCGAATCCCCGCTCCCAGGCTACCTAAGAGGATGAGCGGTGCTCCGACGGCCGGGGCAGCCCTGATGCT CTGCGCCGCCACCGCCGTGCTACTGAGCGCTCAGGGCGGACCCGTGCAGTCCAAGTCGCCGCGCTTTGCG -TCCTGGGACGAGATGAATGTCCTGGCGCACGGACTCCTGCAGCTCGGCCAGGGGCTGCGCGAACACGCGG AGCGCACCCGCAGTCAGCTGAGCGCGCTGGAGCGGCGCCTGAGCGCGTGCGGGTCCGCCTGTCAGGGAAC CGAGGGGTCCACCGACCTCCCGTTAGCCCCTGAGAGCCGGGTGGACCCTGAGGTCCTTCACAGCCTGCAG
ACACAACTCAAGGCTCAGAACAGCAGGATCCAGCAACTCTTCCACAAGGTGGCCCAGCAGCAGCGGCACC TGGAGAAGCAGCACCTGCGAATTCAGCATCTGCAAAGCCAGTTTGGCCTCCTGGACCACAAGCACCTAGA CCATGAGGTGGCCAAGCCTGCCCGAAGAAAGAGGCTGCCCGAGATGGCCCAGCCAGTTGACCCGGCTCAC AATGTCAGCCGCCTGCACCGGCTGCCCAGGGATTGCCAGGAGCTGTTCCAGGTTGGGGAGAGGCAGAGTG GACTATTTGAAATCCAGCCTCAGGGGTCTCCGCCATTTTTGGTGAACTGCAAGATGACCTCAGATGGAGG
CTGGACAGTAATTCAGAGGCGCCACGATGGCTCAGTGGACTTCAACCGGCCCTGGGAAGCCTACAAGGCG GGGTTTGGGGATCCCCACGGCGAGTTCTGGCTGGGTCTGGAGAAGGTGCATAGCATCACGGGGGACCGCA ACAGCCGCCTGGCCGTGCAGCTGCGGGACTGGGATGGCAACGCCGAGTTGCTGCAGTTCTCCGTGCACCT GGGTGGCGAGGACACGGCCTATAGCCTGCAGCTCACTGCACCCGTGGCCGGCCAGCTGGGCGCCACCACC GTCCCACCCAGCGGCCTCTCCGTACCCTTCTCCACTTGGGACCAGGATCACGACCTCCGCAGGGACAAGA
ACTGCGCCAAGAGCCTCTCTGGAGGCTGGTGGTTTGGCACCTGCAGCCATTCCAACCTCAACGGCCAGTA CTTCCGCTCCATCCCACAGCAGCGGCAGAAGCTTAAGAAGGGAATCTTCTGGAAGACCTGGCGGGGCCGC TACTACCCGCTGCAGGCCACCACCATGTTGATCCAGCCCATGGCAGCAGAGGCAGCCTCCTAGCGTCCTG GCTGGGCCTGGTCCCAGGCCCACGAAAGACGGTGACTCTTGGCTCTGCCCGAGGATGTGGCCGTTCCCTG CCTGGGCAGGGGCTCCAAGGAGGGGCCATCTGGAAACTTGTGGACAGAGAAGAAGACCACGACTGGAGAA
GCCCCCTTTCTGAGTGCAGGGGGGCTGCATGCGTTGCCTCCTGAGATCGAGGCTGCAGGATATGCTCAGA CTCTAGAGGCGTGGACCAAGGGGCATGGAGCTTCACTCCTTGCTGGCCAGGGAGTTGGGGACTCAGAGGG ACCACTTGGGGCCAGCCAGACTGGCCTCAATGGCGGACTCAGTCACATTGACTGACGGGGACCAGGGCTT GTGTGGGTCGAGAGCGCCCTCATGGTGCTGGTGCTGTTGTGTGTAGGTCCCCTGGGGACACAAGCAGGCG CCAATGGTATCTGGGCGGCGTCACAGAGTTCTTGGAATAAAAGCAACCTCAGAACACTTAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA (SEQ ID NO: 390)
NP_057193 angiopoietin related protein MSGAPTAGAA MLCAATAVLLSAQGGPVQSKSP FASWDEMSrVIiAHG QLGQGCANTGAHPQSAERAGA
R SACGSACQGTEGSTDLPLAPESRVDPEV HSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQ SQFGL DHKH DHEVAKPARRKR PEMAQPVDPAHNVSRLHR PRDCQELFQVGERQSGLFEIQPQGSPP F VNCKMTSDGGWTVIQRRHDGSVDFNRP EAYKAGFGDPHGEFWLG EKVHSITGDRNSRLAVQLRD D GNAE LQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSG SVPFST DQDHDLRRDKNCAKSLSGG WF GTCSHSN NGQYFRSIPQQRQK KKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
(SEQ ID NO:39X)
AAG22490 angiopoietin-like protein PP1158
MSGAPTAGAA MLC-.^TAVLLSAQGGPVQSKSPRFAS DEMNVL-?^GLLQ GQG REHAERTRSQ SALE RRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQ KAQNSRIQQ FHKVAQQQRHLEKQHLRIQHL
QSQFGLLDHKHLDHEVAKPARR RLPEMAQPVDPAHNVSR HR PRDCQE FQVGERQSGLFEIQPQGSP PF VNCKMTSDGG TVIQRRHDGSVDFNRP EAYKAGFGDPHGEF G EKVHSITGDRNSRLAVQLRDW DGNAELLQFSVH GGEDTAYSLQ TAPVAGQ GATTVPPSG SVPFSTWDQDHD RRDKNCAKSLSGGVJW FGTCSHSNLNGQYFRSIPQQRQKL KGIF KTWRGRYYP QATTM IQPMAAEAAS (SEQ ID NO -.392)
Example F5: GeneCalling results from Job 36320 - all kidney cancer vs all Kidney NAT
abh af153606 ARP ; Human anfliop ietin-related a — protein, (growth factor)
„, . Band Fold c. . . . Set Visual Trap Info
Band ID
0ffset Confirm Diff. Sifl SetA B Inspection Score J1 J2 R1 R2
»dOpO-69.5 493 unconf. 2.3 91 108.4 47.3
(33.6) (6.1)
Pass- 8532 12.7 1
• q0c0-131.2 (131 ) 8S6 67.3 .96 Complete (444) (28) GZ1 comment
• pOcO-131.1 896 unconf. 3989 76.2
5.2 1
(143.6) (9.7)
Results of the GeneCalling job 36320 comparing renal cancers to normal adjacent kidney tissues. Polynucleotides- for e.g. Band ID g0c0-131.2 was identified as being differentially expressed and was confirmed by conducting a PCR reaction according to the
GeneCalling™ protocol, with the addition of a competing unlabelled primer that prevents the amplification from being detected and is represented as "Pass complete" in the chart above.
Example F6: TaqMan Panels
Panel: 1.3D Panel: 4D
Panel:3D
Example F7: Comparing ARP TaqMan expression in panel 2d with QEA electrophoresis profile
Example F8: Comparing NEGF and ARP
QEA electrophoresis profile for VEGF (A) and ARP (B) and RTQ-PCR expression profile for NEGF (C) and ARP (D). The differential expression profile of the CG57094 is better than VEGF as demonstrated by GeneCalling and RTQ-PCR.
A B
Example F9: gene expression in tumor cells exposed to serum starvation, acidosis and anoxia and in brain tumor xenograft, RTQ-PCR on HASS panel v 1.0
The microenvironment within tumors is significantly different from that in normal tissues. Many regions within tumors are transiently or chronically hypoxic due to unbalanced blood supply and significant perfusion heterogeneities. This exacerbates tumor cells' natural tendency to overproduce acids, resulting in very acidic ph values. The hypoxia, trophic limitation and acidity of tumors have important consequences for antitumor therapy and can contribute to the progression of tumors to a more aggressive metastatic phenotype. By subject a set of tumor cell lines to serum starvation, acidosis and anoxia for different time periods, we are modeling the tumor microenviroment.
The HASS panel v 1.0 plates are comprised of 93 cDNA samples and two controls. Specifically, 81 of these samples are derived from cultured human cancer cell lines that had been subjected to serum starvation, acidosis and anoxia for different time periods as well as controls for these treatments, 3 samples of human primary cells, 9 samples of malignant brain cancer (4 medulloblastomas and 5 glioblastomas) and 2 controls. The human cancer cell lines are obtained from ATCC (American Type Culture Collection) and fall into the following tissue groups: breast cancer, prostate cancer, bladder carcinomas, pancreatic cancers and CNS cancer cell lines. These cancer cells are all cultured under standard recommended conditions. The treatments used (serum starvation, acidosis and anoxia) have been previously published in the scientific literature. The primary human cells were obtained from Clonetics (Walkersville, MD) and were grown in the media and conditions recommended by Clonetics. The malignant brain cancer samples are obtained as part of a collaboration (Henry Ford Cancer Center) and are evaluated by a pathologist prior to CuraGen receiving the samples. RNA was prepared from these samples using the standard procedures. The genomic and chemistry control wells have been described previously.
Results:
CG57094 is expressed at the highest level in U87 cells exposed to hypoxia and acidosis (CT=22.7). The expression of this gene is induced in MCF-7 (breast cancer cell line), T24 (bladder cancer cell line), CaPaN (pancreatic cancer cell line), U87 (CNS cancer), and LnCAP (prostate cancer) cells exposed to low oxygen concentrations. This indicates that expression of this gene may be induced in areas of low oxygen tension in tumors. The gene is also expressed at a higher level in gliomas compared to meduUoblastoms and may be used as a marker to distinguish the different kinds of brain cancer. Hence, the therapeutic inhibition of this gene activity, through the use of small molecule drugs or antibodies, might be of utility in the treatment of the above listed cancer types.
HASS panel v 1.0 expression
Table F9:
Rel. Expr., %
Tissue Name tmll202t_ag2012_al
MCF-7 Cl 0.2
MCF-7 C2 0.2
MCF-7 C3 0.3
MCF-7 C4 0.2
MCF-7 C5 0.3
MCF-7 C6 0.6
MCF-7 C7 6.6
MCF-7 C9 10
MCF-7 CIO 0.4
MCF-7 Cll 0.1
MCF-7 C12 0.5
MCF-7 C13 4.5
MCF-7 C15 4.2
MCF-7 C16 0.6
MCF-7 C17 1
T24 Dl 2.9
T24 D2 0.5
T24 D3 1.7
T24 D4 1.3
T24 D5 2.7
T24 D6 0.1
T24 D7 20.6
T24 D9 4.4
T24 D10 0.9
T24 D11 0.7
T24 D12 0.3
T24 D13 14.7
T24 D15 3.9
T24 D16 1.2
T24 D17 2.9
CAPaN Bl 3.8
CAPa B2 1.9
CAPaN B3 0.6
CAPaN B4 1.3
CAPaN B5 1.7
CAPaN B6 5.6
CAPaN B7 23
CAPaN B8 20.3
CAPaN B9 59.9
CAPaN BIO 1.9
CAPaN Bll 1.9
CAPaN B12 4.6
CAPaN B13 40.9
CAPaN B14 8.1
CAPaN B15 5
CAPaN B16 8.5 CAPaN B17 18.1 U87-MGF1(B) 1.8 U87-MGF2 1.2 U87-MGF3 0 U87-MGF4 2.4 U87-MGF5 3.9 U87-MGF6 0 U87-MGF7 59.9 U87-MGF8 16.8 U87-MGF9 39 U87-MG F10 9.3 U87-MGF11 0.1 U87-MGF12 4.9 U87-MGF13 71.1 U87-MG F14 30 U87-MGF15 100 U87-MGF16 7 U87-MG F17 14.6 LnCAPAl 0.1 LnCAPA2 0.1 LnCAP A3 0.1 LnC AP A4 0.1 LnCAP A5 0 LnCAP A6 0 LnCAP A7 0.9 LnCAP A8 0.4 LnCAP A9 0.2 LnCAP A10 0 LnCAP All 0.1 LnCAP A12 0 LnCAP A13 0.1 LnCAP A14 0.1 LnCAPAl 5 0.1 LnCAPAl 6 0.1 LnCAP A17 0.1 Primary Astrocytes 5.8
Primary Renal Proximal Tubule Epithelial cell A2 14.5 Primary melanocytes A5 0.3
126443 - 341 medullo 0.2
126444 - 487 medullo 2.1
126445 - 425 medullo 0
126446 - 690 medullo 1.9
126447 - 54 adult glioma 2.5
126448 - 245 adult glioma 11.7
126449 - 317 adult glioma 12.1 126450 -212 glioma 0.8 12645 -456 glioma 2.3 Example F10: Expression and therapeutic relevance in inflammatory related human diseased and normal tissues.
CG57094 acts as an apoptosis survival factor for vascular endothelial cells [Kim I, Kim HG, Kim H, Kim HH, Park SK, Uhm CS, Lee ZH, Koh GY. Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis. Biochem J. 2000 Mar 15;346 Pt 3:603-10]. Interestingly that epithelium cells and fibroblasts activated with promflammatory cytokines as well as LAK cells expressed high levels of CG57094 mRNA. The above results suggest that CG57094 is an important regulator of inflammation. We used RTQ PCR to test expression of CG57094 mRNA in inflammatory tissues represented on Al comprehensive panel.
Description of AI_comprehensive panel_vl.O
The plates for AI_comprehensive panel_vl.0 include two control wells and 89 test samples comprised of cDNA isolated from surgical and postmortem human tissues obtained from the Backus Hospital and Clinomics (Frederick, MD). Total RNA was extracted from tissue samples from the Backus Hospital in the Facility at CuraGen. Total RNA from other tissues was obtained from Clinomics.
Joint tissues including synovial fluid, synovium, bone and cartilage were obtained from patients undergoing total knee or hip replacement surgery at the Backus Hospital. Tissue samples were immediately snap frozen in liquid nitrogen to ensure that isolated RNA was of optimal quality and not degraded. Additional samples of osteoarfhritis and rheumatoid arthritis joint tissues were obtained from Clinomics. Normal control tissues were supplied by Clinomics and were obtained during autopsy of trauma victims.
Surgical specimens of psoriatic tissues and adjacent matched tissues were provided as total RNA by Clinomics. Two male and two female patients were selected between the ages of 25 and 47. None of the patients were taking prescription drugs at the time samples were isolated.
Surgical specimens of diseased colon from patients with ulcerative colitis and Crohns disease and adjacent matched tissues were obtained from Clinomics. Bowel tissue from three female and three male Crohn's patients between the ages of 41-69 were used. Two patients were not on prescription medication while the others were taking dexamethasone, phenobarbital, or tylenol. Ulcerative colitis tissue was from three male and four female patients. Four of the patients were taking lebvid and two were on phenobarbital. Total RNA from post mortem lung tissue from trauma victims with no disease or with emphysema, asthma or COPD was purchased from Clinomics. Emphysema patients ranged in age from 40-70 and all were smokers, this age range was chosen to focus on patients with cigarette-linked emphysema and to avoid those patients with alpha- lanti-trypsin deficiencies. Asthma patients ranged in age from 36-75, and excluded smokers to prevent those patients that could also have COPD. COPD patients ranged in age from 35-80 and included both smokers and non-smokers. Most patients were taking corticosteroids, and bronchodilators.
In the labels employed to identify tissues in the AI_comprehensive panel_vl.O panel, the following abbreviations are used: Al = Autoimmunity
Syn = Synovial
Normal = No apparent disease
Rep22 /Rep20 = individual patients
RA = Rheumatoid arthritis Backus = From Backus Hospital
OA = Osteoarthritis
(SS) (BA) (MF) = Individual patients
Adj = Adjacent tissue
Match control = adjacent tissues -M = Male
-F = Female
COPD = Chronic obstructive pulmonary disease
Results. CG57094, Angiopoeitin Related Protein, mRNA is clearly over expressed in tissues form osteoarthritis patients (CT=26-29). In addition ARP is expressed in moderate levels in rheumatoid arthritis, psoriasis, ulcer colitis, asthma, emphysema and Crohn's disease tissues. This indicate that the gene is involved in regulation of inflammation by possible promoting survival potentially harmfully cellular components such as T killer cells. Therefore therapeutic inhibition of this gene product, through the use of small molecule drugs or antibodies, might be of utility in the treatment of the above listed inflammatory diseases.
AI_comprehensive panel vl.O expression
Example Fll: Gene Expression analysis using CuraChip in human tissues from tumors and from equivalent normal tissues
CuraGen has developed a gene microarray (CuraChip 1.2) for target identification. It provides a high-throughput means of global mRNA expression analyses of CuraGen's collection of cDNA sequences representing the Pharmaceutically Tractable Genome (PTG). This sequence set includes genes which can be developed into protein therapeutics, or used to develop antibody or small molecule therapeutics. CuraChip 1.2 contains ~11,000 oligos representing approximately 8,500 gene loci, including (but not restricted to) kinases, ion channels, G-protein coupled receptors (GPCRs), nuclear hormone receptors, proteases, transporters, metabolic enzymes, hormones, growth factors, chemokines, cytokines, complement and coagulation factors, and cell surface receptors.
The CuraChip cDNAs were represented as 30-mer oligodeoxyribonucleotides (oligos) on a glass microchip. Hybridization methods using the longer CuraChip oligos are more specific compared to methods using 25-mer oligos. CuraChip oligos were synthesized with a linker, purified to remove truncated oligos (which can influence hybridization strength and specificity), and spotted on a glass slide. Oligo-dT primers were used to generate cRNA probes for hybridization from samples of interest. A biotin-avidin conjugation system was used to detect hybridized probes with a fluorophore-labeled secondary antibody. Gene expression was analyzed using clustering and correlation bioinformatics tools such as
Spotfire® (Spotfire, Inc., 212 Elm Street, Somerville, MA 02144) and statistical tools such as multivariate analysis (MVA).
Normalization method used in CuraChip software
The median fluorescence intensity of each spot and a background for each spot is read on a scale from 0 to 65,000. CuraGen's CuraChip software, developed in-house, has the capability to present the user with either the raw data (median intensities) or normalized data. If normalized data is chosen, the CuraChip software uses the following method to do mean normalization. The normalization is based on each slide/experiment. Suppose we have:
• fg_median is the signal/foreground median for each slide/experiment;
• bκj_median is the background median for each slide/experiment;
• original_value is the difference between fg_median and bg_median; flag is an indicator of a spot's success or failure, where 0 means success and 1 means failure; raw_fg_ ean is the raw foreground mean for each slide/experiment; raw_bg_mean is the raw background mean for each slide/experiment; trim_percentage is the trim percentage for each slide/experiment; this could be defined by the user; currently we are using 2% as the trim percentage for each slide/experiment; nSpots is the number of spots on each slide; nSlides is the number of slides in each experiment; fg_mean is the trimmed foreground mean for each slide/experiment; bg_ ean is the trimmed background mean for each slide/experiment; max_fg_mean is a constant among all slides/experiments, currently 2200.0; normalized_value is the final normalized value; coeff is the normalization co-efficient;
MAX_VALUE is a constant representing the highest possible fluorescence reading, currently
65,000.
Step 1. Calculate trimmed foreground and background means For each slide/experiment, we first calculate the trimmed foreground mean and the trimmed background mean of all spots, suppose nSpots, on each slide. For each spot, if the data is acceptable (flag=0), we calculate the raw foreground mean and background mean by subtracting the background median from the foreground median for each spot. This is designated as a spot's "original value". (Note: If flag=l, all values are set to 0.)
original_value ~ fg_median — bg_median;
if ( flag == 0 ) // experiment is successful
{ raw_fg_mean = original_value ; raw_bg_mean = bg_median;
} else // experiment is failed
{ raw_fg_mean = 0. 0; raw_bg_mean = 0. 0; } After that, we remove (trim) the top and bottom 2% of data points from the data set. After the above calculation, we have nSpot number of foreground means and background means for each slide/experiment, and both lists are sorted. Suppose we have the following sorted lists:
raw_fg_mean [l ] , raw_fg_mean [2] , ..., raw_fg_mean [N] ; N = 1 , nSpots ; raw_bg_mean [ 1 ] , raw__bg_mean [2] , ..., raw_bg_mean [N] ; N = 1, nSpots,-
then we calculate the trimmed data points for each slide/experiment. Suppose α is the trimmed start data point and b is the trimmed end data point, we have:
a = Cβil nSpots * trim_percentage ); b = floor(nSpots * (1 — trim_percβntage);
The "background mean" is calculated from the background medians for the trimmed data set. For the background mean, we simply calculate the average background mean in interval [α,b] then assign to bg meαn:
bg_mean = (raw_bg_mean [ a ] + raw_bg_mean [a+1] +...+ raw_bg_mean [b] ) / (b- a+1) ;
The "foreground mean" is calculated from the "original values" (i.e. background- subtracted spot signal medians); only "original values" greater than 500 are used for this calculation (excluding the trimmed top and bottom 2% of the data). Suppose the sum of those foreground means is sum_rαwjg_meαn and the amount of those foreground means is k.
fg_mean = sιm_raw_fg_mean / k;
For clarity, a snippet code in Java looks like the following,
int k = 0; double sum_raw_fg_mean = 0.0;
for (int j = a; j < Jb; j++) { if { raw_fg_mean [j ] > 500 ) { sum_raw_fg_mean ~ sum_raw_fg_mean + raw_fg_mean [j] \ k++; } }
fg_mean = sum_raw_fg_mean / k;
After the calculation of trimmed foreground means and background means for all slides is complete, we start our normalization procedure.
Step 2. Normalize data
For each slide a normalization coefficient is calculated which compares the foreground mean of the slide to a fixed maximum foreground mean (2200). This coefficient is:
coeff = max_fg_mean I fg_ ean;
The normalized value of each spot is then calculated by multiplying the spot's "original value" by the normalization coefficient. Note that if this value is greater than the maximum reading of 65,000, then the value of 65,000 is used as the normalized value. Also note that if a spot's "original value" is less than the background value, the background value is used.
Recall that origri- aI_value = fg_median — bg median
if ( original_value > bg_mean ) { normallzed_value = min(coeff * original_value, MAX_VALUE); } else { normal ized_value = coeff *bg_mean;
} '
The normalized_value for each spot is the final (normalized) value used in the analysis Example F12: Threshhold for CuraChip data analysis
A number of control spots are present on CuraChip 1.2 for efficiency calculations and to provide alternative normalization methods. For example, CuraChip 1.2 contains a number of empty or negative control spots, as well as positive control spots containing a dilution series of oligos that detect the highly-expressed genes Ubiquitin and glyceraldehyde-3- phosphate dehydrogenase (GAPD). An analysis of spot signal level was performed using raw data from 67 hybridizations using all oligos. The maximum signal intensity for each oligo across all 67 hybridizations was determined, and the fold-over-background for this maximum signal was calculated (i.e. if the background reading is 20 and the raw spot intensity is 100, then the fold-over-background for that spot is 5x). The negative control or empty spots do occasionally "fire" or give a signal over the background level; however, they do not fire very strongly, with 77.1% of empty spots firing <3x over background and 91.7% <5x (see burgundy bars in figure below). The positive control spots (Ubiquitin and GAPD, the light blue and dark blue bars, respectively) always fired at >100x background. The experimental oligos (CuraOligos, in yellow below) fired over the entire range of intensities, with some at low fold-over-background intensities. Since the negative control spots do fire occasionally at low levels, we have set a suggested threshhold for data analysis at >5x background.
Table F12a: CuraChip normalization data
Expression Levels ; Controls vs . Experimental {raw data)
0-2 2-3 3-3 4-5 5-10 10- 100- XL0Q0
100 1000
Fold Exp ession. Over Bae groimd Results of PTG Chip 1.2: One hundred seventy-eight samples of RNA from tissues obtained from surgically dissected tumors, non-diseased tissues from the corresponding organs and tumor xenografts grown in nude nu/nu mices were used to generate probes and run on PTG Chip 1.2. An oligo (oρtg2_0010188) that corresponds to CG57094 on the PTG Chip 1.2 was scrutinized for its expression profile. The statistical analysis identify significant over-expression in a subset of lung tumors compared with corresponding normal lung tissue and strong expression in melanomas and breast cancers, which do not have matched normal tissue
Thus, based upon its profile, the expression of this gene could be of use as a marker for subsets of lung, melanomas and breast cancers, in addition to the subset of Kidney cancers as previously disclosed. In addition, therapeutic inhibition of the activity of the product of this gene, through the use of antibodies or small molecule drugs, may be useful in the therapy of kidney, lung, melanomas and breast cancers that express CG57094 and are dependent on them
ptq2 0010188 Oligo Sequence:
>ATCTGGAAACTTGTGGACAGAGAAGAAGAC (SEQ ID NO: 393)
Table F12b: CG57094 expression in CuraChip Oncology samples
CuraChip expression
o 200 400 600 800
-Absolute value
Table F12c
Tissue Tissue ID absolute Foreground background Definition value Mean mean
G1C4D21B11-
01_Lung cancer(35C)
G1C4D21B11-
02_Lung
NAT(36A)
G1C4D21B11-
03_Lung cancer(35E) 3
G1C4D21B11-
04J_ung cancer(365) 4
G1C4D21B11-
05_Lung cancer(368)
G1C4D21B11-
06_Lung cancer(369)
G1C4D21B11-
07_Lung cancer(36E)
G1C4D21B11-
08_Lung
NAT(36F)
G1C4D21B11-
09_Lung cancer(370)
G1C4D21B11-
10JLung cancer(376) 10
G1C4D21B11-
11_Lung cancer(378) 11
G1C4D21B11-
12_Lung cancer(37A) 12
G1C4D21B11-
13_Normal
Lung 4 13
G1C4D21B11-
14_Normal
Lung 5 14
G1C4D21B11-
15_CuraC ip reference 1 15
G1C4D21B11-
16_5. elanoma 16
G1C4D21B11-
17_6.Melanoma 17
G1C4D21B11-
18_Melanoma
(19585) 18
G1C4D21B11-
19_Normal
Lung 1 19 G1C4D21 B11-
20_Lung cancer(372) 20
G1 C4D21 B1 1-
21 Lung
NAT(35D) 21
G1C4D21 B11-
22 Lung
NAT(361) 22
G1C4D21B11-
23 1. Melanoma 23
G1C4D21 B11-
24 Normal
Lung 2 24
G1C4D21B11-
25_Lung cancer(374) 25
G1C4D21B11-
26_Lung cancer(36B) 26
G1 C4D21B11-
27_Lung cancer(362) 27
G1C4D21 B11-
28_Lung cancer(358) 28
G1C4D21 B11-
29 2.Melanoma 29
G1C4D21B11-
30 Normal
Lung 3 30
G1C4D21B11-
31 Lung
NAT(375) 31
G1C4D21B11-
32_Lung cancer(36D) 32
G1C4D21B11-
33 Lung
NAT(363) 33
G1 C4D21B11-
34_Lung cancer(35A) 34
G1C4D21B11-
35 4.Melanoma 35
G1 C4E09B12-
54 Prostate cancer(B8B) 36
G1C4E09B12-
55 Prostate cancer(B88) 37
G1C4E09B12-
56 Prostate
NAT(B93) 38
G1C4E09B12-
57 Prostate cancer(B8C) 39
G1C4E09B12-
58 Prostate 40 cancer(AD5)
G1C4E09B12-
59 Prostate
NAT(AD6) 41
G1C4E09B12-
60 Prostate cancer(AD7) 42
G1C4E09B12-
61 Prostate
NAT(AD8) 43
G1C4E09B12-
62 Prostate cancer(ADA) 44
G1C4E09B12-
63 Prostate
NAT(AD9) 45
G1C4E09B12-
64 Prostate cancer(9E7) 46
G1C4E09B12-
66 Prostate cancer(AOA) 47
G1C4E09B12-
67 Prostate cancer(9E2) 48
G1C4E09B12-
68 Pancreatic cancer(9E4) 49
G1C4E09B12-
69 Pancreatic cancer(9D8) 50
G1C4E09B12-
70 Pancreatic cancer(9D4) 51
G1C4E09B12-
71 Pancreatic cancer(9BE) 52
G1C4E09B12-
73 Pancreatic
NAT(ADB) 53
G1C4E09B12-
74 Pancreatic
NAT(ADC) 54
G1C4E09B12-
76 Pancreatic
NAT(ADD) 55
G1C4E09B12-
77 Pancreatic
NAT(AED) 56
G1C4E19B13-
1 Colon cancer(8A3) 57
G1C4E19B13-
10 Colon
NAT(8B6) 58
G1C4E19B13-
12 Colon
NAT(9F1) 59 G1C4E19B13-
13_Colon cancer(9F2) 60 52.51
G1C4E19B13-
14 Colon
NAT(A1D) 61 49.92
G1C4E19B13-
15_Colon cancer(9DB) 62 42.55
G1C4E19B13-
16 Colon
NAT(A15) 63 59.68
G1C4E19B13-
17_Colon cancer(A14) 64 56.64
G1C4E19B13-
18 Colon
NAT(ACB) 65 58.01
G1C4E19B13-
19_Colon cancer(AC0) 66 53.49
G1C4E19B13-
2_Colon cancer(8A4) 67 53.4
G1C4E19B13-
20 Colon
NAT(ACD) 68 53.97
G1C4E19B13-
21_Colon cancer(AC4) 69 49.29
G1C4E19B13-
22 Colon
NAT(AC2) 70 52.18
G1C4E19B13-
23_Colon cancer(AC1) 71 48.1
G1C4E19B13-
24 Colon
NAT(ACC) 72 42.7
G1C4E19B13-
25_Colon cancer(AC3) 73 68.18
G1C4E19B13-
26_Breast cancer(9B7) 74 55.27
G1C4E19B13-
27 Breast
NAT(9CF) 75 71.21
G1C4E19B13-
28_Breast cancer(9B6) 76 49.21
G1C4E19B13-
29_Breast cancer(9C7) 77 47.76
G1C4E19B13-
3_Colon cancer(8A6) 78 47.69
G1C4E19B13-
30 Breast 79 66.26 NAT(A11)
G1C4E19B13-
31_Breast cancer(AIA) 80
G1C4E19B13-
32_Breast cancer(9F3) 81
G1C4E19B13-
33_Breast cancer(9B8) 82
G1C4E19B13-
34_Breast
NAT(9C4) 83
G1C4E19B13-
35_Breast cancer(9EF) 84
G1C4E19B13-
36_Breast cancer(9F0) 85
G1C4E19B13-
37_Breast cancer(9B4) 86
G1C4E19B13-
38_Breast cancer(9EC) 87
G1C4E19B13-
4_Colon cancer(8A7) 88
G1C4E19B13-
44_Colon cancer(8B7) 89
G1C4E19B13-
5_Colon cancer(8A9) 90
G1C4E19B13-
6_Colon cancer(8AB) 91
G1C4E19B13-
7_Colon cancer(8AC) 92
G1C4E19B13-
8_Colon
NAT(8AD) 93
G1C4E19B13-
9_Colon cancer(8B5) 94
G1C4E21B14-
1_Cervical cancer(BOδ) 95
G1C4E21B14-
10_Brain cancer(9F8) 96
G1C4E21B14-
11_Brain cancer(9C0) 97
G1C4E21B14-
12_Brain cancer(9F7) 98 G1C4E21B14-
13_Brain cancer(A00) 99 4.74
G1C4E21B14-
14 Brain
NAT(A01) 100 0.82
G1C4E21B14-
15_Brain cancer(9DA) 101 1.55
G1C4E21B14-
16_Brain cancer(9FE) 102 4.5
G1C4E21B14-
17_Brain cancer(9C6) 103 6.17
G1C4E21B14-
18_Brain cancer(9F6) 104 5.2
G1C4E21B14-
2 Cervical
NAT(AEB) 105 4.36
G1C4E21B14-
21 Bladder
NAT(23954) 106 1.86
G1C4E21B14-
22_Urinary cancer(AF6) 107 3.06
G1C4E21B14-
23_Urinary cancer(BOC) 108 2.29
G1C4E21B14-
24_Urinary cancer(AE4) 109 2.22
G1C4E21 B14-
25 Urinary
NAT(B20) 110 2.21
G1C4E21 B14-
26_Urinary cancer(AE6) 111 2.03
G1C4E21B14-
27 Urinary
NAT(B04) 112 0.23
G1C4E21B14-
28_Urinary cancer(B07) 113 6.64
G1C4E21B14-
29 Urinary
NAT(AF8) 114 0.93
G1C4E21B14-
3_Cervical cancer(AFF) 115 6.72
G1C4E21 B14-
30_Ovarian cancer(9D7) 116 1.13
G1C4E21 B14-
31_Urinary cancer(AF7) 117 2.51
G1C4E21B14-
32_Ovarian 118 0 cancer(9F5)
G1C4E21B14-
33_Ovarian cancer(A05) 119 4.19
G1C4E21B14-
34_Ovarian cancer(9BC) 120 0.65
G1C4E21B14-
35_Ovarian cancer(9C2) 121
G1C4E21 B14-
36_Ovarian cancer(9D9) 122 2.8
G1C4E21B14-
37_Ovarian
NAT(AC7) 123 1.73
G1C4E21B14-
38_Ovarian
NAT(AC9) 124 2.61
G1C4E21B14-
39_Ovarian
NAT(ACA) 125 8.33
G1C4E21B14-
4_Cervical
NAT(B1E) 126 11.93
G1C4E21B14-
40_Ovarian
NAT(AC5) 127 4.02
G1C4E21B14-
5_Cervical cancer(BOO) 128 14.43
G1C4E21B14-
6_Cervical
NAT(AFA) 129 16.96
G1C4E21B14-
7_Cervical cancer(BIF) 130 23.4
G1C4E21B14-
8_Cervical
NAT(B1C) 131 7.92
G1C4E21B14-
9_Brain cancer(9F9) 132 7.41
G1C4E23B15-
32_Breast cancer(D34) 133 103.28
G1C4E23B15-
33_Breast cancer(D35) 134
G1C4E23B15-
34_Breast cancer(D36) 135 152.74
G1C4E23B15-
35_Breast cancer(D37) 136 52.81
G1C4E23B15-
36_Breast cancer(D38) 137 8.84 G1C4E23B15-
37_Breast cancer(D39) 138 0.03
G1C4E23B15-
38_Breast cancer(D3A) 139 27.92
G1C4E23B15-
39_Breast cancer(D3B) 140 0.86
G1C4E23B15-
40_Breast cancer(D3C) 141 0.41
G1C4E23B15-
41_Breast cancer(D3D) 142 40.41
G1C4E23B15-
42_Breast cancer(D3E) 143 28.26
G1C4E23B15-
43_Breast cancer(D3F) 144 1.41
G1C4E23B15-
44_Breast cancer(D40) 145 0.96
G1C4E23B15-
45_Breast cancer(D42) 146 0.81
G1C4E23B15-
46_Breast cancer(D43) 147 43.82
G1C4E23B15-
47_Breast cancer(D44) 148 56.05
G1C4E23B15-
48_Breast cancer(D45) 149 28.87
G1C4E30B16-
1_2.SK- ES 150 21.18
G1C4E30B16-
10_40.HLaC-79 151 0
G1C4E30B16-
11_43.H226 152 28.33
G1C4E30B16-
12_45. HCT-116 153 300.1
G1C4E30B16-
13_53.IGROV-1 154 38.67
G1C4E30B16-
14_59.MX-1 155 54.09
G1C4E30B16-
15_63.C33A 156 0
G1C4E30B16-
16_65.Daudi 157 0.01
G1C4E30B16-
17_71.MV522 158 0.76
G1C4E30B16-
18_76.RWP-2 159 0
G1C4E30B16-
1977.BON 160 7.91 G1 C4E30B16-
2 β.MiaPaCa 161
G1C4E30B16-
20 82.H82 162
G1 C4E30B16-
21 86.H69 163
G1 C4E30B16-
22 95.Caki-2 164
G1 C4E30B16-
23 100.LNCaP 165
G1 C4E30B16-
24 101.A549 166
G1C4E30B16-
25 1. DU145 167
G1C4E30B16-
26 6. OVCAR-
3 168
G1 C4E30B16-
27 11. HT-29 169
G1C4E30B16-
28 13. DLD-2 170
G1C4E30B16-
29 18. MCF-7 171
G1C4E30B16-
3 9.H460 172
G1C4E30B16-
4 15.SW620 173
G1C4E30B16-
5 20.SK-OV-3 174
G1C4E30B16-
6 23.MDA-231 175
G1 C4E30B16-
7 27.Caki-1 176
G1 C4E30B16-
8 31. PC-3 177
G1C4E30B16-
9 35.LoVo 178
Example F13: Subcloning and Protein expression
CG57094 encodes a protein consisting of a signal peptide followed by a coil-coil-like domain (required for oligomerization) followed by a fibrinogen-like domain (required for binding to the receptor). Only the mature region of this protein was expressed (removing the signal peptide and substituting it with a IgKappa signal peptide) because the full length sequence with its own signal peptide did not express and secrete sufficient amount . Two recombinant sequences were made, CG57094-02 and CG57094-04 as described in methods, for expression in mammalian system Example F14: Expression of CG57094-04 in human embryonic kidney 293 cells. A 1143 bp long Bglϋ-Xhol fragment containing the CG57094-04 sequence was subcloned into BamHI-XhoI digested pCEP4/Sec to generate plasmid 789. The resulting plasmid 789 was transfected into 293 cells using the LipofectaminePlus reagent following the manufacturer's instructions (Invitrogen/Gibco). The cell pellet and supernatant were harvested 72h post transfection and examined for CG57094-04 expression by Western blot (reducing conditions) using an anti-V5 antibody. The gel below shows that CG57094-04 is expressed, and a 35 kDa protem is secreted by 293 cells.
The transient 293 transfection was scaled up yielding 6 L conditioned media, from each scale up, providing material for batches 3 and 4.
CG57094-04 protein secreted by 293 cells.
Example F15: Expression of CG57094-02 in stable CHO-K1 cells. A 1143 bp long BgUI- Xhol fragment containing the CG57094-02 sequence was subcloned into BamHI-XhoI digested pEE14.4Sec to generate plasmid 1614. The resulting plasmid 1614 was transfected into CHO-K1 cells using the LipofectaminePlus reagent following the manufacturer's instructions (Invitrogen/Gibco). The cell pellet and supernatant were harvested 72h post transfection and examined for CG57094-02 expression by Western blot (reducing conditions) using an anti-V5 antibody. The gel below shows that CG57094-02 is expressed, and a 33 kDa protein is secreted by the CHO-K1 cells at transient level. The culture media was DMEM, 10% FBS, lx nonessential amino acids.
Protein expression of CG57094-02 in CHO-K1 cells at transient level.
MSX resistant clones were selected using the GS system (Lonza Biologicals) The culture media in the selection process was: Glutamin-free DMEM (JRH), 10% dialyzed FBS, lx GS supplement (JRH), 25uM MSX (JRH). A high expressor clone, was selected for scale up in 10 LWave bioreactors. Two reactors were inoculated. 30 L conditioned media was collected from each reactors yielding batches 2 and 3.
The culture media was harvested 120h after inoculating the Wave bioreactor and examined for CG57094-04 expression by Western blot (reducing conditions) using an anti- N5 antibody. The gel below represents the Western analysis of the sample.
Protein Expression of CG57094-02 in CHO-K1 cells in Wave bioreactors.
The protein secreted as the predicted, 45 kDa molecule.
The culture media in the Wave bioreactor is: EX-Cell302 media, 10% dialyzed FBS, lx GS supplement, lx HT supplement, 25 uM MSX.
The difference between the observed molecular weight of the secreted molecule in the transient and in the stable cell line scale up conditions is most likely a consequence of the different culture media used in the two production schemes.
Example F16: Protein expression and purification
CG57094 variant 02 was expressed and purified in the CHO stable cell system. This method yields both full length protein (around 54Kd) and a proteohtyc fragment of 35Kd, with a ration of about 1 :2 full length/fragment. In non reducing conditions (As seen in the western blot), the full length undergoes oligomerization
CG57094 variant 04, that has the same protem sequence as 02, was expressed and purified in the 293 transient cell system. More than 90% of the protem is purified as a proteolitic fragment and thefore does not undergo oligomerization. Procedure
1. Transfected into attached CHO stable cells with Lipofectamine 2000 in Opti- MEM 1. Overlay with DMEM media with 5% FBS after 4 hours.
2. Harvested after 3, 5 and 7 days incubation at 37°C.
Cell Lysis/Protein Recovery
Procedure
1. Centrifuged at 3000 rpm for 10 min and filter with 0.2 um pore size.
Procedure
1. Metal Affinity Chromatography - Pharmacia 50ml and 5 ml Metal Chelate - Running buffer 20 mM phosphate, pH 7.4, 0.5 M NaCl. Wash with 20mM, 50mM, and lOOmM Imidazole. Elute with 500mM Imidazole.
2. HS Cation Exchange Chromatography — Poros HS 1.6 ml column — 30 mM Tris-Cl, pH 8.0, 0.05% CHAPS. Elute with 0-2 M NaCl gradient.
3. Dialysis - @ 4°C using 3,500 MWCO against 20mM Tris-HCl, pH7.4 + 150mM NaCl.
PROTEIN QUALITYCONTROL
Western Blot Procedure
Antibody name, catalog # and supplier: Anti-V5-HRP Antibody.46-0708, Invitrogen (Carlsbad, CA). S-protein HRP conjugate. 69047. Novagen (Madison. WI) Antibody dilution buffer: PBS/5% milk/0.1% Tween-20 Wash buffer: PBS/0.1% Tween-20 Detection reagents: ECL (Amersham Biosciences Corp., Piscataway, NJ)
1. The blot was covered with antibody dilution buffer and incubated on a rocker for one hour at room temperature.
2. The blocking solution was replaced with antibody dilution buffer containing the appropriate amount of conjugate, and the blot was incubated on a rocking platform for one hour at room temperature.
3. The antibody solution was decanted, and the blot was washed quickly with two quick rinses of wash buffer. The blot was then covered with wash buffer and incubated on the rocking platform for five minutes, and the wash buffer was decanted. This process was repeated twice for a total of three five-minute washes. 4. The blot was developed using ECL reagents (Amersham Biosciences Corp.,
Piscataway, NJ) as per manufacturer instructons and luminescence was then digitized on a Kodak Image Sciences Imaging Station.
Example F17: CG57094-02 Batch2, Plasmid #1614 CHO stable cell line PROTEIN QUALITY CONTROL DATA Protein Concentration
Protein Characterization
Protein Purity
CG57094-02 Batch2 Comassie staining and western blot Example F18: CG57094-02 B3, Plasmid #1614 CHO stable cell line
PROTEIN QUALITY CONTROL DATA Protein Concentration
Protein Characterization
Protein Purity
CG57094-02 Batch3 Comassie staining and western blot Example F19: CG57094-04 Batch3, 293 cell transient transfection
METHOD OF PURIFICATION
1. Metal Affinity Chromatography - PHARMACIA 50ml Metal Chelate - 20 mM sodium phosphate, pH 7.4, 0.5 M NaCl. Wash with 20mM, 50mM, and lOO M Imidazole. Elute with 500mM Imidazole.
2. Metal Affinity Chromatography - PHARMACIA 5ml Metal Chelate - 20 mM sodium phosphate, pH 7.4, 0.5 M NaCl. Elute against a gradient from 0-500mM Imidazole.
3. Ion-exchange Chromatography - Poros 50 HS column - Elute against a gradient from 0-1M NaCl in 30 mM Tris-Cl, pH 8.0, 0.05% CHAPS.
4. Dialysis - @ 4°C using 3,500 MW Cutoff against 20 mM Tris-HCl, pH 7.4 + 150 mM NaCl
QC DATA MW Red Non-Red
CG57094-04 Batch3 Comassie staining and western blot
Example F20: CG57094-04 Batch4293 cell transient transfection
QC DATA MW Stain Blot
R NR lOOng R NR
CG57094-04 Batch4 Comassie staining and western blot
As indicated in the Certificate of Analysis for the CG57094-04 protein preparation, during expression and purification, the expressed protein undergoes a non obvious proteohtyc cleavage that generate a fragment peptide The protein sequence of this peptide was determined by N-terminal sequencing of the protein preparation generating a N-terminal sequence of LPEMA QPVDP AHXVS. The sequence was determined by transferring the protein to polyvinylidenedifluoride (PVDF) membranes as described in P. Matsudaira, J. Biol. Chem., 261, 10035-10038 (1987). and then performing automated gas-phase sequencing as described in R.M. Hewic , M.W. Hunkapiller, L.E. Hood, and W.J. Dreyer, J. Biol. Chem., 256, 7990-7997 (1981). The COOH terminus is defined by the tag included in the expression construct (V5 and His peptide) both because the tag is used for purification and because the purified protein is still reactive to the N5 antibodies as shown in the western blot. Therefore the normal COOH terminus of the CG57094 protein is present in the purified protein.
The molecular features ot this proteolitic fragments are specifically different from those of the parental sequence, of CG57094-02 and of ΝL2, specifically this protein does not undergo oligomerization due to the loss of the Coil-Coil domain while retaimng the receptor binding region, the fiubrinogen domain. This results in a peptide that it is easier to express and purify while retaining activity as shown in the Cell Survival Assay with 786-O Cells example. It represent a non-obvious result of the expression construct and cell line used for expression.
>CG57094-04_proteolityc_fragment LPEMAQPVDPAHNVSRHRLPRDCQELFQVGERQSGLFEIQPQGSPPF VNCK TSDGG TVIQRIϊHDGS VDFNRPWEAYK&GFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAE LQFSVH GGEDTAYSLQL TAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL KKGIFWKTWRGRYYPLQATTMLIQP AAEAASLE (SEQ ID NO: 394)
>N 2 MET ORF
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHG LQLGQGLREHAERTRSQLSALE RRLSACGSACQGTEGSTDLP APESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQH RIQHL QSQFG DHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSP PFLWCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLG EK-VHSITGDRNSR AVQLRDW DGNAE LQFSVHLGGEDTAYS QLTAPVAGQLGATTVPPSGLSVPFST DQDHD RRDKNCAKS SGGWW FGTCSHSNLNGQYFRSIPQQRQK KKGIFWKTWRGRYYPLQATT LIQP AAEAAS (SEQ ID NO: 395)
>CG57094-02
GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSA ERRLSACGSACQGTEGSTDLPLAPESRVDPE VLHS QTQLKAQNSRIQQLFHKVAQQQRH EKQHLRIQHLQSQFG LDHKHLDHEVAKPARRKRLPEMAQPVDPA HNVSRLHRLPRDCQELFQVGERQSG FEIQPQGSPPFLVNCKMTSDGG TVIQRRHDGSVDFNRP EAYKAGFGD PHGEFWLG EKVHSITGDRNSR AVQ RD DGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVP FST DQDHD RRDKNCAKSLSGG FGTCSHSNLNGQYFRSIPQQRQKLK GIF KT RGRYYP QATTi IQPM AAEAAS (SEQ ID NO: 396) >CG57094-04
RSGPVQS SPRFAS DEMNVLAHGLLQLGQG REHAERTRSQLSADERRLSACGSACQGTEGSTDLPLAPESRVD PEVLHSLQTQ KAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVD PAHNVSRLHRLPRDCQE FQVGERQSGLFEIQPQGSPPFLVNCK TSDGG TVIQRRHDGSVDFNRP EAYKAGF GDPHGEFWLGLEKVΪΪSITGDRNSRLAVQ RDWDGNAELLQFSVH GGEDTAYSLQLTAPVAGQLGATTVPPSGLS VPFST DQDHD RRDKNCAKSLSGGW FGTCSHSNLNGQYFRSIPQQRQ LKKGIF KTWRGRYYPLQATT LIQ PMAAEAASLE (SEQ ID NO: 397)
Example F21: PE 52a: cellular proliferation CG57094 belongs to the angiopoietin-like family of pro-anti angiogenic factors that either induce or inhibit endothelial cell proliferation. We wanted therefore to test whether our preparation CG57094-02 is able to induce or inhibit endothelial cell proliferation. CG57094 did not inhibit endothelial cell proliferation but at a concentration of lOμg/ml increased the proliferation of HUVEC and HMVEC but the extent of proliferation was not significant.
Example F22: Inhibition of HUVEC proliferation:
BrdU Incorporation in HUVEC cells. Proliferative activity is measured by treatment of serum-starved cultured cells with CG57094-02 at 1 mcg/ml and 0.1 mcg/ml and measurement of BrDU incorporation during DNA synthesis. HUVEC cells were cultured in DMEM supplemented with 10% fetal bovine serum or 10% calf serum respectively. Cells were grown to confluence at 37°C in 10% CO2/air. Cells were then starved in DMEM for 24- 72 h. pCEP4sec or pCEP4sec/CG57094-02 enriched conditioned medium was added (10 μL/100 μL of culture) for 18 h. BrdU (10 μM final concentration) was then added and incubated with the cells for 5 h. BrdU incorporation was assayed according to the manufacturer's specifications (Boehringer Mannheim, Indianapolis, IN).
1%FBS plus growth factor stimulated the proliferation of HUVEC cells. In the presence of TNF alpha, which was used as positive control, the proliferation of HUVEC cells was markedly inhibited and was comparable to the level of serum free control. CG57094-02 did not significantly affect the proliferation of these endothelial cells at concentrations of 1 μg and 0.1 μg/ml.
SFM 1Η-FBS.VEGF TNF CG5709 -021ug/ml CG57094-02 O.lugfoll
Treatments
Inhibition of HUVEC BrdU by CG57094-02.
Example F23: Inhibition of HMVEC proliferation BrdU Incorporation in HMVEC cells. Proliferative activity is measured by treatment of serum-starved cultured cells with CG57094-02 at 1 mcg/ml and 0.1 mcg/ml and measurement of BrDU incorporation during DNA synthesis. HMVEC cells were cultured in DMEM supplemented with 10% fetal bovine serum or 10% calf serum respectively. Cells were grown to confluence at 37°C in 10% CO2/air. Cells were then starved in DMEM for 24- 72 h. pCEP4sec or pCEP4sec/CG57094-02 enriched conditioned medium was added (10 μL/100 μL of culture) for 18 h. BrdU (10 μM final concentration) was then added and incubated with the cells for 5 h. BrdU incorporation was assayed according to the manufacturer's specifications (Boehringer Mannheim, Indianapolis, IN).
1%FBS plus growth factor stimulated the proliferation of HMVEC cells. In the presence of TNF alpha, which was used as positive control, the proliferation of HMVEC cells was markedly inhibited and was comparable to the level of serum free control. CG57094-02 did not significantly affect the proliferation of these endothelial cells at concentrations of 1 μg and 0.1 μg/ml.
S FM 1WBSΛ-ΕGF TNF CG5709-M.2 .igΛϊil CG5709 -020.1ug'h.l
Treatmerts
Inhibition of HMVEC BrdU by CG57094-02.
Example F24: Inhibition of CPAE proliferation
BrdU Incorporation in Calf pulmonary arterial endothelial cells (CPAE). Proliferative activity is measured by treatment of serum-starved cultured cells with CG57094-02 at 1 mcg ml and 0.1 mcg/ml and measurement of BrDU incorporation during DNA synthesis. CPAE cells were cultured in DMEM supplemented with 10% fetal bovine serum or 10% calf serum respectively. Cells were grown to confluence at 37°C in 10% CO2/air. Cells were then starved in DMEM for 24- 72 h. pCEP4sec or pCEP4sec/CG57094-02 enriched conditioned medium was added (10 μL/100 μL of culture) for 18 h. BrdU (10 μM final concentration) was then added and incubated with the cells for 5 h. BrdU incorporation was assayed according to the manufacturer's specifications (Boehringer Mannheim, Indianapolis, IN).
1%FBS plus growth factor stimulated the proliferation of CPAE cells. In the presence : of TNF alpha, which was used as positive control, the proliferation of CPAE cells was markedly inhibited and was comparable to the level of serum free control. CG57094-02 did not significantly affect the proliferation of these endothelial cells at concentrations of 1 μg and 0. l μg/ml.
SFM 1%FBS/VEGF TNF CG57094-02 CG57094-02 1ugΛτιl O.lugΛnl Treatments
Inhibition of CPAE BrdU by CG57094-02
Example F25: BrdU Incorporation in HUVEC cells. Proliferative activity is measured by treatment of serum-starved cultured cells with
CG57094-02 at 10 mcg/ml, lmcg/ml, 0.5 mcg/ml, and 0.1 mcg/ml and measurement of BrDU incorporation during DNA synthesis. HUVEC cells were cultured in DMEM supplemented with 10% fetal bovine serum or 10% calf serum respectively. Cells were grown to confluence at 37°C in 10% CO2/air. Cells were then starved in DMEM for 24- 72 h. pCEP4sec or pCEP4sec/CG57094-02 enriched conditioned medium was added (10 μL/100 μL of culture) for 18 h. BrdU (10 μM final concentration) was then added and incubated with the cells for 5 h. BrdU incorporation was assayed according to the manufacturer's specifications (Boehringer Mannheim, Indianapolis, IN). VEGF/bFGF combination at lOng/ml was used as positive control. CG57094 at a concentration of 1 Oμg/ml increased the proliferation of HUVEC but the extent of proliferation was not significant.
Stave CG57094-Q2 CG5703 -02 HjgdTll CG57094-Q2 CGS7094-G2
10ug-tol 0.5ϋg!to. O.lugilnl
Treatments
Stimulation of proliferation of HUVEC by CG57094-02.
Example F26: BrdU Incorporation in HMVEC cells. Proliferative activity is measured by treatment of serum-starved cultured cells with
CG57094-02 at 10 mcg/ml, 5mcg/ml, 1 mcg/ml and 0.1 mcg/ml and measurement of BrDU incorporation during DNA synthesis. HMVEC cells were cultured in DMEM supplemented with 10% fetal bovine serum or 10% calf serum respectively. Cells were grown to confluence at 37°C in 10% C02/air. Cells were then starved in DMEM for 24- 72 h. pCEP4sec or pCEP4sec/CG57094-02 enriched conditioned medium was added (10 μL/100 μL of culture) for 18 h. BrdU (10 μM final concentration) was then added and incubated with the cells for 5 h. BrdU incorporation was assayed according to the manufacturer's specifications (Boehringer Mannheim, Indianapolis, IN).
CG57094 at a concentration of lOμg/ml increased the proliferation of HMVEC but the extent of proliferation was not significant.
Starve VESF/bFGF O36709M2 lOug'ml CI3670S1-Q2 Sugftnl CG670Θ402 -\ugftti CG57D94Q2 1Chg/ml O.lug'ml
Trβat errb
Stimulation of proliferation of HMVEC by CG57094-02.
Example F27: PE52: Cellular survival CG57094 belongs to the angiopoietin-like family of pro-anti angiogenic factors that either induce or inhibit endothelial cell survial upon cellular stress like starvation. We wanted therefore to test whether our preparation CG57094-02 is able to induce or inhibit endothelial cell survial. CG57094 at a concentration up to O.Olμg/ml increased the survival of HUVEC and HMVEC but not CPAE in a significant fashion. CeU Viability assay (WST1 survival Assay). Since CG57094-02 did not induce the potent proliferation of endothelial cells, we tested whether the target gene (CG57094-02) would increase the survival of endothelial cell during starvation. Viability of the cells were measured using Wst-1 assay. The cell lines were chosen on the basis of potential cell types implicated in angiogenesis or cancer neovascularization: HUVEC (human umbilical vein endothelial cells), HMNEC-D (endothelial, dermal capillary) and Calf pulmonary arterial endothelial cells (CPAE). 96 well plates (flat bottom) were coated with 100 μl of attachment factor and incubated at 37°C for one hour. Attachment factor was aspirated and endothelial cells were plated in a DMEM medium containing 0.1 % FBS (no growth factors). After 24h cells were washed and pCEP4sec or pCEP4sec/CG57094-02 enriched conditioned medium was added (10 μL/100 μL of culture) for 48 h. Purified CG57094-02 protein or conditional media was added again, without changing the medium and further incubated for another 24 h. Wst-1 reagent (lOμl/well) was added and incubated for 45min-l hour at 37°C. Plates were read at 450nm absorbance.
Example F28:
In the presence of VEGF/bFGF HUVECs survival of HUVEC cells increased markedly as observed by increase in A450 reading compared to starved cells. Interestingly, CG57094-02 at a concentration of 2.5μg/ml also increased the viability of HUVEC compared to starved cells. This trend remained the same even at concentrations as low as O.Olμg/ml of CG57094-02. All of these data suggest that CG57094-02 may be a potent survival factor for endothelial cells. Therefore, inhibition of CG57094-02 activity with a neutralizing monoclonal antibody may inhibit neovascularization of tumors as well as diabetic retinopathies.
starve 0 Λ FB S VEGFΛ FG F CG57094-02 CG57094-02 CG57Q94-02 CG57094-02 CG57094-02
IDπgΛrl 2.5ugΛrl lugήnl 0.5ug/tπl O .lug.'W ø U .ugΛπl
Treatments Induction of survival of HUVEC by CG57094-02.
Example F29:
CG57094-02 at lμg/ml showed a marked increase in HUVEC cell survival as compared to starved cells, which is consistent with the results shown in fig 6. Interestingly, at higher protein concentrations, cells exhibited a decreased viability with the greatest effect seen at the 5μg/mL concentration.
0.1% FBS VEGFΛFGF CG57094-02 CG67094-02 CG57094-O2 CG57094-02
1Qngήτιl 10ugιtol S gήnl 2.5ugj ιl 1 ug*nl
Treatments Induction of survival of HUVEC by CG57094-02.
Example F30:
Consistent with the result seen on HUVEC cells, the survival of HMVEC-d cells were also enhanced by CG57094-02 at lower concentrations. Interestingly, at higher protein concentrations, cells exhibited a decreased viability with the greatest effect seen at the 0.5μg/mL concentration.
starve VB3FΛFGF CG5709402 CG67094-02 CG57D94-02 O357D9402 CGδ7094O2 On^ml 25ugΛrl 1ugW OSugfml O.lugΛri 0.01ugftnl Treatments
Induction of survival of HMVEC-d by CG57094-02. Example F31:
VEGF/bFGF increased the survival of CPAE cells as observed by an increase in A450 readings compared to starved cells. Although, CG57094-02 also enhanced the survival of HUNEC and HMVEC-d cells, it had no effect on CPAE cells as measured by Wst-1 reagent.
Treatments
Effect of CG57094-02 on survival of CPAE cells.
Example F32: Cell Survival Assay 786-0 Cells
786-0 is a human cell line derived from renal carcinoma and lacks one allele and express a truncated protein (AA 1-104) from the second allele of the von Hippel-Lindau tumor suppressor gene (NHL). The inactivation of the VHL gene predisposes affected individuals to the human VHL cancer syndrome and is associated with sporadic renal cell carcinomas (RCC) and brain hemangioblastomas. We and other people skilled in the art (Pause A, Lee S, Lonergan KM, Klausner RD. The von Hippel-Lindau tumor suppressor gene is required for cell cycle exit upon serum withdrawal. Proc Νatl Acad Sci U S A 1998 Feb 3;95(3):993-8) believe that this cell lines represent a suitable in-vitro model to study tumorogenic mechanisms in renal carcinoma. Specifically in this example, we wanted to test how treating 786-0 cells with CG57094 purified protein influence their survival in serum withdrawal conditions that would otherwise lead to cell death.
Method: Standard testing method (STM) CV-SUV-001 Table F32a: DEFINITIONS
Table F32b: REAGENTS, MATERIALS AND EQUIPMENT
REAGENT PREPARATION
Complete DMEM:
DMEM +10%FBS+ 1% P/S
Starvation medium: DMEM + 0.5 % FBS + 1% P/S Serum Free Media DMEM + 0.1%BSA + 1% P/S PROCEDURES
Procedure Summary: Cells are plated in the inner sixty wells of a 96- well plate in Complete DMEM. The following day, the cells are washed in SFM and treated with CuraProteins in 0.5% FBS/DMEM. Untreated cells serve as baseline controls. Cells cultured in 10 % FBS serve as positive controls. On the third day following treatment, MTS is added to the medium and the cells are incubated for 0.5-4 hrs. The absorbance of the wells is then determined using a microplate absorbance reader.
Day l:
A. Prepare Cells.
1. Wash a flask of 70-80 % confluent cells lx with PBS.
2. Treat cells for ~1 min with 5 ml Trypsin/EDTA per T175 flask until cells can be knocked free from the bottom of the culture flask.
3. After cells have been knocked free, add 5 ml of Complete DMEM to flask.
4. Transfer cell suspension to a 15 ml conical bottom centrifuge tube. 5. Centrifuge cell suspension at 1200 RPM for 5 min at 4° C.
6. Resuspend cells with 10 mis of Complete DMEM.
C. Count viable cells using trypan blue in a hemacytometer.
D. Dilute cells with Complete DMEM to yield 5,000 cells/well, 10 mL per plate needed.
E. For blank wells add 100 μl of Complete DMEM no cells.
F. Incubate at 37° C in 10% C02 humidified incubator over-night.
Day2:
A. View plate for appropriate confluency, viability, and consistency of plating from well to well.
1. Wash plate 2 times with SFM.
B. Add CuraProteins and controls to appropriate wells.
1- For positive controls, add 100 μl Complete DMEM in wells.
2. For negative controls, add 100 μl 0.5 % FBS/DMEM in wells.
3. For Buffer controls, add similar amount of buffer solution used in highest concentration protein treatments.
4. For blank wells, add 100 μl Complete DMEM in wells.
C. Incubate at 37° C in 10% C02 humidified incubator for next three days.
Day 5:
A. Visually inspect wells for effects and then add 20 μl MTS to each well.
B. Incubate at 37°C in 10% C02 humidified incubator for 0.5-4 hrs.
C. Read plates on PowerWave spectrophotometer at 490 nm, single wavelength (KC4 program / Protocol / MTS490 / save file in MS EXCEL format).
Results of CV-SUV-001: The results were assessed by measuring the MTS activity of the cells after 5 days of treatment as described above comparing cell treated with various amount of CG57094, (1) relative to cells without serum stimulation stimulation or stimulated with 0.5% serum (negative controls) and (2) in the last experiment, relative to complete media (positive control). The results are considered positive, if the increase of MTS activity is greater than in the negative controls in a statistically significant fashion. The results below are indicative of the utility of the CG57064, and possibly related polypeptides, in pro- angiogenic therapy and specifically in cardiovascular diseases. The IC50 for the 04 preparations of CG57094 is around 5 μg/ml, for the 02 preparation is below 500 ng/ml and above 100 ng/ml. Considering its overexpression in tumor cells and tumor tissues obtained from kidney, lung, melanomas and breast cancers and the cellular data that revealed how tumor cell survival, especially kidney cancer cell survival, is stimulated by CG57094, inhibiting its activity will have utility in cancer therapy and specifically in inhibiting kidney, lung, melanomas and breast cancers.
The results of this set of experiment are non-obvious in light of the previous art both as disclosed by US Patent 6,455,496 and US Patent US6074873.
In these applications the inventors disclosed activity only on endothelial cell that is opposite to what we discovered. In example 10 of US6074873 they disclosed that their NL2 preparation induced endothelial cell apoptosis, the opposite of cell survival. Kim et al. (Kim, I; Kim, HG; Kim, H; Kim, HH; Park, SK; Uhm, CS; Lee, ZH; Koh, GY. Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis. Biochem J 2000 346 Pt 3: 603-610.) disclosed a anti-apoptotic activity only on endothelial cells and with a limited effect (30 and 45% reduction). The activity that we discovered on 786-0 has a range of specific activity less that 1 microgram/ml and the effect is substantial (500-1000%) that permit to set up a screening assay for neutralizing antibodies (antibodies that bind to CG57094 and related polypeptides and block their activity). Fig 22 shows both preparations of CG57094 protein were able to stimulate the survival of 786-0 cells, compared with controls. The 02 preparation appears to have an higher specific activity.
CG57094 (ARP) on 786-0 cells (Treat day after Plating) 10/1402 M. Baron
TTEST against av. st. dev 0.5% serum
(-) 0.020033333 0.00608824
0.5 % FBS 0.0217 0.00497996
CG57094-02 B2 1 ug/ml 0.383033333 0.602524965 0.406308204 3 ug/ml 1.030033333 0.431413182 0.056312197 6 ug/ml 1.3587 0.033645208 0.000250838
10 ug/ml 1.3397 0.123405835 0.00303949
1.289033333 0.015275252
30 ug/ml 5.11734E-05 buffer 0.0657 . 0.089515362 0.472407116
CG57094-04 B4 1 ug/ml 0.024033333 0.013012814 0.723436712 3 ug/ml 0.035366667 0.009712535 0.12823907 6 ug/ml 0.709033333 0.261977734 0.044591873
10 ug/ml 1.2697 0.160726476 0.002005621
30 ug/ml 1.489033333 0.024006943 8.64534E-05 buffer 0.017033333 0.013503086 0.650072894
The survival activity was repeated by both preparations of CG57094 protein. The 02 preparation appears to have a higher specific activity than before.
CG57094 (ARP) on 786-0 cells (Treat day after Plating) 10/21/02 M. Baron
TTEST against av. st. dev 0.5% serum
(-) 0.043466667 0.004633213
0.5 % FBS 0.1413 0.013397761
CG57094-02 B2 1 ug/ml 1.039466667 0.035275109 0.00036726
3 ug/ml 1.1418 0.04095119 0.000446
6 ug/ml 1.1628 0.005567764 1.5068E-05
10 ug/ml 1.083466667 0.142205251 0.0060124
30 ug/ml 1.1618 0.02007486 8.6897E-05 buffer 0.161133333 0.05770904 0.07027706
CG57094-04 B3 1 ug/ml 0.204133333 0.047056703 0.20173704
3 ug/ml 0.369133333 0.099651058 0.02678674
6 ug/ml 0.648466667 0.120238652 0.01299048 10 ug/ml 1.0808 0.023895606 0.00011835
30 ug/ml 1.086466667 0.046576103 0.00074619 buffer 0.1138 0.036373067 0.05843518
The survival activity was repeated using 2 batches of the same preparations of CG57094 protein. Batch 03 of preparation 02 had higher specific activity
CG57094 (ARP) 786-0 cells (Treat day after Plating) 10/25/02 M. Baron
av. st. dev
(-) 0.012433333 0.002081666
0.5 % FBS 0.028433333 0.005773503 complete 1.0451 0.180357977
CG57094-02 B2 1 ng/ml 0.036766667 0.009291573
10 ng/ml 0.033766667 0.004618802
100 ng/ml 0.035766667 0.016165808
500 ng/ml 0.043433333 0.003511885
1 ug/ml 0.0661 0.00781025
10 ug/ml 1.064433333 0.0306159 buffer high 0.017433333 0.005686241 buffer mid 0.027433333 0.013576941
CG57094-02 B3 1 ng/ml 0.027766667 0.010503968
10 ng/ml 0.034766667 0.005859465
100 ng/ml 0.047433333 0.002081666
500 ng/ml 0.9061 0.064969223
1 ug/ml 1.103766667 0.029143324 10 ug/ml 1.1281 0.053113087 buffer high 0.029433333 0.01106044 buffer mid 0.0221 0
Example F33: Pe 52al— Cell Survival Assay Of Activated T-Lymphocytes And Macrophages
ARP protein is tested for the ability to prevent apoptosis in activated T-lymphocytes and macrophages since it was shown that these cell types are present in knee synovial samples from patients with knee osteoarthritis [Saito I, Koshino T, Nakashima K, Uesugi M, Saito T. Increased cellular infiltrate in inflammatory synovia of osteoarthritic knees. Osteoarthritis Cartilage. 2002 Feb;10(2):156-62.]. The following methods are used for validation of APR effects on T cells and macrophages: measurement of cell proliferation, relevant cytokine production (IL-2, IL-4, IL-6, TNF-a etc.). In addition early apoptosis markers (Anexin V binding) are tested. The increased cell proliferation and cytokine production indicates positive effects of ARP on cell survival. Decreased Anexin V binding also indicates prevention of apoptosis. For screening of the therapeutic neutralizing antibody similar tests are used. Criteria for antibody selection are as follows:
1. Binding to ARP (ELISA) Inhibition of survival T lymphocytes and macrophages induced by ARP in vitro.
Example F34: Preparation of Antibodies that Bind CG57094
As described above, inhibiting CG57094 activity has utility in cancer therapy and specifically in inhibiting kidney, lung, melanomas and breast cancers. It is know in the art that antibodies that bind secreted factors like CG57094 can inhibit their activity in a process called neutralization. Specifically, neutralizing monoclonal antibodies that bind VEGF have been shown to inhibit tumor growth acting against tumor-induced angiogenesis 0 Therefore production of polyclonal and monoclonal antibodies directed against CG57094 has utility in cancer therapy and specifically in inhibiting kidney, lung, melanomas and breast cancers. As opposed to VEGF, that is needed only for tumor induced endothelial cell growth and survival, CG57094 is required for cell growth and survival both by endothelial and tumor cells, therefore inhibition of CG57094 activity could have a more pronounced therapeutic effect. Because of the non-obvious result from the protein expression that indicates how CG57094-04 generate a proteolitic fragment that encode only the fibrinogen domain, we decided to use that fragment as an antigen for immunization. As discussed the fibrinogen domain is the region that binds the receptor, so antibodies that bind to this region are preferable because they have high possibility to be neutralizing.
Method: Techniques for producing the antibodies are known in the art and are described, for example, in "Antibodies, a Laboratory Manual" Eds Harlow and Lane, Cold Spring Harbor publisher. Both rabbits and mice are suitable for the production of polyclonal antibodies, while mice are also suitable for the production of monoclonal antibodies. Mice where the human immunoglubolin genes have replaced the mouse immunoglubolin genes can be used to produce fully human monoclonal antibodies. These antibodies have better pharmaceutical characteristic, no or minimal antibody directed immune reactions that results in loss of therapeutic efficacy and have been shown to eradicate tumor in animal model (Yang XD, Jia XC, Corvalan JR, Wang P, Davis CG, Jakobovits A Eradication of established tumors by a fully human monoclonal antibody to the epidermal growth factor receptor without concomitant chemotherapy. Cancer Res 1999 Mar 15;59(6):1236-43). Of particular use in this application are bispecific antibody comprised of an antibody unit specific for VEGF and an antibody unit specific for CG57094. We have disclosed that in tumors, specifically in renal cell carcinomas, there is a high correlation between the expression of VEGF and CG57094. Both protein support tumorogenesis by increasing tumor-induced angiogenesis, so an antibody that block the activity of both proteins at once would have a preferable therapeutic activity. An example is VL(a)-Linker-VH(a)-Linker- VL(b)-Linker-VH(b), where a is an antibody variable region segment directed to VEGF and b is an antibody variable region segment directed to CG57094, or vice versa. Other examples of bispecific antibodies are reviewed by Carter Improving the efficacy of antibody-based cancer therapies. Nat Rev Cancer 2001 Nov;l(2): 118-29
Example F35: Generation of rabbit polyclonal antibodies
Rabbit are immunized with the immunogen emulsified in complete Freund's adjuvant and injected subcutaneously or intraperitoneally or intramuscolar in an amount from 50-1000 micrograms. The immunized rabbits are then boosted 10 to 12 days later with additional immunogen emulsified in the selected adjuvant. Thereafter, for several weeks, the rabbits might also be boosted with additional immunization injections. Serum samples may be periodically obtained from the rabbit by bleeding of the ear for testing ELISA assays to detect the antibodies.
Example F36: ELISA Protocol todetermine binding of the antibodies
Solution Preparation
Coating Buffer (0.1M Carbonate, pH9.5)
8.4 g. NaHC03, 3.56g. Na2C03, pH to 9.5, and dilute to 1 L. with ddH20
ASSAY DILUENT
Pharmingen #2641 IE
PROTOCOL
• Coat a 96-well high protein binding ELISA plate (Corning Costar #3590) with 50 ul. of protein at a concentration of 5ug/mL. in coating buffer overnight at 4 degrees.
• Following day wash the cells 5X 200-300 ul. of 0.5% Tween-20 in PBS. • Block plates with 200ul. of assay diluent for at least 1 hour at room temperature.
• Dilute antibodies in assay diluent.
• Wash plate as in step 2.
• Add 50ul. of each antibody dilution to the proper wells for at least 2 hours at room temp. • Wash plate as in step 2.
• Add 50ul. of secondary antibody and incubate for 1 hour at room temp.
• Wash plate as in step 2.
• Develop assay with lOOul. of TMB substrate solution/well. (1:1 ratio of solution A+B) (Pharmingen #2642KK) • Stop reaction with 50ul. sulfuric acid
Read plate at 450nm with a correction of 550nm.
Results: The CG57094-02 purified protein preparation was able to induce a strong immune reaction, as shown by the elisa data in Figures 25-26-27. Only the immune serum and not the preimmune serum shows strong reactivity against CG57094-02 coated plates (figure 25-26) while no reactivity was seen against non-coated plates (figures 27)
This data indicates that the CG57094-02 purified protein preparation is a good immunogen and can be used to generate antibodies.
Titer estimation ELISA 9-11-02 CG57094-02 coat/CR064 and pre-immune serum detection
Plate 1
Antibody dilutions
Table F36a:
Preimmune OD- serum blank
Cr064 serum dilutions OD-blank dilutions
100 0.999 100 0.021
1000 0.876 1000 0.004
2000 0.931 2000 0.003
4000 0.963 4000 0.002
8000 0.732 8000 0.002
10000 0.669 10000 0.002
20000 0.511 1 20000 0.001
100000 0.147 100000 0.001
200000 0.084 200000 0.001
1000000 0.018 1000000 0.001 Titer estimation ELISA 9-11-02 CG57094-02 coat CR064 and pre-immune serum detection
Plate 2
S$> <#
Antibody dilutions
Table F36b:
Preimmune OD- serum dilutions OD-blank J serum dilutions blank
100 1.066 100 0.024
1000 1.127 1000 0.003
2000 1.054 2000 0.002
4000 0.993 4000 0.001
8000 0.720 8000 0.001
10000 0.714 10000 0.001
20000 0.536 20000 0.000
100000 0.153 100000 0.000
200000 0.088 200000 0.000
1000000 0.017 1000000 0.001
Titer estimation ELISA 9-11 -02 no coat/ CR064 and pre-immmune serum detection
Plate 1
CR064 serum
Antibody dilutions
Table F36e:
Preimmune serum
Cr064 serum dilutions OD-blank dilutions OD-blank
100 0.290 100 0.030
1000 0.066 1000 0.005
2000 0.036 2,000 0.002
4000 0.021 4,000 0.002
8000 0.010 8,000 0.001
10000 0.008 10,000 0.002
20000 0.004 20000 0.002
100000 0.001 100,000 0.001
200000 0.002 200,000 0.001
1000000 0.001 1 ,000,000 0.001
10 Example F37: Identification of CG57094 neutralizing antibodies
As shown in the Cell Survival Assay for 786-0 Cells, purified CG57094 has a survival activity for 786-0 with an IC50 for the 04 preparation around 5 μg/ml and for the 02 preparation below 500 ng/ml and above 100 ng/ml.
As previously discussed, the identification of antibodies, preferably fully human monoclonal antibodies that bind to CG57094 and neutralize its activity, limiting or abolishing its ability to rescue cell from serum withdrawal conditions, would be very beneficial because these antibodies will have therapeutic effect agamst tumors, specifically against kidney, lung, melanomas and breast cancers. To determine whether an antibody can neutralize CG57094 activity, various amounts of such antibody are added to the Cell Survival Assay for 786-O Cells as described in the method below. The results are assessed by measuring the MTS activity of the cells after 5 days of treatment as described below comparing cell treated with various amount of the antibody, (1) relative treated with non-binding antibody (negative controls) and (2) relative to serum-starved cells (positive control). The results are considered positive, if the decrease in MTS activity is greater than in the negative controls in a statistically significant fashion.
Antibody that can neutralize the CG57094 activity at least with a molar ratio of 10: 1 antibody:CG57094 can be useful as therapeutic, lower molar ratio are preferable.
Method: Standard testing method (STM) CV-ANTSUN-001
Table F37a: DEFINITIONS
Table F37b: REAGENTS, MATERIALS AND EQUIPMENT
PROCEDURES
Procedure Summary: Cells are plated in the inner sixty wells of a 96- well plate in Complete DMEM. The following day, the cells are washed in SFM and treated with CuraProteins in 0.5% FBS/DMEM. Untreated cells serve as baseline controls. Cells cultured in 10 % FBS serve as positive controls. On the third day following treatment, MTS is added to the medium and the cells are incubated for 0.5-4 hrs. The absorbance of the wells is then determined using a microplate absorbance reader.
Day l:
A. Prepare Cells.
1. Wash a flask of 70-80 % confluent cells lx with PBS.
2. Treat cells for ~1 min with 5 ml Trypsin EDTA per TI 75 flask until cells can be knocked free from the bottom of the culture flask.
3. After cells have been knocked free, add 5 ml of Complete DMEM to flask.
4. Transfer cell suspension to a 15 ml conical bottom centrifuge tube.
5. Centrifuge cell suspension at 1200 RPM for 5 min at 4° C.
6. Resuspend cells with 10 mis of Complete DMEM.
C. Count viable cells using trypan blue in a hemacytometer.
D. Dilute cells with Complete DMEM to yield 5,000 cells/well, 10 mL per plate needed.
E. For blank wells add 100 μl of Complete DMEM no cells.
F. Incubate at 37° C in 10% C0 humidified incubator over-night.
Day2:
A. Niew plate for appropriate confluency, viability, and consistency of plating from well to well.
1. Wash plate 2 times with SFM.
B. Add CuraProteins and controls to appropriate wells.
1- For positive controls, add 100 μl Complete DMEM in wells.
2. For negative controls, add 100 μl 0.5 % FBS/DMEM in wells.
3. For Buffer controls, add similar amount of buffer solution used in highest concentration protein treatments.
4. For negative antibody control use 100 μl of negative antibody in 0.5% FBS/DMEM. Also use lOOul of negative antibody and add appropriate (pre-determined) concentration of survival factor. Mix and let stand at room temperature for 10 to 20 minutes for binding, then add 100 μl to each of three wells/treatment.
4. For blank wells, add 100 μl Complete DMEM in wells.
5. In an eppendorf tube add appropriate (pre-determined) concentration of survival factor with 10 μg/ml of experimental antibody, and in a second tube, again with survival factor and 1 μg/ml of experimental antibody. Mix tube and let stand for 10 to 20 minutes for binding, then add 100 μl to each of three wells/treatment.
C. Incubate at 37° C in 10% C02 humidified incubator for next three days.
Day 5:
A. Nisually inspect wells for effects and then add 20 μl MTS to each well.
B. Incubate at 37°C in 10% CO2 humidified incubator for 0.5-4 hrs.
C. Read plates on PowerWave spectrophotometer at 490 nm, single wavelength (KC4 program / Protocol / MTS490 / save file in MS EXCEL format).
REAGENT PREPARATION
Complete DMEM:
DMEM +10%FBS+ 1% P/S
Starvation medium:
DMEM + 0.5 % FBS + 1% P/S
Serum Free Media
DMEM + 0.1%BSA + 1% P/S Example F38: Effects of neutralizing antibodies binding to CG57094-04 (defined as CR064) in Matrigel Plug 786-0 Renal Carcinoma Induced Angiogenesis in Athymic Nude Mice.
Purified CG50794-02 and 04 have demonstrated ability to increase survival of endothelial and 786-0 tumor cells in cell culture studies. We hypothesize that neutralizing antibodies agamst CR064 should inhibit survival of endothelial cell and 786-0 tumor cell in cell culture studies. We hypothesize that these antibodies could offer an antiangiogenic and antitumor effect in a 786-0 driven in vivo model of vessel growth. This activity is not limited to this particular cellular model but should be relevant to the angiogenic reponse by other tumor cell lines, preferably those cell lines that naturally express CG50794 polypepetides.
To evaluate the effects of Cr064 in tumor induced angiogenesis Matrigel plug model using 786-0 human clear cell renal carcinoma. This Matrigel plug assay is designed to provide a quantifiable measure of tumor induced angiogenic response under in vivo conditions as a screen for evaluating the antiangiogenic and antitumor efficacy of CR064. Such a strategy has already been used by Liao et al. to show that a neutralizing antibody against Vascular E-Cadherin inhibited tumor-induce angiogenesis (Liao F, Doody IF, Overholser J, Finnerty B, Bassi R, Wu Y, Dejana E, Kussie P, Bohlen P, Hicklin DJ. Selective targeting of angiogenic tumor vasculature by vascular endothelial-cadherin antibody inhibits tumor growth without affecting vascular permeability. Cancer Res 2002 May l;62(9):2567-75). Our antibody will have a preferable activity because it will affect the survival not only of endothelial cells but also of tumor cells.
Histological evaluation will assess the total vascularity of the subcutaneously implanted Matrigel plugs, as well as any antiangiogenic effect by CR064. Efficacy for this antibody in this model will be defined as the inhibition of 786-0 cell induced angiogenesis as measured by the establish histological methods described below.
MATERIALS AND METHODS
Test System
Species/strain: Mice Balb/C Athymic homozygous nude
(nu/nu)
Physiological state: Normal. Age/weight range at start of 6-8 weeks, 18 -20 g. study:
Number/sex of animals: Total of 25 female mice will be required. Identification: Animals are identified by dots at the base of tail delineating animal numbers. All the cages will be labeled with protocol number, group and animal numbers with appropriate color codes
Randomization: According to body weight. Justification: This study is designed to use a minimum of laboratory animals sufficient to detect meaningful efficacy results within the treatment period.
Replacement: Animals will not be replaced during this study.
Animal Housing and Environment
Housing: Animals will be housed 5 mice per cage in polycarbonate microisolation cages, wood chip bedding and suspended food and sterile water bottles. The cages conform to the guidelines cited in the Guide for the Care and Use of Laboratory Animals and the applicable Standard Operating Procedures.
Acclimation: Mice will be acclimated for 8 days and given food and sterile water ad libitum. Animals will be examined prior to initiation of the study to assure adequate health and suitability. Animals that are found to be diseased or unsuitable will not be assigned to the study.
Environmental conditions: During the course of the study, 12-hour light/12-hour dark cycle will be maintained. A nominal temperature range of 20 to 23° C with a relative humidity between 30% and 70% will also be maintained.
Food/water and Harlan Teklad rodent diet and sterile water contaminants: will be provided ad libitum
Administration of Cr064 antibodies
Route and method of Cr064 will be dosed IP at least twice a week. administration:
Justification for route of This route will be used to evaluate administration: pharmacologic efficacy in this model.
Administered dose: 1, 5 and 10 mg/kg Administered volume: Adjust by body weight, 20 gram mouse/ 0.2 mis
Identity and lot number: 786-0 human renal clear cell adenocarcinoma; batch number P15IC
Physical description: Human Renal Clear Cell Adenocarcinoma
Source: ATCC
Characterization/certification ATCC
Storage conditions: Stability/expiration date: Long-term storage in liquid nitrogen. Thawed and cultured for 48 hours before use. Harvested cells are stored at 4°C during transfer between the laboratory to the Specific Pathogen Free Facility
Experimental Design
Mice will be randomized and groups of 5 will be implanted with Matrigel reconstituted with the required tumor cell lines. A total of 0.5 ml of the suspension will be subcutaneously injected into the right flank of athymic, female, nude mice. Additional animals will be implanted with Matrigel contaimng 786-0 renal cell carcinoma (1.0 x 10 cells). Animals implanted with Matrigel contaimng 786-0 cells will be dosed with 1, 5 and 10 mg/kg, IP, twice daily. Animals will be monitored for 7 days, sacrificed and the Matrigel plugs will be imaged and harvested for further histological evaluation.
Table F38a:
Matrigel volume of 0.5ml will be injected into right flank
Clinical Observations/Signs
Mice will be observed daily for moribundity and mortality approximately 60 minutes after dosing.
Body Weight
Individual body weights of all mice will be recorded daily, for randomization and dosing.
Animals Found Dead or Moribund
If animal dies prior to necropsy (found dead) necropsy and histology data will not be included and tissues will not be collected.
Necropsy
At necropsy, animals will be euthanized by C02 asphyxiation. The Matrigel plugs will be exposed through surgical removal of the covering skin flap. Digital images will then be recorded of the matrigel. - The matrigel plug will then be surgically removed, and processed as described below. Cervical dislocation of mice under deep anesthesia will be performed before the final disposal of animals.
Matrigel plugs will be then resected carefully and cut into three parts.
• One part will be snap frozen in TissueTek and used for cryocut sections.
• One part will be fixed in buffered formalin and then embedded in paraffin for sectioning.
• One part will be reserved as a backup. Snap frozen and stored at — 80°C
Macroscopic and Histopathology
Formalin Fixed Matrigel Sections :
Three sections/mouse of 5 to 7 μm in thickness will be cut and stained with hematoxylin and Eosin. Sections will be examined under phase contrast microscope. Representative photomicrographs will be recorded [two frames (10X and 40X)]. Infiltration of endothelial cells and vessels will be recorded.
Vessel Staining by Immunohistochemistry :
Frozen Matrigel plugs will be sectioned (5 μm sections) in a Cryocut microtome. Three independent sections per mouse will be made at different levels and used for staining. Sections will be blocked with BSA (0.1 %) and then treated with monoclonal antibody reactive to mouse CD31 conjugated to Phycoerythin (dilutions as recommended by the manufacturer). After thorough washings, sections will be mounted under anti-fading reagent (Vecta Shield) and observed under UN microscope using Red filter. Representative Digital images will be captured (two images at 100 X and 200 X magnification).
Morphometric analysis of vessel density: Immunofluorescence images of CD31 staining will be analyzed by Skeletinization program as described by Wild et al (1). Data will be processed to provide mean vessel density, node and length for each group.
DATA ANALYSIS AND REPORTING
Statistical Analysis
Final Report At the conclusion of the study, the results will be reported in full. This final report will include the experimental design, description of local and systemic effects, body weight, mortality and results of macroscopic and histopathologic findings. The format of all textual reports, including figures, tables, and scanned images will conform to CuraGen standards (CuraStandards). Data presentation will include:
• Representative Color Photomicrographs
• Digital files (JPEG or TIFF or PDB) for permanent record
1. Wild, R., S. Ramakrishnan, J. Sedgewick, and A. W. Griffioen 2000. Quantitative assessment of angiogenesis and tumor vessel architecture by computer-assisted digital image analysis: effects of VEGF-toxin conjugate on tumor microvessel density Microvasc Res. 59:368-76.
Example F39: Efficacy Evaluation of CUR64 Against the 786-0 Human Renal Cell Carcinoma Line Grown as a Xenograft in Nude Mice
Purified CG50794-02 and 04 have demonstrated ability to increase survival of endothelial and 786-0 tumor cells in cell culture studies. We hypothesize that neutralizing antibodies against CR064 should inhibit survival of endothelial cell and 786-0 tumor cell in cell culture studies. We hypothesize that these antibodies could offer an antiangiogenic and antitumor effect in a 786-0 driven in vivo model of tumor xenograft.
The ability of this tumor cell line to produce ectopic tumor xenograft in nude mice is known in the art and it has been used to test the anti-tumor activity of several agents (Plonowski A, Schally AN, Νagy A, Kiaris H, Hebert F, Halmos G Inhibition of metastatic renal cell carcinomas expressing somatostatin receptors by a targeted cytotoxic analogue of somatostatin AN-238. Cancer Res 2000 Jun 1;60(11):2996-3001)
This activity is not limited to this particular cellular model but should be relevant to other tumor cell lines, preferably those cell lines that naturally express CG50794 polypeptides.
Combination therapy of biological compounds like subcutaneous interferon-alpha (TFN-alpha) and interleukin-2 (IL-2) with intravenous 5-fluorouracil (5-FU) is nowdays standard therapy and achieves some long-term survival benefits in patients with metastatic renal cell carcinoma but it is not curative and affects only a subset of patients. It is therefore necessary to discover new agents that either as single therapy or in combination with 5-FU increase both the overall response rate, long term survival and quality of life.
Therefore we test the efficacy of CR064 antibodies in the 786-0 tumor xenograft alone and in combination with 5-FU. Efficacy for this antibody in this model will be defined as tumor growth delay or growth inhibition as single therapy or combination as measured by the established methods described below.
Test System
Species/strain: Mouse/ nu/nu Physiological state: Normal Age/weight range at start of Animals aged 5 to 6 weeks with body study: weight of approximately 20 g
Animal supplier: Charles River Number/sex of animals: 60/Female Identification: Individually tattooed tails. Randomization: Animals will be randomized prior to assignment to treatment groups
Justification: Xenograft tumor models present a well characterized system for testing of anti-cancer agents.
Replacement: Animals will not be replaced during the course of the study. Animal Housing and Environment
Housing: Static microisolators. Acclimation: 1 week. Environmental conditions: 12-hour light cycle at 21 - 22° C (70 - 72 °F) and 40% - 60% humidity.
Food/water and Irradiated standard rodent diet (NIH31 contaminants: Modified and Irradiated) consisting of: 18% protein; 5% fat; and 5% fiber; water (reverse osmosis, 1 ppm Cl), ad libitum
Administration of Cr064 antibodies
Route and method of Cr064 will be dosed IP at least twice a week for at least 3 weeks administration:
Justification for route of This route will be used to evaluate administration: pharmacologic efficacy in this model.
Administered dose: 1, 5 and 10 mg/kg
Administered volume: Adjust by body weight, 20 gram mouse/ 0.2 mis
Identity and lot number: 786-0 human renal clear cell adenocarcinoma; batch number PI 5IC
Physical description: Human Renal Clear Cell Adenocarcinoma
Source: ATCC
Characterization/certification ATCC
Stability/expiration date: Long-term storage in liquid nitrogen. Thawed and cultured for 48 hours before use. Harvested cells are stored at 4°C during transfer between the laboratory to the Specific Pathogen Free Facility Experimental Design
After an acclimation period mice will be subcutaneously implanted with l x l mm3 fragments of 786-0 tumors. Animals will be randomized and individually identified. Upon tumors reaching a volume of 60-100 mm3 treatment with will begin. Cr064 antibodies will be administered intraperitoneally at the following doses and schedule (Table 1). Mice will be observed daily, tumors and weight will be recorded twice weekly throughout the study period.
Table F39a: Study Design
Table F39b: Study Timeline
Experimental Procedures
Tumor bearing animals will be randomized prior to the start of treatment with. Mice will be monitored daily for body condition and health status. Starting at the point where there is a palpable size mass (60-100 mm3) treatment with CR064 will start. The treatment schedule will be 1, 5 or 10 mg/kg, IP, twice daily for 14 days. Throughout the study the animals will be monitored for tumor twice weekly using calipers. Weights will be recorded daily for the treatment period and twice weekly thereafter.
Tumor volumes will be calculated for all remaining animals as well as body weights. Tumor volumes will be analyzed using the methodology described in the data analysis and reporting section.
Tumor implantation
Tumors will be harvested from healthy tumor-bearing donor animals. The tissues will be homogenized using standard procedures. Cells will be counted and evaluated for viability using trypan blue. Cells will be suspended in serum free media, and a total of 5 x 106 cells will be subcutaneously implanted in the flank of mice.
Tumor Measurement and Volume Determination
Tumor growth will be measured and recorded 3 times a week using a caliper. Length and width will be measured for each tumor. Tumor volume will be determined using the following formula: „ „-. . , . , -. w x l
Tumor Weight (mg) = — - —
Clinical Observations/Signs
Animals will be observed daily for significant clinical signs, moribundity and mortality.
Animals Found Dead or Moribund
Percentage of animal mortality and time to death will be recorded for every animal on the study. Mice may be defined moribund and sacrificed if one or more of the following criteria are met:
1) Body weight loss of 20% or greater in a 2- week period.
2) Tumors that inhibit normal physiological function such as eating, drinking, mobility and ability to urinate and or defecate.
3) Tumors that exceed a maximum dimension of 2000mg as measured by calipers.
4) Ulcerated tumors, tumor producing a exudates or bleeding. 5) Prolonged diarrhea leading to weight loss.
6) Persistent wheezing and respiratory distress
Animals can also be considered moribund if there is prolonged or excessive pain or distress as defined by clinical observations such as: Prostrate, hunched posture, paralysis/paresis, distended abdomen, ulcerations, abscesses, seizures and/or hemorrhages.
Animals Found Dead or Moribund
Any adverse effects or unanticipated deaths will be reported to the veterinarian and to CuraGen Corporation immediately.
Table F40: PE201: Transgenic Mouse Production
Transgenic expression of a human gene in a mouse is a useful tool to help determine the function of the product of the gene in instances where the resulting protein product(s) bind to and activate equivalent receptors leading to conserved biological function. Transgenic mice expressing a human protein can also be used as tools to study the inhibitory or activating properties of antibodies to the human protein in vivo. The production and molecular characterization of the transgenic mice was performed by Xenogen Transgenics (Cranberry, NJ).
Transgenic mice were produced which express CG57094-02 gene driven by the SAP (serum amyeloid P component (SAP) promoter, a gift of Dr. Yamamura, Institute of Molecular Embryology and Genetics, Kumamoto University School of Medicine,
Kumamoto, Japan. The promoter drives expression of the gene to produce protein in the liver with slight expression in the postnatal mouse. Mouse embryonic stem cells were microinjected with linearized DNA consisting of the SAP promoter and the downstream gene which encodes CG57094-02. The CG57094-02 sequence is flanked 5' by an IgK secretory signal sequence and 3' by DNA encoding V5/His epitopes. Mouse embryos were implanted, and progeny were analyzed for gene integration
Sharma A. Khourv-Christianson AM. White SP. Dhanial NK. Huang Related Articles. Links
W. Paulhiac C. Friedman EJ. Maniula BN. Kumar R.
High-efficiency synthesis of human alpha-endorphin and magainin in the erythrocytes of transgenic mice: a production system for therapeutic peptides. Proc Natl Acad Sci U S A. 1994 Sep 27;91(20):9337-41. Founders (mice which have integrated the gene) were identified by PCR of tail genomic DNA. Sera was drawn from the mouse tail vein at age 4 weeks for serum ELISA to examine protein expression in the circulation for genes for which a secreted product is expected. Serum ELISA was performed using [Curamab/polymab/anti-V5 tag - assay in development] in a two-site format. Serum protem positive mice were bred to obtain lines with relatively homogeneous expression of the protein. These mice can be used for phenotypic analysis or disease modeling to determine the role of the CG57094-02 and functional or PK properties of CR064 mAb.
OTHER EMBODIMENTS
Although particular embodiments have been disclosed herein in detail, this has been done by way of example for purposes of illustration only, and is not intended to be limiting with respect to the scope of the appended claims, which follow. In particular, it is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the invention without departing from the spirit and scope of the invention as defined by the claims. The choice of nucleic acid starting material, clone of interest, or library type is believed to be a matter of routine for a person of ordinary skill in the art with knowledge of the embodiments described herein. Other aspects, advantages, and modifications considered to be within the scope of the following claims. The claims presented are representative of the inventions disclosed herein. Other, unclaimed inventions are also contemplated. Applicants reserve the right to pursue such inventions in later claims.

Claims

CLAIMSWhat is claimed is:
1. An isolated polypeptide comprising the mature form of an amino acid sequenced selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
2. An isolated polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
3. An isolated polypeptide comprising an amino acid sequence which is at least 95% identical to an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
4. An isolated polypeptide, wherein the polypeptide comprises an amino acid sequence comprising one or more conservative substitutions in the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherem n is an integer between 1 and 141.
5. The polypeptide of claim 1 wherein said polypeptide is naturally occurring.
6. A composition comprising the polypeptide of claim 1 and a carrier.
7. A kit comprising, in one or more containers, the composition of claim 6.
8. The use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease selected from a pathology associated with the polypeptide of claim 1, wherein the therapeutic comprises the polypeptide of claim 1.
9. A method for determining the presence or amount of the polypeptide of claim 1 in a sample, the method comprising: (a) providing said sample;
(b) introducing said sample to an antibody that binds immunospecifically to the polypeptide; and
(c) determining the presence or amount of antibody bound to said polypeptide, thereby determining the presence or amount of polypeptide in said sample.
10. A method for determining the presence of or predisposition to a disease associated with altered levels of expression of the polypeptide of claim 1 in a first mammalian subject, the method comprising: a) measuring the level of expression of the polypeptide in a sample from the first mammalian subject; and b) comparing the expression of said polypeptide in the sample of step (a) to the expression of the polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, said disease, wherein an alteration in the level of expression of the polypeptide in the first subject as compared to the control sample indicates the presence of or predisposition to said disease.
11. A method of identifying an agent that binds to the polypeptide of claim 1 , the method comprising:
(a) introducing said polypeptide to said agent; and
(b) determining whether said agent binds to said polypeptide.
12. The method of claim 11 wherein the agent is a cellular receptor or a downstream effector.
13. A method for identifying a potential therapeutic agent for use in treatment of a pathology, wherein the pathology is related to aberrant expression or aberrant physiological interactions of the polypeptide of claim 1, the method comprising:
(a) providing a cell expressing the polypeptide of claim 1 and having a property or function ascribable to the polypeptide;
(b) contacting the cell with a composition comprising a candidate substance; and (c) determining whether the substance alters the property or function ascribable to the polypeptide; whereby, if an alteration observed in the presence of the substance is not observed when the cell is contacted with a composition in the absence of the substance, the substance is identified as a potential therapeutic agent.
14. A method for screening for a modulator of activity of or of latency or predisposition to a pathology associated with the polypeptide of claim 1, said method comprising:
(a) administering a test compound to a test animal at increased risk for a pathology associated with the polypeptide of claim 1, wherein said test animal recombinantly expresses the polypeptide of claim 1;
(b) measuring the activity of said polypeptide in said test animal after administering the compound of step (a); and
(c) comparing the activity of said polypeptide in said test animal with the activity of said polypeptide in a control animal not administered said polypeptide, wherein a change in the activity of said polypeptide in said test animal relative to said control animal indicates the test compound is a modulator activity of or latency or predisposition to, a pathology associated with the polypeptide of claim 1.
15. The method of claim 14, wherein said test animal is a recombinant test animal that expresses a test protein transgene or expresses said transgene under the control of a promoter at an increased level relative to a wild-type test animal, and wherein said promoter is not the native gene promoter of said transgene.
16. A method for modulating the activity of the polypeptide of claim 1 , the method comprising contacting a cell sample expressing the polypeptide of claim 1 with a compound that binds to said polypeptide in an amount sufficient to modulate the activity of the polypeptide.
17. A method of treating or preventing a pathology associated with the polypeptide of claim 1, the method comprising administering the polypeptide of claim 1 to a subject in which such treatment or prevention is desired in an amount sufficient to treat or prevent the pathology in the subject.
18. The method of claim 17, wherein the subject is a human.
19. A method of treating a pathological state in a mammal, the method comprising administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141 or a biologically active fragment thereof.
20. An isolated nucleic acid molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141.
21. The nucleic acid molecule of claim 20, wherein the nucleic acid molecule is naturally occurring.
22. A nucleic acid molecule, wherein the nucleic acid molecule differs by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 141.
23. An isolated nucleic acid molecule encoding the mature form of a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO:2n, wherein n is an integer between 1 and 141.
24. An isolated nucleic acid molecule comprising a nucleic acid selected from the group consisting of 2n-l, wherein n is an integer between 1 and 141.
25. The nucleic acid molecule of claim 20, wherein said nucleic acid molecule hybridizes under stringent conditions to the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 141, or a complement of said nucleotide sequence.
26. A vector comprising the nucleic acid molecule of claim 20.
27. The vector of claim 26, further comprising a promoter operably linked to said nucleic acid molecule.
28. A cell comprising the vector of claim 26.
29. An antibody that immunospecifically binds to the polypeptide of claim 1.
30. The antibody of claim 29, wherein the antibody is a monoclonal antibody.
31. The antibody of claim 29, wherein the antibody is a humanized antibody.
32. A method for determining the presence or amount of the nucleic acid molecule of claim 20 in a sample, the method comprising:
(a) providing said sample;
(b) introducing said sample to a probe that binds to said nucleic acid molecule; and
(c) determining the presence or amount of said probe bound to said nucleic acid molecule, thereby determining the presence or amount of the nucleic acid molecule in said sample.
33. The method of claim 32 wherein presence or amount of the nucleic acid molecule is used as a marker for cell or tissue type.
34. The method of claim 33 wherem the cell or tissue type is cancerous.
35. A method for determining the presence of or predisposition to a disease associated with altered levels of expression of the nucleic acid molecule of claim 20 in a first mammalian subject, the method comprising: a) measuring the level of expression of the nucleic acid in a sample from the first mammalian subject; and b) comparing the level of expression of said nucleic acid in the sample of step (a) to the level of expression of the nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease; wherein an alteration in the level of expression of the nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
36. A method of producing the polypeptide of claim 1 , the method comprising culturing a cell under conditions that lead to expression of the polypeptide, wherein said cell comprises a vector comprising an isolated nucleic acid molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:2n-l, wherein n is an integer between 1 and 141.
37. The method of claim 36 wherein the cell is a bacterial cell.
38. The method of claim 36 wherein the cell is an insect cell.
39. The method of claim 36 wherein the cell is a yeast cell.
40. The method of claim 36 wherein the cell is a mammalian cell.
41. A method of producing the polypeptide of claim 2, the method comprising culturing a cell under conditions that lead to expression of the polypeptide, wherein said cell comprises a vector comprising an isolated nucleic acid molecule comprising a nucleic acid sequence selected from the group consisting of SEQ ID NO:2n-l, whereinn is an integer between 1 and 141.
42. The method of claim 41 wherein the cell is a bacterial cell.
43. The method of claim 41 wherein the cell is an insect cell.
44. The method of claim 41 wherein the cell is a yeast cell.
5. The method of claim 41 wherein the cell is a mammalian cell.
EP02793885A 2001-11-05 2002-11-05 Therapeutic polypeptides, nucleic acids encoding same, and methods of use Withdrawn EP1539985A4 (en)

Applications Claiming Priority (39)

Application Number Priority Date Filing Date Title
US33862601P 2001-11-05 2001-11-05
US338626P 2001-11-05
US33660001P 2001-12-05 2001-12-05
US336600P 2001-12-05
US33828501P 2001-12-07 2001-12-07
US338285P 2001-12-07
US34134601P 2001-12-12 2001-12-12
US341346P 2001-12-12
US34154001P 2001-12-17 2001-12-17
US34147701P 2001-12-17 2001-12-17
US341540P 2001-12-17
US341477P 2001-12-17
US34259201P 2001-12-20 2001-12-20
US342592P 2001-12-20
US34429701P 2001-12-27 2001-12-27
US344297P 2001-12-27
US34490301P 2001-12-31 2001-12-31
US344903P 2001-12-31
US37328802P 2002-04-17 2002-04-17
US373288P 2002-04-17
US38098102P 2002-05-15 2002-05-15
US380981P 2002-05-15
US38149502P 2002-05-17 2002-05-17
US381495P 2002-05-17
US38353402P 2002-05-28 2002-05-28
US38374402P 2002-05-28 2002-05-28
US383534P 2002-05-28
US383744P 2002-05-28
US38402402P 2002-05-29 2002-05-29
US38382902P 2002-05-29 2002-05-29
US383829P 2002-05-29
US384024P 2002-05-29
US40178802P 2002-08-07 2002-08-07
US401788P 2002-08-07
US40635302P 2002-08-26 2002-08-26
US406353P 2002-08-26
PCT/US2002/035536 WO2003040330A2 (en) 2001-11-05 2002-11-05 Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US10/287,971 US20040067882A1 (en) 2001-10-22 2002-11-05 Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US287971 2002-11-05

Publications (2)

Publication Number Publication Date
EP1539985A2 true EP1539985A2 (en) 2005-06-15
EP1539985A4 EP1539985A4 (en) 2006-06-28

Family

ID=32512865

Family Applications (1)

Application Number Title Priority Date Filing Date
EP02793885A Withdrawn EP1539985A4 (en) 2001-11-05 2002-11-05 Therapeutic polypeptides, nucleic acids encoding same, and methods of use

Country Status (3)

Country Link
EP (1) EP1539985A4 (en)
CA (1) CA2460653A1 (en)
WO (1) WO2003040330A2 (en)

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050123925A1 (en) 2002-11-15 2005-06-09 Genentech, Inc. Compositions and methods for the diagnosis and treatment of tumor
US20050053988A1 (en) * 2003-08-08 2005-03-10 The Gov. Of The Usa As Represented By The Secretary Of The Dept. Of Health & Human Services Gene expressed in breast cancer and methods of use
WO2005072340A2 (en) 2004-01-27 2005-08-11 Compugen Ltd. Novel polynucleotides encoding polypeptides and methods using same
EP1771474B1 (en) 2004-07-20 2010-01-27 Genentech, Inc. Inhibitors of angiopoietin-like 4 protein, combinations, and their use
CA2574791A1 (en) 2004-07-20 2006-02-09 Genentech, Inc. Compositions and methods of using angiopoietin-like 4 protein
US8604185B2 (en) 2004-07-20 2013-12-10 Genentech, Inc. Inhibitors of angiopoietin-like 4 protein, combinations, and their use
WO2006043271A1 (en) * 2004-10-22 2006-04-27 Compugen Ltd. Novel nucleotide and amino acid sequences, and assays and methods of use thereof for diagnosis
US10842849B2 (en) * 2011-02-28 2020-11-24 The Schepens Eye Research Institute, Inc. Methods for promoting neuronal outgrowth by insulin-like growth factor binding protein-like 1 (IGFBPL-1) in glaucoma or leber's optic neuropathy
CN119306833B (en) * 2023-07-11 2025-09-16 东莞市朋志生物科技有限公司 Anti-procalcitonin antibodies, reagents and kits for detecting procalcitonin

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997033996A2 (en) * 1996-03-11 1997-09-18 Bayer Corporation Human bikunin

Also Published As

Publication number Publication date
EP1539985A4 (en) 2006-06-28
CA2460653A1 (en) 2003-05-15
WO2003040330A2 (en) 2003-05-15
WO2003040330A8 (en) 2005-04-21

Similar Documents

Publication Publication Date Title
WO2004000997A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040067882A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003029423A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003040330A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003083046A2 (en) Novel proteins and nucleic acids encoding same
US20030219823A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040038230A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003031571A2 (en) Novel human proteins, polynucleotides encoding them and methods of using the same
WO2003085124A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
EP1572922A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003083039A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003023002A2 (en) Novel human proteins, polynucleotides encoding them and methods of using the same
US20030229016A1 (en) Novel human proteins, polynucleotides encoding them and methods of using the same
CA2471480A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2004089282A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003064589A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
AU2002359353A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040002453A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
US20040076967A1 (en) Novel human proteins, polynucleotides encoding them and methods of using the same
EP1513864A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
AU2003210852A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
WO2003064629A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
AU2002340385A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
AU2002335718A1 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use
EP1572948A2 (en) Therapeutic polypeptides, nucleic acids encoding same, and methods of use

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20040521

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR IE IT LI LU MC NL PT SE SK TR

AX Request for extension of the european patent

Extension state: AL LT LV MK RO SI

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: CURAGEN CORPORATION

A4 Supplementary search report drawn up and despatched

Effective date: 20060530

17Q First examination report despatched

Effective date: 20070206

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20070817