EP1520023A2 - Human nuclear hormone receptor - Google Patents

Human nuclear hormone receptor

Info

Publication number
EP1520023A2
EP1520023A2 EP03738307A EP03738307A EP1520023A2 EP 1520023 A2 EP1520023 A2 EP 1520023A2 EP 03738307 A EP03738307 A EP 03738307A EP 03738307 A EP03738307 A EP 03738307A EP 1520023 A2 EP1520023 A2 EP 1520023A2
Authority
EP
European Patent Office
Prior art keywords
polypeptide
nucleic acid
disease
acid molecule
disorders
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP03738307A
Other languages
German (de)
French (fr)
Inventor
Christopher Benjamin Phelps
Richard Joseph Fagan
Kathryn Elizabeth Allen
Ilana Stancovski
Valerie Nathalie Pierron
Tom Phillips
Caroline Ann Hunt
Zinat Ellaheh Enayat
Janet Marjorie Allen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Inpharmatica Ltd
Original Assignee
Inpharmatica Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Inpharmatica Ltd filed Critical Inpharmatica Ltd
Publication of EP1520023A2 publication Critical patent/EP1520023A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70567—Nuclear receptors, e.g. retinoic acid receptor [RAR], RXR, nuclear orphan receptors
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • This invention relates to a protein, termed BAB13403.1 (also referred to as NHR14, NR14 and LBDG14) herein identified as a Nuclear Hormone Receptor and to the use of this protein and nucleic acid sequence from the encoding gene in the diagnosis, prevention and treatment of disease.
  • BAB13403.1 also referred to as NHR14, NR14 and LBDG14
  • NHR14, NR14 and LBDG14 nuclear Hormone Receptor
  • This tool is a database system, termed the Biopendium search database, that is the subject of co-pending International Patent Application No. PCT/GB01/01105.
  • This database system consists of an integrated data resource created using proprietary technology and containing information generated from an all-by-all comparison of all available protein or nucleic acid sequences.
  • the aim behind the integration of these sequence data from separate data resources is to combine as much data as possible, relating both to the sequences themselves and to information relevant to each sequence, into one integrated resource.
  • All the available data relating to each sequence including data on the three-dimensional structure of the encoded protein, if this is available, are integrated together to make best use of the information that is known about each sequence and thus to allow the most educated predictions to be made from comparisons of these sequences.
  • the annotation that is generated in the database and which accompanies each sequence entry imparts a biologically relevant context to the sequence information.
  • This data resource has made possible the accurate prediction of protein function from sequence alone. Using conventional technology, this is only possible for proteins that exhibit a high degree of sequence identity (above about 20%-30% identity) to other proteins in the same functional family. Accurate predictions are not possible for proteins that exhibit a very low degree of sequence homology to other related proteins of known function.
  • a protein whose sequence is recorded in a publicly available database as KIAA1577 (NCBI Genebank nucleotide accession number AB046797.1 and a Genebank protein accession number BAB 13403.1), is implicated as a novel member of the Nuclear Hormone Receptor Ligand Binding Domain family.
  • KIAA1577 NCBI Genebank nucleotide accession number AB046797.1 and a Genebank protein accession number BAB 13403.1
  • the Nuclear Hormone Receptor family encodes structurally related proteins that regulate the transcription of target genes. These proteins include receptors for steroid and thyroid hormones, vitamins, and other proteins for which no ligands have been found.
  • a protein must possess at least one of two key domains; a C4-type zinc finger DNA-Binding Domain (DBD) or a Ligand Binding Domain (LBD).
  • DBD C4-type zinc finger DNA-Binding Domain
  • LBD Ligand Binding Domain
  • the DBD is required for binding DNA in the vicinity of target genes, and the LBD is required for steroid-like ligand responsiveness. It is the Ligand Binding Domain of Nuclear Hormone Receptors which is the binding site for pharmacological agents such as Tamoxifen.
  • Nuclear Hormone Receptors possess both a DBD and an LBD, and a well-known example of this is Estrogen receptor alpha, which possesses both a DBD and an LBD.
  • Nuclear Hormone Receptors which possess both a DBD and an LBD can be referred to as "Classical Nuclear Honnone Receptors".
  • Nuclear Hormone Receptors which possess an LBD can be sub-classified as "Nuclear Hormone Receptor Ligand Binding Domain” family members. Thus Estrogen receptor alpha and SHP are "Nuclear Hormone Receptor Ligand Binding Domain” family members whereas Knirps and ODR7 are excluded.
  • Nuclear Hormone Receptors can also be sub-classified on the basis of possession of a DBD. Nuclear Hormone Receptors which possess a C4-type zinc finger DBD can be sub- classified as "Nuclear Hormone Receptor DNA Binding Domain” family members. Thus Estrogen Receptor alpha, Knirps and ODR7 are "Nuclear Hormone Receptor DNA Binding Domain” family members whereas SHP is excluded.
  • the DBD directs the protein to bind specific DNA sequences in the vicinity of target genes.
  • the Ligand Binding Domain (LBD) binds and responds to the cognate hormone. Ligand binding to the LBD triggers a conformational change which expels a bound "Nuclear Receptor Co-Repressor". The site previously occupied by the Co-Repressor is then free to recruit a "Nuclear Receptor Co-Activator”. This Ligand-triggered swap of a Co- Repressor for a Co-Activator is the mechanism by which Ligand binding leads to the transcriptional activation of target genes.
  • the LBD is the binding site for all Nuclear Hormone Receptor targeted drugs to date and it is thus desirable to identify Ligand Binding Domains since these will be attractive drug targets.
  • the LBD also directs dimerisation with other LBDs.
  • the Estrogen receptor alpha ligand binding domain can homodimerise with itself, or heterodimerise with the Estrogen receptor beta ligand binding domain.
  • Ligand Binding Domains share low sequence identity ( ⁇ 15%) but have very similar structures and so present ideal targets for a structure-based relationship tool such as Inpharmatica Genome Threader .TM
  • Class ID refers to a classification code for each member
  • accession refers to NCBI GenBank nucleotide accession code.
  • Nuclear Hormone Receptor Ligand Binding Domain family members have been shown to play a role in diverse physiological functions, many of which can play a role in disease processes (see Table 2).
  • the invention is based on the discovery that the BAB 13403.1 protein functions as a Nuclear Hormone Receptor Ligand Binding Domain.
  • Human RXRalpha Ligand Binding Domain is known to function as a Nuclear Hormone Receptor Ligand Binding Domain. This relationship is not just to the Human RXRalpha Ligand Binding Domain, but rather to the Nuclear Hormone Receptor Ligand Binding Domain family as a whole.
  • results presented herein clearly indicate that the LBDG14 transcript is present at detectable levels in a variety of human tissues and cell lines. This confirms the relevance of the LBDG14 polypeptides as important targets for futher biochemical characterisation.
  • the particular tissues and cell lines identified herein as expressing LBDG14 represent ideal targets for further studies of LBDG14 function in vivo. Such studies may, for example, make use of the ligands identified using the assays and screening methods disclosed herein to investigate the effects of inducing or inhibiting LBDG14 function.
  • the cloning of the full-length LBDG14 polypeptide allows for high-level expression, purification and characterisation of these polypeptides.
  • the cloning, purification and partial characterisation of the LBD of LBDG14 is described herein.
  • the expression level of LBDG14 is increased in a number of diseased tissues relative to undiseased tissues, particularly in certain tumour samples including Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis.
  • Down regulation of LBDG14 expression has been noted in lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas.
  • An upregulation has also been noted in activated neutrophils.
  • Such disease conditions include all infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as D3D; multiple sclerosis; rheumatoid arthritis and chronic obstructive pulmonary disease (COPD).
  • chronic bacterial infections such as tuberculosis; cancers; sarcoidosis
  • CCD Chronic granulomatous disease
  • COPD chronic obstructive pulmonary disease
  • agonists and antagonists of LBDG14 are likely to be of great value in the treatment of diseases in which Nuclear Hormone Receptors are implicated, especially those disclosed above.
  • agonists and antagonists of the LBDG14 polypeptides can be readily identified using the assays and screening methods disclosed. Once identified, the effect of agonists and antagonists on diseased cell lines and tissue types may then be investigated using the methods disclosed herein or known to those of skill in the art. It is likely that certain agonists or antagonists identified using the assays and methods disclosed herein will be useful in the prophylaxis or treatment of diseases associated with LBDG14.
  • the polypeptides of the invention are therefore of value in the development of diagnostic methods for the identification of patients with those particular disease conditions and for the development of suitable prophylactic and therapeutic treatments.
  • the present invention allows the development of molecular diagnostic tools, such as monoclonal antibodies, for the detection of LBDG14 in vivo, that preferably target the ligand binding domain or DNA binding domain specifically.
  • molecular diagnostic tools such as monoclonal antibodies
  • the LBDG14 polypeptide is a Nuclear Hormone Receptor, that allows the skilled reader to use this knowledge to generate bespoke compounds that bind to areas of interest and biochemical importance in the polypeptide.
  • the identification of patients affected by particular cancer conditions using such diagnostic methods will enable specific therapeutic approaches for individual patients to be selected.
  • the present invention allows the design of specific therapies for the treatment of the specific cancer conditions identified herein; such therapies may, for example, target LBDG14 expression or function in the relevant tumour cells.
  • the invention provides a polypeptide, which polypeptide:
  • (i) comprises the amino acid sequence as recited in SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30 and/or SEQ ID NO:32;
  • (ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding Domain activity or having an antigenic determinant in common with the polypeptides of (i); or
  • polypeptide according to the first aspect of the invention is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • (i) comprises the amino acid sequence as recited in SEQ ID NO: 2 and/or SEQ ID NO: 32;
  • (ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding Domain activity, or having an antigenic determinant in common with the polypeptides of (i); or
  • (i) consists of the amino acid sequence as recited in SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30 and/or SEQ ID NO:32; (ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding Domain activity, or having an antigenic determinant in common with the polypeptides of (i); or (iii) is a functional equivalent of (i) or (ii).
  • the polypeptide having the sequence recited in SEQ ID NO:2 is referred to hereafter as "the LBDG14 polypeptide". It is anticipated that additional N terminal sequence will exist that is N terminal to the sequence recited in SEQ ID NO:2, such that the sequence presently recited is not that of the full length protein. Proposed missing exons A, B, C, D, E, F, G, H, I, J, K, L, M and N are recited herein as SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28 and 30 respectively. The full amount of LBDG14 polypeptide sequence that is currently known is rected in SEQ ID NO: 32 (coding sequence given in SEQ ID NO:31).
  • the extended LBDG14 polypeptide This sequence is referred to herein as "the extended LBDG14 polypeptide". It is suspected that there is at least one missing exon between exons A and B (SEQ ID NO: 4 and SEQ ID NO: 6, respectively), encoding sequence that is represented in SEQ ID NO:32 as (X) n , "X” denoting any amino acid, and "n” an integer between 1 and 1000, preferably between 1 and 200, more preferably between 1 and 100. It will be apparent to the skilled reader how the missing sequence may be identified using the various molecular biology techniques that are recited herein (see below).
  • a preferred polypeptide fragment according to part ii) above includes the region of the LBDG14 polypeptide or the extended LBDG14 polypeptide that is predicted as that responsible for Nuclear Hormone Receptor Ligand Binding Domain activity (hereafter, the "LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region"), or is a variant thereof.
  • the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region is considered to extend between residue 248 and residue 433 of the LBDG14 polypeptide sequence (SEQ ID NO:2).
  • This aspect of the invention also includes fusion proteins that incorporate polypeptide fragments and variants of these polypeptide fragments as defined above, provided that said fusion proteins possess activity as a Nuclear Hormone Receptor Ligand Binding Domain.
  • Nuclear Hormone Receptor Ligand Binding Domain we refer to polypeptides that comprise amino acid sequence or structural features that can be identified as conserved features within the polypeptides of the Nuclear Hormone Receptor family, such that the polypeptide' s interaction with receptor or ligand is not substantially affected detrimentally in comparison to the function of the full length wild type polypeptide. In particular, we refer to the presence of cysteine residues in specific positions within the polypeptide that allow the formation of disulphide bonds.
  • a polypeptide according to the first aspect of the invention functions as a nuclear hormone receptor.
  • the invention provides a purified nucleic acid molecule that encodes a polypeptide of the first aspect of the invention, or a fragment thereof.
  • the purified nucleic acid molecule has the nucleic acid sequence as recited in SEQ ID NO:l (encoding the LBDG14 polypeptide), SEQ ID NO:31 (encoding the extended LBDG14 polypeptide) or is a redundant equivalent or fragment of this sequence.
  • a preferred nucleic acid fragment is one that encodes a polypeptide fragment according to part ii) above, preferably a polypeptide fragment that includes the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region, or that encodes a variant of these fragments as this term is defined above.
  • an nucleic acid molecule according to the second aspect of the invention further comprises nucleic acid sequences selected from the group comprising SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO:l l, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29 and SEQ ID NO: 31. It is anticipated that at least one further exon exists in the LBDG14 gene, corresponding to further nucleic acid sequence between SEQ ID NO: 3 and SEQ ID NO: 5.
  • a nucleic acid molecule according to the second aspect of the invention consists of the nucleic acid sequence recited in SEQ ID NO: 31; this sequence is the full amount of LBDG14 nucleotide sequence that is currently known.
  • the missing nucleic acid sequence is proptrayed in this SEQ ID as (X) context, "X” denoting any nucleotide, and "n” an integer between 3 and 3000, preferably 3 and 600, more preferably between 3 and 300. It will be apparent to the skilled reader how the missing sequence may be identified using the various molecular biology techniques that are recited herein (see below).
  • the invention provides a purified nucleic acid molecule which hybridizes under high stringency conditions with a nucleic acid molecule of the second aspect of the invention.
  • the invention provides a vector, such as an expression vector, that contains a nucleic acid molecule of the second or third aspect of the invention.
  • the invention provides a host cell transformed with a vector of the fourth aspect of the invention.
  • the invention provides a ligand which binds specifically to, and which binds to and preferably inhibits or activates the Nuclear Hormone Receptor Ligand Binding Domain activity of, a polypeptide of the first aspect of the invention.
  • the ligand inhibits the function of a polypeptide of the first aspect of the invention which is a Nuclear Hormone Receptor Ligand Binding Domain.
  • Ligands to a polypeptide according to the invention may come in various forms, including natural or modified substrates, enzymes, receptors, small organic molecules such as small natural or synthetic organic molecules of up to 2000Da, preferably 800Da or less, peptidomimetics, inorganic molecules, peptides, polypeptides, antibodies, structural or functional mimetics of the aforementioned.
  • small organic molecules such as small natural or synthetic organic molecules of up to 2000Da, preferably 800Da or less
  • peptidomimetics small organic molecules of up to 2000Da, preferably 800Da or less
  • inorganic molecules peptides, polypeptides, antibodies, structural or functional mimetics of the aforementioned.
  • a low molecular weight compound representative of retinoid modulators has been demonstrated herein to activate with high affinity to the LBDG14 polypeptide.
  • such ligands may bind specifically to, and inhibit the activity of a Nuclear Hormone Receptor Ligand Binding Domain of the present invention by binding to one or more residues within the LBD, or to one or more residues outside the LBD.
  • all known drugs that affect Nuclear Hormone Receptors bind to residues within the LBD. Accordingly, it is preferred that ligands of the invention which inhibit the Nuclear Hormone Receptor Ligand Binding Domain activity of a polypeptide of the invention bind to residues within the LBD.
  • such ligands may bind specifically to, and inhibit the activity of a Nuclear Hormone Receptor DNA Binding Domain of the present invention by binding to one or more residues within the LBD, or to one or more residues outside the LBD. It is preferred that ligands of the invention which inhibit the Nuclear Hormone Receptor DNA Binding Domain activity of a polypeptide of the invention bind to residues within the DBD. For example, such ligand may bind specifically to, and inhibit the activity of a Nuclear Hormone Receptor of the present invention by binding to either the LBD or the DBD, such that the NHR is unable to function normally.
  • the invention provides a compound that is effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the first aspect of the invention.
  • a compound that is effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the first aspect of the invention.
  • Such compounds may be identified using the assays and screening methods dislcosed herein.
  • a compound of the seventh aspect of the invention may either increase agonise) or decrease (antagonise) the level of expression of the gene or the activity of the polypeptide.
  • the identification of the function of the region defined herein as the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide, respectively allows for the design of screening methods capable of identifying compounds that are effective in the treatment and/or diagnosis of diseases in which Nuclear Hormone Receptor Ligand Binding Domains are implicated.
  • the invention provides a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in therapy or diagnosis.
  • These molecules may also be used in the manufacture of a medicament for the treatment of such diseases.
  • Examples of diseases in which Nuclear Hormone Receptor Ligand Binding Domains are implicated include cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, uterus, prostate, pancreas, head and neck and other solid tumours, myeloproliferative disorders, such as leukemia, non- Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma, autoimmv e/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection, cardiovascular disorders, including hypertension, hypotension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, heart arrhythmia, and ischemia, neurological disorders including, central nervous system disease, Alzheimer's disease, Parkinson's disease, brain injury, stroke, amyotrophic lateral sclerosis,
  • the disease is a tumour, examples of which include Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis, lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas.
  • sarcomas of stomach and small intestine
  • Wilms tumour of kidney oncocytoma prostate cancer and also rheumatoid arthritis
  • lung carcinoma neuroendocrine and squamous cell carcinoma
  • seminoma of testis adenocarcinoma of colon and malignant lymphomas.
  • the disease may alternatively be one in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD).
  • IBD irritable bowel syndrome
  • COPD chronic obstructive pulmonary disease
  • regulating neutrophil function is of value in treating infections and wound healing.
  • the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide of the first aspect of the invention or the activity of a polypeptide of the first aspect of the invention in tissue from said patient and comparing said level of expression or activity to a control level, wherein a level that is different to said control level is indicative of disease.
  • a method will preferably be carried out in vitro.
  • Similar methods may be used for monitoring the therapeutic treatment of disease in a patient, wherein altering the level of expression or activity of a polypeptide or nucleic acid molecule over the period of time towards a control level is indicative of regression of disease.
  • a preferred method for detecting polypeptides of the first aspect of the invention comprises the steps of: (a) contacting a ligand, such as an antibody, of the sixth aspect of the invention with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex.
  • a ligand such as an antibody
  • the ligand of the sixth aspect of the invention may be any suitable ligand, such as an antibody, hormone or nucleic acid sequence.
  • the disease diagnosed by a method of the ninth aspect of the invention is a disease in which Nuclear Hormone Receptors are implicated, as described above.
  • a number of different such methods according to the ninth aspect of the invention exist, as the skilled reader will be aware, such as methods of nucleic acid hybridization with short probes, point mutation analysis, polymerase chain reaction (PCR) amplification and methods using antibodies to detect aberrant protein levels. Similar methods may be used on a short or long-term basis to allow therapeutic treatment of a disease to be monitored in a patient.
  • the invention also provides kits that are useful in these methods for diagnosing disease.
  • the invention provides for the use of a polypeptide of the first aspect of the invention, or a fragment thereof, as a Nuclear Hormone Receptor Ligand Binding Domain.
  • the invention also provides for the use of a nucleic acid molecule according to the second or third aspects of the invention to express a protein that possesses Nuclear Hormone Receptor Ligand Binding Domain activity.
  • the invention also provides a method for effecting Nuclear Hormone Receptor Ligand Binding Domain activity, said method utilising a polypeptide of the first aspect of the invention.
  • the invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell according to the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, in conjunction with a pharmaceutically-acceptable carrier.
  • the present invention provides a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell according to the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in the manufacture of a medicament for the diagnosis or treatment of a disease in which Nuclear Hormone Receptors are implicated, examples of which are given above.
  • the invention provides a method of treating a disease in a patient comprising administering to the patient a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, or a pharmaceutical composition of the eleventh aspect of the invention.
  • the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an agonist.
  • the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an antagonist. Examples of such antagonists include antisense nucleic acid molecules, ribozymes and ligands, such as antibodies.
  • the disease is a disease in which Nuclear Hormone Receptors are implicated, as described above.
  • the invention provides transgenic or knockout non-human animals that have been transformed to express higher, lower or absent levels of a polypeptide of the first aspect of the invention. Such transgenic animals are very useful models for the study of disease and may also be used in screening regimes for the identification of compounds that are effective in the treatment or diagnosis of such a disease.
  • the disease is a disease in which Nuclear Hormone Receptors are implicated, as described above.
  • polypeptide includes any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e. peptide isosteres. This term refers both to short chains (peptides and oligopeptides) and to longer chains (proteins).
  • the polypeptide of the present invention may be in the form of a mature protein or may be a pre-, pro- or prepro- protein that can be activated by cleavage of the pre-, pro- or prepro- portion to produce an active mature polypeptide.
  • the pre-, pro- or prepro- sequence may be a leader or secretory sequence or may be a sequence that is employed for purification of the mature polypeptide sequence.
  • the polypeptide of the first aspect of the invention may form part of a fusion protein.
  • a fusion protein may contain one or more additional amino acid sequences which may contain secretory or leader sequences, pro-sequences, sequences which aid in purification, or sequences that confer higher protein stability, for example during recombinant production.
  • the mature polypeptide may be fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol).
  • Polypeptides may contain amino acids other than the 20 gene-encoded amino acids, modified either by natural processes, such as by post-translational processing or by chemical modification techniques which are well known in the art.
  • modifications which may commonly be present in polypeptides of the present invention are glycosylation, lipid attachment, sulphation, gamma-carboxylation, for instance of glutamic acid residues, hydroxylation and ADP-ribosylation.
  • Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini.
  • blockage of the amino or carboxyl terminus in a polypeptide, or both, by a covalent modification is common in naturally-occurring and synthetic polypeptides and such modifications may be present in polypeptides of the present invention.
  • polypeptides that occur in a polypeptide often will be a function of how the polypeptide is made.
  • the nature and extent of the modifications in large part will be determined by the post-translational modification capacity of the particular host cell and the modification signals that are present in the amino acid sequence of the polypeptide in question. For instance, glycosylation patterns vary between different types of host cell.
  • the polypeptides of the present invention can be prepared in any suitable manner. Such polypeptides include isolated naturally-occurring polypeptides (for example purified from cell culture), recombinantly-produced polypeptides (including fusion proteins), synthetically-produced polypeptides or polypeptides that are produced by a combination of these methods.
  • the functionally-equivalent polypeptides of the first aspect of the invention may be polypeptides that are homologous to the LBDG14 polypeptide or the extended LBDG14 polypeptide.
  • Two polypeptides are said to be "homologous", as the term is used herein, if the sequence of one of the polypeptides has a high enough degree of identity or similarity to the sequence of the other polypeptide. "Identity” indicates that at any particular position in the aligned sequences, the amino acid residue is identical between the sequences. "Similarity” indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences.
  • Homologous polypeptides therefore include natural biological variants (for example, allelic variants or geographical variations within the species from which the polypeptides are derived) and mutants (such as mutants containing amino acid substitutions, insertions or deletions) of the LBDG14 polypeptide or the extended LBDG14 polypeptide.
  • Such mutants may include polypeptides in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code.
  • Typical such substitutions are among Ala, Val, Leu and He; among Ser and Thr; among the acidic residues Asp and Glu; among Asn and Gin; among the basic residues Lys and Arg; or among the aromatic residues Phe and Tyr.
  • Particularly preferred are variants in which several, i.e. between 5 and 10, 1 and 5, 1 and 3, 1 and 2 or just 1 amino acids are substituted, deleted or added in any combination.
  • silent substitutions, additions and deletions which do not alter the properties and activities of the protein. Also especially preferred in this regard are conservative substitutions.
  • Such mutants also include polypeptides in which one or more of the amino acid residues includes a substituent group.
  • polypeptides of the first aspect of the invention have a degree of sequence identity with the LBDG14 polypeptide or the extended LBDG14 polypeptide, or with active fragments thereof, of greater than 80%. More preferred polypeptides have degrees of identity of greater than 85%, 90%, 95%, 98% or 99%, respectively with the LBDG14 polypeptide or the extended LBDG14 polypeptide, or with active fragments thereof.
  • the functionally-equivalent polypeptides of the first aspect of the invention may also be polypeptides which have been identified using one or more techniques of structural alignment.
  • the Inpharmatica Genome ThreaderTM technology that forms one aspect of the search tools used to generate the Biopendium search database may be used (see PCT application published as WO 01/67507) to identify polypeptides of presently- unknown function which, while having low sequence identity as compared to the LBDG14 polypeptide or the extended LBDG14 polypeptide, are predicted to have Nuclear Hormone Receptor activity, by virtue of sharing significant structural homology with the LBDG14 polypeptide or the extended LBDG14 polypeptide sequence.
  • the Inpharmatica Genome ThreaderTM predicts two proteins, or protein regions, to share structural homology with a certainty of at least 10% more preferably, at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% and above.
  • the certainty value of the Inpharmatica Genome ThreaderTM is calculated as follows. A set of comparisons was initially performed using the Inpharmatica Genome ThreaderTM exclusively using sequences of known structure. Some of the comparisons were between proteins that were known to be related (on the basis of structure). A neural network was then trained on the basis that it needed to best distinguish between the known relationships and known not-relationships taken from the CATH structure classification (www.biochem.ucl.ac.uk/bsm/cath).
  • Structural homologues to the Ligand Binding Domain of LBDG14 should share structural homology with the LBDG14LBD region. Such structural homologues are predicted to have Nuclear Hormone Receptor Ligand Binding Domain activity by virtue of sharing significant structural homology with this polypeptide sequence.
  • the polypeptides of the first aspect of the invention also include fragments of the LBDG14 polypeptide or the extended LBDG14 polypeptide, functional equivalents of the fragments of the LBDG14 polypeptide or the extended LBDG14 polypeptide, and fragments of the functional equivalents of the LBDG14 polypeptides, provided that those functional equivalents and fragments retain Nuclear Hormone Receptor activity or have an antigenic determinant in common with the LBDG14 polypeptide or the extended LBDG14 polypeptide.
  • fragment refers to a polypeptide having an amino acid sequence that is the same as part, but not all, of the amino acid sequence of the LBDG14 polypeptide or the extended LBDG14 polypeptides or one of its functional equivalents.
  • the fragments should comprise at least n consecutive amino acids from the sequence and, depending on the particular sequence, n preferably is 7 or more (for example, 8, 10, 12, 14, 16, 18, 20 or more). Small fragments may form an antigenic determinant.
  • Preferred polypeptide fragments according to this aspect of the invention are fragments that include a region defined herein as the LBDG14LBD region of the LBDG14 polypeptide. This region is the region that has been annotated as a Nuclear Hormone Receptor Ligand Binding Domain. For the LBDG14 polypeptide, this region is considered to extend between residues 248-433. Variants of this fragment are included as embodiments of this aspect of the invention, provided that these variants possess activity as a Nuclear Hormone Receptor Ligand Binding Domain.
  • variable is meant to include extended or truncated versions of this polypeptide fragment.
  • the LBDG14LBD region of the LBDG14 polypeptide will fold correctly and show Nuclear Hormone Receptor Ligand Binding Domain activity if additional residues C terminal and/or N terminal of these boundaries in the LBDG14 polypeptide sequence are included in the polypeptide fragment.
  • additional 5, 10, 20, 30, 40 or even 50 or more amino acid residues from the LBDG14 polypeptide sequence, or from a homologous sequence may be included at either or both the C terminal and/or N terminal of the boundaries of the LBDG14LBD region of the LBDG14 polypeptide, without prejudicing the ability of the polypeptide fragment to fold correctly and exhibit Nuclear Hormone Receptor Ligand Binding Domain activity.
  • one or more amino acid residues may be deleted at either or both the C terminus or the N terminus of the LBDG14LBD region of the LBDG14 polypeptide.
  • the term "variant" includes homologues of the polypeptide fragments described above, that possess significant sequence homology with the Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide, provided that said variants retain activity as an Nuclear Hormone Receptor Ligand Binding Domain.
  • Homologues include those polypeptide molecules that possess greater than 30% identity with the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain regions, of the LBDG14 polypeptide or the extended LBDG14 polypeptides, respectively.
  • variant homologues of polypeptide fragments of this aspect of the invention have a degree of sequence identity with the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain regions, of the LBDG14 polypeptides, respectively, of greater than 40%.
  • variant polypeptides have degrees of identity of greater than 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99%, respectively with the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain regions of the LBDG14 polypeptide or the extended LBDG14 polypeptides, provided that said variants retain activity as a Nuclear Hormone Receptor Ligand Binding Domain.
  • variant polypeptides also include homologues of the truncated forms of the polypeptide fragments discussed above, provided that said variants retain activity as a Nuclear Hormone Receptor Ligand Binding Domain.
  • polypeptide fragments of the first aspect of the invention may be polypeptide fragments that exhibit significant structural homology with the structure of the polypeptide fragment defined by the LBDG14LBD region of the LBDG14 polypeptide sequence, for example, as identified by the Inpharmatica Genome ThreaderTM. Accordingly, polypeptide fragments that are structural homologues of the polypeptide fragments defined by the LBDG14LBD region of the LBDG14 polypeptide sequence should adopt the same fold as that adopted by this polypeptide fragment, as this fold is defined above. Such fragments may be "free-standing", t.e. not part of or fused to other amino acids or polypeptides, or they may be comprised within a larger polypeptide of which they form a part or region.
  • the fragment of the invention When comprised within a larger polypeptide, the fragment of the invention most preferably forms a single continuous region. For instance, certain preferred embodiments relate to a fragment having a pre- and/or pro- polypeptide region fused to the amino terminus of the fragment and/or an additional region fused to the carboxyl terminus of the fragment. However, several fragments may be comprised within a single larger polypeptide.
  • the polypeptides of the present invention or their immunogenic fragments can be used to generate ligands, such as polyclonal or monoclonal antibodies, that are immunospecific for the polypeptides.
  • ligands such as polyclonal or monoclonal antibodies
  • Such antibodies may be employed to isolate or to identify clones expressing the polypeptides of the invention or to purify the polypeptides by affinity chromatography.
  • the antibodies may also be employed as diagnostic or therapeutic aids, amongst other applications, as will be apparent to the skilled reader.
  • immunospecific means that the antibodies have substantially greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art.
  • antibody refers to intact molecules as well as to fragments thereof, such as Fab, F(ab')2 and Fv, which are capable of binding to the antigenic determinant in question. Such antibodies thus bind to the polypeptides of the first aspect of the invention.
  • substantially greater affinity we mean that there is a measurable increase in the affinity for a polypeptide of the invention as compared with the affinity for known Nuclear Hormone Receptors.
  • the affinity is at least 1.5-fold, 2-fold, 5-fold 10-fold, 100-fold, 10 3 -fold, 10 4 - fold, 10 5 -fold, 10 6 -fold or greater for a polypeptide of the invention than for known Nuclear Hormone Receptors.
  • a selected mammal such as a mouse, rabbit, goat or horse
  • a polypeptide of the first aspect of the invention may be immunised with a polypeptide of the first aspect of the invention.
  • the polypeptide used to immunise the animal can be derived by recombinant DNA technology or can be synthesized chemically.
  • the polypeptide can be conjugated to a carrier protein.
  • Commonly used carriers to which the polypeptides may be chemically coupled include bovine serum albumin, thyroglobulin and keyhole limpet haemocyanin.
  • the coupled polypeptide is then used to immunise the animal. Serum from the immunised animal is collected and treated according to known procedures, for example by immunoaffinity chromatography.
  • Monoclonal antibodies to the polypeptides of the first aspect of the invention can also be readily produced by one skilled in the art.
  • the general methodology for making monoclonal antibodies using hybridoma technology is well known (see, for example, Kohler, G. and Milstein, C, Nature 256: 495-497 (1975); Kozbor et al, Immunology Today 4: 72 (1983); Cole et al., 77-96 in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985).
  • Panels of monoclonal antibodies produced against the polypeptides of the first aspect of the invention can be screened for various properties, i.e., for isotype, epitope, affinity, etc. Monoclonal antibodies are particularly useful in purification of the individual polypeptides against which they are directed. Alternatively, genes encoding the monoclonal antibodies of interest may be isolated from hybridomas, for instance by PCR techniques known in the art, and cloned and expressed in appropriate vectors.
  • Chimeric antibodies in which non-human variable regions are joined or fused to human constant regions (see, for example, Liu et al, Proc. Natl. Acad. Sci. USA, 84, 3439 (1987)), may also be of use.
  • the antibody may be modified to make it less immunogenic in an individual, for example by humanisation (see Jones et al, Nature, 321, 522 (1986); Verhoeyen et al, Science, 239: 1534 (1988); Kabat et al, J. Immunol., 147: 1709 (1991); Queen et al, Proc. Natl Acad. Sci. USA, 86, 10029 (1989); Gorman et al, Proc. Natl Acad. Sci. USA, 88: 34181 (1991); and Hodgson et al, Bio/Technology 9: 421 (1991)).
  • humanisation see Jones et al, Nature, 321, 522 (1986); Verhoeyen et al, Science, 239: 1534 (1988); Kabat et al, J. Immunol., 147: 1709 (1991); Queen et al, Proc. Natl Acad. Sci. USA, 86, 10029 (1989); Gorman et
  • humanised antibody refers to antibody molecules in which the CDR amino acids and selected other amino acids in the variable domains of the heavy and/or light chains of a non-human donor antibody have been substituted in place of the equivalent amino acids in a human antibody.
  • the humanised antibody thus closely resembles a human antibody but has the binding ability of the donor antibody.
  • the antibody may be a "bispecific" antibody, that is an antibody having two different antigen-binding domains, each domain being directed against a different epitope.
  • Phage display technology may be utilised to select genes which encode antibodies with binding activities towards the polypeptides of the invention either from repertoires of PCR amplified V-genes of lymphocytes from humans screened for possessing the relevant antibodies, or from naive libraries (McCafferty, J. et al, (1990), Nature 348, 552-554; Marks, J. et al, (1992) Biotechnology 10, 779-783).
  • the affinity of these antibodies can also be improved by chain shuffling (Clackson, T. et al, (1991) Nature 352, 624-628).
  • Antibodies generated by the above techniques have additional utility in that they may be employed as reagents in immunoassays, radioimmunoassays (RIA) or enzyme-linked immunosorbent assays (ELISA).
  • the antibodies can be labelled with an analytically-detectable reagent such as a radioisotope, a fluorescent molecule or an enzyme.
  • Preferred nucleic acid molecules of the second and third aspects of the invention are those which encode the polypeptide sequence recited in SEQ ID NO:2, and functionally equivalent polypeptides, including active fragments of the LBDG14 polypeptide, such as a fragment including the LBDG14LBD region of the LBDG14 polypeptide sequence, or a homologue thereof. Nucleic acid molecules encompassing these stretches of sequence form a preferred embodiment of this aspect of the invention.
  • nucleic acid molecules may be used in the methods and applications described herein.
  • the nucleic acid molecules of the invention preferably comprise at least n consecutive nucleotides from the sequences disclosed herein where, depending on the particular sequence, n is 10 or more (for example, 12, 14, 15, 18, 20, 25, 30, 35, 40 or more).
  • nucleic acid molecules of the invention also include sequences that are complementary to nucleic acid molecules described above (for example, for antisense or probing purposes).
  • Nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance cDNA, synthetic DNA or genomic DNA. Such nucleic acid molecules may be obtained by cloning, by chemical synthetic techniques or by a combination thereof.
  • the nucleic acid molecules can be prepared, for example, by chemical synthesis using techniques such as solid phase phosphoramidite chemical synthesis, from genomic or cDNA libraries or by separation from an organism. RNA molecules may generally be generated by the in vitro or in vivo transcription of DNA sequences.
  • the nucleic acid molecules may be double-stranded or single-stranded.
  • Single-stranded DNA may be the coding strand, also known as the sense strand, or it may be the non- coding strand, also referred to as the anti-sense strand.
  • nucleic acid molecule also includes analogues of DNA and RNA, such as those containing modified backbones, and peptide nucleic acids (PNA).
  • PNA peptide nucleic acids
  • PNAs may be pegylated to extend their lifespan in a cell, where they preferentially bind complementary single stranded DNA and RNA and stop transcript elongation (Nielsen, P.E. et al. (1993) Anticancer Drug Des. 8:53-63).
  • a nucleic acid molecule which encodes the polypeptide of SEQ ID NO:2, or an active fragment thereof may be identical to the coding sequence of the nucleic acid molecule shown in SEQ ID NO:l.
  • a nucleic acid molecule which encodes the polypeptide of SEQ ID NO:32, or an active fragment thereof may be identical to the coding sequence of the nucleic acid molecule shown in SEQ ID NO:31.
  • These molecules also may have a different sequence which, as a result of the degeneracy of the genetic code, encodes the polypeptide SEQ ID NO:2, or an active fragment of the LBDG14 polypeptide, such as a fragment including the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region, or a homologue thereof.
  • the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region is considered to extend between residue 248 and residue 433 of the LBDG14 polypeptide sequence.
  • SEQ ID NO:l the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region is thus encoded by a nucleic acid molecule including nucleotide 742 to nucleotide 1299. Nucleic acid molecules encompassing this stretch of sequence, and homologues of this sequence, form a preferred embodiment of this aspect of the invention.
  • nucleic acid molecules that encode the polypeptide of SEQ ID NO:2 or SEQ ID NO:32 may include, but are not limited to, the coding sequence for the mature polypeptide by itself; the coding sequence for the mature polypeptide and additional coding sequences, such as those encoding a leader or secretory sequence, such as a pro-, pre- or prepro- polypeptide sequence; the coding sequence of the mature polypeptide, with or without the aforementioned additional coding sequences, together with further additional, non-coding sequences, including non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription (including termination signals), ribosome binding and mRNA stability.
  • the nucleic acid molecules may also include additional sequences which encode additional amino acids, such as those which provide additional functionalities.
  • the nucleic acid molecules of the second and third aspects of the invention may also encode the fragments or the functional equivalents of the polypeptides and fragments of the first aspect of the invention.
  • a preferred fragment of the LBDG14 polypeptide is a fragment including the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region, or a homologue thereof.
  • the Nuclear Hormone Receptor Ligand Binding Domain region is encoded by, at the most, a nucleic acid molecule including nucleotides 742 to 1299 of SEQ ID NO:l.
  • polynucleotide sequences which encode the Nuclear Hormone Receptor Ligand Binding Domain regions of the LBDG14 polypeptide will encode correctly folded LBDs that show Nuclear Hormone Receptor Ligand Binding Domain activity if additional residues 5' and/or 3' nucleotides terminal of these boundaries in the polynucleotide sequence are included in the polynucleotide fragment. For example, an additional 5, 15, 60, 90, 120 or even 150 or more nucleotides from the LBDG14 sequence may be included.
  • nucleic acid molecules according to the invention may be naturally-occurring variants such as a naturally-occurring allelic variant, or the molecules may be a variant that is not known to occur naturally.
  • Such non-naturally occurring variants of the nucleic acid molecule may be made by mutagenesis techniques, including those applied to nucleic acid molecules, cells or organisms.
  • variants in this regard are variants that differ from the aforementioned nucleic acid molecules by nucleotide substitutions, deletions or insertions.
  • the substitutions, deletions or insertions may involve one or more nucleotides.
  • the variants may be altered in coding or non-coding regions or both.
  • Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or insertions.
  • the nucleic acid molecules of the invention can also be engineered, using methods generally known in the art, for a variety of reasons, including modifying the cloning, processing, and/or expression of the gene product (the polypeptide).
  • DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides are included as techniques which may be used to engineer the nucleotide sequences.
  • Site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, introduce mutations and so forth.
  • Nucleic acid molecules which encode a polypeptide of the first aspect of the invention may be ligated to a heterologous sequence so that the combined nucleic acid molecule encodes a fusion protein.
  • Such combined nucleic acid molecules are included within the second or third aspects of the invention.
  • a fusion protein that can be recognised by a commercially-available antibody.
  • a fusion protein may also be engineered to contain a cleavage site located between the sequence of the polypeptide of the invention and the sequence of a heterologous protein so that the polypeptide may be cleaved and purified away from the heterologous protein.
  • the nucleic acid molecules of the invention also include antisense molecules that are partially complementary to nucleic acid molecules encoding polypeptides of the present invention and that therefore hybridize to the encoding nucleic acid molecules (hybridization).
  • antisense molecules such as oligonucleotides, can be designed to recognise, specifically bind to and prevent transcription of a target nucleic acid encoding a polypeptide of the invention, as will be known by those of ordinary skill in the art (see, for example, Cohen, J.S., Trends in Pharm. Sci., 10, 435 (1989), Okano, J. Neurochem. 56, 560 (1991); O'Connor, J. Neurochem 56, 560 (1991); Lee et al, Nucleic Acids Res 6, 3073 (1979); Cooney et al, Science 241, 456 (1988); Dervan et al, Science 251, 1360 (1991).
  • hybridization refers to the association of two nucleic acid molecules with one another by hydrogen bonding. Typically, one molecule will be fixed to a solid support and the other will be free in solution. Then, the two molecules may be placed in contact with one another under conditions that favour hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase molecule to the solid support (Denhardt's reagent or BLOTTO); the concentration of the molecules; use of compounds to increase the rate of association of molecules (dextran sulphate or polyethylene glycol); and the stringency of the washing conditions following hybridization (see Sambrook et al. [supra]).
  • the inhibition of hybridization of a completely complementary molecule to a target molecule may be examined using a hybridization assay, as known in the art (see, for example, Sambrook et al. [supra]).
  • a substantially homologous molecule will then compete for and inhibit the binding of a completely homologous molecule to the target molecule under various conditions of stringency, as taught in Wahl, G.M. and S.L. Berger (1987; Methods Enzymol. 152:399-407) and Kimmel, A.R. (1987; Methods Enzymol. 152:507-511).
  • Stringency refers to conditions in a hybridization reaction that favour the association of very similar molecules over association of molecules that differ.
  • High stringency hybridisation conditions are defined as overnight incubation at 42°C in a solution comprising 50% formamide, 5XSSC (150mM NaCl, 15mM trisodium citrate), 50mM sodium phosphate (pH7.6), 5x Denhardts solution, 10% dextran sulphate, and 20 microgram/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1X SSC at approximately 65°C.
  • Low stringency conditions involve the hybridisation reaction being carried out at 35°C (see Sambrook et al [supra).
  • the conditions used for hybridization are those of high stringency.
  • Preferred embodiments of this aspect of the invention are nucleic acid molecules that are at least 70% identical over their entire length to a nucleic acid molecule encoding the LBDG14 polypeptide (SEQ ID NO:2) or the extended LBDG14 polypeptide (SEQ ID NO:32), and nucleic acid molecules that are substantially complementary to such nucleic acid molecules.
  • a preferred active fragment is a fragment that includes the LBDG14LBD region of the LBDG14 polypeptide sequences, respectively.
  • nucleic acid molecules include those that are at least 70% identical over their entire length to a nucleic acid molecule encoding the LBDG14LBD region of the LBDG14 polypeptide sequence, wherein percentage identity is as determined using BLAST version 2.1.3 using the default parameters specified by the NCBI (the National Center for Biotechnology Information; http://www.ncbi.nlm.nih.gov/).
  • a nucleic acid molecule according to this aspect of the invention comprises a region that is at least 80% identical over its entire length to the nucleic acid molecule having the sequence given in SEQ ID NO:l, to a region including nucleotides 1486-2136 of this sequence, or a nucleic acid molecule that is complementary to any one of these regions of nucleic acid.
  • nucleic acid molecules at least 90%, preferably at least 95%, more preferably at least 98% or 99% identical over their entire length to the same are particularly preferred.
  • Preferred embodiments in this respect are nucleic acid molecules that encode polypeptides which retain Nuclear Hormone Receptor Ligand Binding Domain activity.
  • the invention also provides a process for detecting a nucleic acid molecule of the invention, comprising the steps of: (a) contacting a nucleic probe according to the invention with a biological sample under hybridizing conditions to form duplexes; and (b) detecting any such duplexes that are formed.
  • a nucleic acid molecule as described above may be used as a hybridization probe for RNA, cDNA or genomic DNA, in order to isolate full-length cDNAs and genomic clones encoding the LBDG14 polypeptide and to isolate cDNA and genomic clones of homologous or orthologous genes that have a high sequence similarity to the gene encoding this polypeptide.
  • the sequencing process may be automated using machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), the Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) and the ABI Catalyst and 373 and 377 DNA Sequencers (Perkin Elmer).
  • machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), the Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) and the ABI Catalyst and 373 and 377 DNA Sequencers (Perkin Elmer).
  • One method for isolating a nucleic acid molecule encoding a polypeptide with an equivalent function to that of the LBDG14 polypeptide, particularly with an equivalent function to the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide is to probe a genomic or cDNA library with a natural or artificially-designed probe using standard procedures that are recognised in the art (see, for example, "Current Protocols in Molecular Biology", Ausubel et al. (eds). Greene Publishing Association and John Wiley Interscience, New York, 1989,1992).
  • Probes comprising at least 15, preferably at least 30, and more preferably at least 50, contiguous bases that correspond to, or are complementary to, nucleic acid sequences from the appropriate encoding gene (SEQ ID NO:l), particularly a region from nucleotides 742- 1299 of SEQ ID NO: 1 , are particularly useful probes. Such probes may be labelled with an analytically-detectable reagent to facilitate their identification.
  • Useful reagents include, but are not limited to, radioisotopes, fluorescent dyes and enzymes that are capable of catalysing the formation of a detectable product.
  • probes the ordinarily skilled artisan will be capable of isolating complementary copies of genomic DNA, cDNA or RNA polynucleotides encoding proteins of interest from human, mammalian or other animal sources and screening such sources for related sequences, for example, for additional members of the family, type and/or subtype.
  • isolated cDNA sequences will be incomplete, in that the region encoding the polypeptide will be cut short, normally at the 5' end.
  • Several methods are available to obtain full length cDNAs, or to extend short cDNAs. Such sequences may be extended utilising a partial nucleotide sequence and employing various methods known in the art to detect upstream sequences such as promoters and regulatory elements. For example, one method which may be employed is based on the method of Rapid Amplification of cDNA Ends (RACE; see, for example, Frohman et al, Proc. Natl. Acad. Sci. USA (1988) 85: 8998-9002).
  • RACE Rapid Amplification of cDNA Ends
  • Another method which may be used is capture PCR which involves PCR amplification of DNA fragments adjacent a known sequence in human and yeast artificial chromosome DNA (Lagerstrom, M. et al (1991) PCR Methods Applic. 1: 111-119). Another method which may be used to retrieve unknown sequences is that of Parker, J.D. et al (1991); Nucleic Acids Res. 19:3055- 3060). Additionally, one may use PCR, nested primers, and PromoterFinderTM libraries to walk genomic DNA (Clontech, Palo Alto, CA). This process avoids the need to screen libraries and is useful in finding intron/exon junctions.
  • nucleic acid molecules of the present invention may be used for chromosome localisation. In this technique, a nucleic acid molecule is specifically targeted to, and can hybridize with, a particular location on an individual human chromosome.
  • mapping of relevant sequences to chromosomes is an important step in the confirmatory correlation of those sequences with the gene-associated disease.
  • the physical position of the sequence on the chromosome can be correlated with genetic map data.
  • genetic map data are found in, for example, V. McKusick, Mendelian Inheritance in Man (available on-line through Johns Hopkins University Welch Medical Library).
  • the relationships between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes). This provides valuable information to investigators searching for disease genes using positional cloning or other gene discovery techniques.
  • any sequences mapping to that area may represent associated or regulatory genes for further investigation.
  • the nucleic acid molecule may also be used to detect differences in the chromosomal location due to translocation, inversion, etc. among normal, carrier, or affected individuals.
  • the nucleic acid molecules of the present invention are also valuable for tissue localisation.
  • Such techniques allow the determination of expression patterns of the polypeptide in tissues by detection of the mRNAs that encode them.
  • These techniques include in situ hybridization techniques and nucleotide amplification techniques, such as PCR. Results from these studies provide an indication of the normal functions of the polypeptide in the organism.
  • comparative studies of the normal expression pattern of mRNAs with that of mRNAs encoded by a mutant gene provide valuable insights into the role of mutant polypeptides in disease. Such inappropriate expression may be of a temporal, spatial or quantitative nature.
  • Gene silencing approaches may also be undertaken to down-regulate endogenous expression of a gene encoding a polypeptide of the invention.
  • RNA interference (Elbashir, SM et al. , Nature 2001, 411, 494-498) is one method of sequence specific post- transcriptional gene silencing that may be employed. Short dsRNA oligonucleotides are synthesised in vitro and introduced into a cell. The sequence specific binding of these dsRNA oligonucleotides triggers the degradation of target mRNA, reducing or ablating target protein expression.
  • Efficacy of the gene silencing approaches assessed above may be assessed through the measurement of polypeptide expression (for example, by Western blotting), and at the RNA level using TaqMan-based methodologies.
  • the vectors of the present invention comprise nucleic acid molecules of the invention and may be cloning or expression vectors.
  • the host cells of the invention which may be transformed, transfected or transduced with the vectors of the invention may be prokaryotic or eukaryotic.
  • the polypeptides of the invention may be prepared in recombinant form by expression of their encoding nucleic acid molecules in vectors contained within a host cell. Such expression methods are well known to those of skill in the art and many are described in detail by Sambrook et al. (supra) and Fernandez & Hoeffler (1998, eds. "Gene expression systems. Using nature for the art of expression”. Academic Press, San Diego, London, Boston, New York, Sydney, Tokyo, Toronto).
  • any system or vector that is suitable to maintain, propagate or express nucleic acid molecules to produce a polypeptide in the required host may be used.
  • the appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-known and routine techniques, such as, for example, those described in Sambrook et al, (supra).
  • the encoding gene can be placed under the control of a control element such as a promoter, ribosome binding site (for bacterial expression) and, optionally, an operator, so that the DNA sequence encoding the desired polypeptide is transcribed into RNA in the transformed host cell.
  • suitable expression systems include, for example, chromosomal, episomal and virus-derived systems, including, for example, vectors derived from: bacterial plasmids, bacteriophage, transposons, yeast episomes, insertion elements, yeast chromosomal elements, viruses such as baculoviruses, papova viruses such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, or combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, including cosmids and phagemids.
  • Human artificial chromosomes may also be employed to deliver larger fragments of DNA than can be contained and expressed in a plasmid.
  • Particularly suitable expression systems include microorgamsms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (for example, baculo virus); plant cell systems transformed with virus expression vectors (for example, cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (for example, Ti or pBR322 plasmids); or animal cell systems.
  • Cell-free translation systems can also be employed to produce the polypeptides of the invention.
  • nucleic acid molecules encoding a polypeptide of the present invention into host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al, Basic Methods in Molecular Biology (1986) and Sambrook et al, [supra]. Particularly suitable methods include calcium phosphate transfection, DEAE-dextran mediated transfection, fransvection, microinjection, cationic lipid- mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection (see Sambrook et al, 1989 [supra]; Ausubel et al, 1991 [supra]; Spector, Goldman & Leinwald, 1998). In eukaryotic cells, expression systems may either be transient (for example, episomal) or permanent (chromosomal integration) according to the needs of the system.
  • the encoding nucleic acid molecule may or may not include a sequence encoding a control sequence, such as a signal peptide or leader sequence, as desired, for example, for secretion of the translated polypeptide into the lumen of the endoplasmic reticulum, into the periplasmic space or into the extracellular environment.
  • a control sequence such as a signal peptide or leader sequence
  • These signals may be endogenous to the polypeptide or they may be heterologous signals.
  • Leader sequences can be removed by the bacterial host in post-translational processing.
  • regulatory sequences that allow for regulation of the expression of the polypeptide relative to the growth of the host cell.
  • regulatory sequences are those which cause the expression of a gene to be increased or decreased in response to a chemical or physical stimulus, including the presence of a regulatory compound or to various temperature or metabolic conditions.
  • Regulatory sequences are those non-translated regions of the vector, such as enhancers, promoters and 5' and 3' untranslated regions. These interact with host cellular proteins to carry out transcription and translation. Such regulatory sequences may vary in their strength and specificity. Depending on the vector system and host utilised, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used.
  • inducible promoters such as the hybrid lacZ promoter of the Bluescript phagemid (Stratagene, LaJolla, CA) or pSportlTM plasmid (Gibco BRL) and the like may be used.
  • the baculovirus polyhedrin promoter may be used in insect cells. Promoters or enhancers derived from the genomes of plant cells (for example, heat shock, RUBISCO and storage protein genes) or from plant viruses (for example, viral promoters or leader sequences) may be cloned into the vector. In mammalian cell systems, promoters from mammalian genes or from mammalian viruses are preferable. If it is necessary to generate a cell line that contains multiple copies of the sequence, vectors based on SV40 or EBV may be used with an appropriate selectable marker.
  • An expression vector is constructed so that the particular nucleic acid coding sequence is located in the vector with the appropriate regulatory sequences, the positioning and orientation of the coding sequence with respect to the regulatory sequences being such that the coding sequence is transcribed under the "control" of the regulatory sequences, i.e., RNA polymerase which binds to the DNA molecule at the control sequences transcribes the coding sequence.
  • control sequences i.e., RNA polymerase which binds to the DNA molecule at the control sequences transcribes the coding sequence.
  • control sequences and other regulatory sequences may be ligated to the nucleic acid coding sequence prior to insertion into a vector.
  • the coding sequence can be cloned directly into an expression vector that already contains the control sequences and an appropriate restriction site.
  • stable expression is preferred.
  • cell lines which stably express the polypeptide of interest may be transformed using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
  • the purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences.
  • Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type.
  • Mammalian cell lines available as hosts for expression are known in the art and include many immortalised cell lines available from the American Type Culture Collection (ATCC) including, but not limited to, Chinese hamster ovary (CHO), HeLa, baby hamster kidney (BHK), monkey kidney (COS), C127, 3T3, BHK, HEK 293, Bowes melanoma and human hepatocellular carcinoma (for example Hep G2) cells and a number of other cell lines.
  • ATCC American Type Culture Collection
  • the materials for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego CA (the "MaxBac” kit). These techniques are generally known to those skilled in the art and are described fully in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987). Particularly suitable host cells for use in this system include insect cells such as Drosophila S2 and Spodoptera Sf9 cells.
  • all plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be utilised, so that whole plants are recovered which contain the transferred gene.
  • Practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugar cane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
  • Examples of particularly preferred bacterial host cells include streptococci, staphylococci, E. coli, Streptomyces and Bacillus subtilis cells.
  • yeast cells for example, S. cerevisiae
  • Asperg ⁇ llus cells examples of particularly suitable host cells for fungal expression include yeast cells (for example, S. cerevisiae) and Asperg ⁇ llus cells.
  • any number of selection systems are known in the art that may be used to recover transformed cell lines. Examples include the herpes simplex virus thymidine kinase (Wigler, M. et al (1977) Cell 11:223-32) and adenine phosphoribosylfransferase (Lowy, I. et al. (1980) Cell 22:817-23) genes that can be employed in tk " or anx cells, respectively.
  • antimetabolite, antibiotic or herbicide resistance can be used as the basis for selection; for example, dihydrofolate reductase (DHFR) that confers resistance to methotrexate (Wigler, M. et ⁇ l. (1980) Proc. Natl. Acad. Sci. 77:3567-70); npt, which confers resistance to the aminoglycosides neomycin and G-418 (Colbere-Garapin, F. et ⁇ l. (1981) J. Mol. Biol. 150:1-14) and als or pat, which confer resistance to chlorsulfuron and phosphinotricin acetyltransferase, respectively. Additional selectable genes have been described, examples of which will be clear to those of skill in the art.
  • marker gene expression suggests that the gene of interest is also present, its presence and expression may need to be confirmed.
  • a marker gene can be placed in tandem with a sequence encoding a polypeptide of the invention under the control of a single promoter. Expression of the marker gene in response to induction or selection usually indicates expression of the tandem gene as well.
  • host cells that contain a nucleic acid sequence encoding a polypeptide of the invention and which express said polypeptide may be identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA-DNA or DNA-RNA hybridizations and protein bioassays, for example, fluorescence activated cell sorting (FACS) or immunoassay techniques (such as the enzyme-linked immunosorbent assay [ELISA] and radioimmunoassay [RIA]), that include membrane, solution, or chip based technologies for the detection and/or quantification of nucleic acid or protein (see Hampton, R. et al. (1990) Serological Methods, a Laboratory Manual, APS Press, St Paul, MN) and Maddox, D.E. et al. (1983) J. Exp. Med, 158, 1211-1216).
  • FACS fluorescence activated cell sorting
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • Means for producing labelled hybridization or PCR probes for detecting sequences related to nucleic acid molecules encoding polypeptides of the present invention include oligolabelling, nick translation, end-labelling or PCR amplification using a labelled polynucleotide.
  • sequences encoding the polypeptide of the invention may be cloned into a vector for the production of an mRNA probe.
  • RNA polymerase such as T7, T3 or SP6 and labelled nucleotides. These procedures may be conducted using a variety of commercially available kits (Pharmacia & Upjohn, (Kalamazoo, MI); Promega (Madison WI); and U.S. Biochemical Corp., Cleveland, OH)).
  • Suitable reporter molecules or labels include radionuclides, enzymes and fluorescent, chemiluminescent or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
  • Nucleic acid molecules according to the present invention may also be used to create transgenic animals, particularly rodent animals. Such transgenic animals form a further aspect of the present invention. This may be done locally by modification of somatic cells, or by germ line therapy to incorporate heritable modifications. Such transgenic animals may be particularly useful in the generation of animal models for drug molecules effective as modulators of the polypeptides of the present invention.
  • the polypeptide can be recovered and purified from recombinant cell cultures by well- known methods including ammonium sulphate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography is particularly useful for purification. Well known techniques for refolding proteins may be employed to regenerate an active conformation when the polypeptide is denatured during isolation and or purification.
  • Specialised vector constructions may also be used to facilitate purification of proteins, as desired, by joining sequences encoding the polypeptides of the invention to a nucleotide sequence encoding a polypeptide domain that will facilitate purification of soluble proteins.
  • purification-facilitating domains include metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilised metals, protein A domains that allow purification on immobilised immunoglobulin, and the domain utilised in the FLAGS extension/affinity purification system (Immunex Corp., Seattle, WA).
  • cleavable linker sequences such as those specific for Factor XA or enterokinase (Invitrogen, San Diego, CA) between the purification domain and the polypeptide of the invention may be used to facilitate purification.
  • One such expression vector provides for expression of a fusion protein containing the polypeptide of the invention fused to several histidine residues preceding a thioredoxin or an enterokinase cleavage site. The histidine residues facilitate purification by IMAC (immobilised metal ion affinity chromatography as described in Porath, J. et al. (1992) Prot. Exp. Purif.
  • the polypeptide is to be expressed for use in screening assays, generally it is preferred that it be produced at the surface of the host cell in which it is expressed. In this event, the host cells may be harvested prior to use in the screening assay, for example using techniques such as fluorescence activated cell sorting (FACS) or immunoaffinity techniques. If the polypeptide is secreted into the medium, the medium can be recovered in order to recover and purify the expressed polypeptide. If polypeptide is produced intracellularly, the cells must first be lysed before the polypeptide is recovered.
  • FACS fluorescence activated cell sorting
  • the polypeptide of the invention can be used to screen libraries of compounds in any of a variety of drug screening techniques. Such compounds may activate (agonise) or inhibit (antagonise) the level of expression of the gene or the activity of the polypeptide of the invention and form a further aspect of the present invention. Preferred compounds are effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the first aspect of the invention.
  • Agonist or antagonist compounds may be isolated from, for example, cells, cell-free preparations, chemical libraries or natural product mixtures. These agonists or antagonists may be natural or modified substrates, ligands, enzymes, receptors or structural or functional mimetics. For a suitable review of such screening techniques, see Coligan et al, Current Protocols in Immunology l(2):Chapter 5 (1991).
  • Compounds that are most likely to be good agonists and antagonists are molecules that bind to the polypeptide of the invention modulating the biological effects of the polypeptide upon binding to it.
  • Potential agonists and antagonists include small organic molecules, peptides, polypeptides and antibodies that bind to the polypeptide of the invention and thereby activate, inhibit or extinguish its activity.
  • a low molecular weight compound representative of retinoid modulators has been demonstrated herein to activate with high affinity to the polypeptides of the invention. In this fashion, binding of the polypeptide to normal cellular binding molecules may be modulated, such that the normal biological activity of the polypeptide is enhanced, or decreased for therapeutic utility.
  • the functional effects for the nuclear receptor gene family are typically modified by ligands, either with transcription being upregulated or downregulated by addition of a ligand.
  • ligands may either be therapeutic agents themselves, or form the basis for novel therapeutic agents.
  • the set of ligands that known nuclear receptor ligand binding domains interact with include, but are not limited by, steroid, fatty acid, vitamins, and similar molecules. Modulation of the transcriptional activity of nuclear receptors by such ligand is thus indicative of their functional activity.
  • the polypeptide of the invention that is employed in such a screening technique may be free in solution, affixed to a solid support, borne on a cell surface or located intracellularly.
  • screening procedures may involve using appropriate cells or cell membranes that express the polypeptide that are contacted with a test compound to observe binding, or stimulation or inhibition of a functional response.
  • the functional response of the cells contacted with the test compound is then compared with control cells that were not contacted with the test compound.
  • Such an assay may assess whether the test compound results in a signal generated by activation of the polypeptide, using an appropriate detection system.
  • Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist in the presence of the test compound is observed.
  • a particular example is cotransfecting a construct expressing a polypeptide according to the invention, or a fragment such as the LBD, in fusion with the GAL4 DNA binding domain, into a cell together with a reporter plasmid, an example of which is pFR-Luc (Stratagene Europe, Amsterdam, The Netherlands).
  • This particular plasmid contains a synthetic promoter with five tandem repeats of GAL4 binding sites that control the expression of the luciferase gene. When a potential ligand is added to the cells, it will bind the GAL4-polypeptide fusion and induce transcription of the luciferase gene.
  • a further preferred method for identifying an agonist or antagonist of a polypeptide of the invention comprises:
  • a method such as FRET detection of a ligand bound to the polypeptide in the presence of peptide co-activators might be used.
  • the general methods that are described above may further comprise conducting the identification of agonist or antagonist in the presence of labelled or unlabelled ligand for the polypeptide.
  • the method for identifying agonist or antagonist of a polypeptide of the present invention comprises: determining the inhibition of binding of a ligand to the polypeptide of the invention on any solid or cellular surface thereof, in the presence of a candidate compound under conditions to permit binding to the polypeptide, and determining the amount of ligand bound to the polypeptide.
  • a compound capable of causing reduction of binding of a ligand is considered to be a competitor which may act as an agonist or antagonist.
  • the ligand is labelled.
  • a method of screening for a polypeptide antagonist or agonist compound comprises the steps of: (a) incubating a labelled ligand with a polypeptide according to the invention on any solid support or the cell surface, or a cell membrane containing a polypeptide of the invention.
  • step (c) adding a candidate compound to a mixture of labelled ligand and immobilized polypeptide on the solid support, the whole cell or the cell membrane of step (a) and allowing the mixture to attain equilibrium;
  • step (d) measuring the amount of labelled ligand bound to the immobilized polypeptide or the whole cell or the cell membrane after step (c);
  • step (e) comparing the difference in the labelled ligand bound in step (b) and (d), such that the compound which causes the reduction in binding in step (d) is considered to be an agonist or antagonist.
  • polypeptides may be found to modulate a variety of physiological and pathological processes in a dose-dependent manner in the above-described assays.
  • the "functional equivalents" of the polypeptides of the invention include polypeptides that exhibit any of the same modulatory activities in the above-described assays in a dose- dependent manner.
  • the degree of dose-dependent activity need not be identical to that of the polypeptides of the invention, preferably the "functional equivalents" will exhibit substantially similar dose-dependence in a given activity assay compared to the polypeptides of the invention.
  • simple binding assays may be used, in which the adherence of a test compound to a surface bearing the polypeptide is detected by means of a label directly or indirectly associated with the test compound or in an assay involving competition with a labelled competitor.
  • competitive drug screening assays may be used, in which neutralising antibodies that are capable of binding the polypeptide specifically compete with a test compound for binding. In this manner, the antibodies can be used to detect the presence of any test compound that possesses specific binding affinity for the polypeptide.
  • Assays may also be designed to detect the effect of added test compounds on the production of mRNA encoding the polypeptide in cells.
  • an ELIS A may be constructed that measures secreted or cell-associated levels of polypeptide using monoclonal or polyclonal antibodies by standard methods known in the art, and this can be used to search for compounds that may inhibit or enhance the production of the polypeptide from suitably manipulated cells or tissues. The formation of binding complexes between the polypeptide and the compound being tested may then be measured.
  • Assay methods that are also included within the terms of the present invention are those that involve the use of the genes and polypeptides of the invention in overexpression or ablation assays. Such assays involve the manipulation of levels of these genes/polypeptides in cells and assessment of the impact of this manipulation event on the physiology of the manipulated cells. For example, such experiments reveal details of signalling and metabolic pathways in which the particular genes/polypeptides are implicated, generate information regarding the identities of polypeptides with which the studied polypeptides interact and provide clues as to methods by which related genes and proteins are regulated.
  • Another technique for drug screening which may be used provides for high throughput screening of compounds having suitable binding affinity to the polypeptide of interest (see International patent application WO84/03564).
  • This method large numbers of different small test compounds are synthesised on a solid substrate, which may then be reacted with the polypeptide of the invention and washed.
  • One way of immobilising the polypeptide is to use non-neutralising antibodies. Bound polypeptide may then be detected using methods that are well known in the art. Purified polypeptide can also be coated directly onto plates for use in the aforementioned drug screening techniques.
  • the polypeptide of the invention may be used to identify membrane-bound or soluble receptors, through standard receptor binding techniques that are known in the art, such as ligand binding and crosslinking assays in which the polypeptide is labelled with a radioactive isotope, is chemically modified, or is fused to a peptide sequence that facilitates its detection or purification, and incubated with a source of the putative receptor (for example, a composition of cells, cell membranes, cell supematants, tissue extracts, or bodily fluids).
  • a source of the putative receptor for example, a composition of cells, cell membranes, cell supematants, tissue extracts, or bodily fluids.
  • the efficacy of binding may be measured using biophysical techniques such as surface plasmon resonance (supplied by Biacore AB, Uppsala, Sweden) and spectroscopy. Using such assays, it will be possible to investigate the degree to which polypeptides of the invention dimerise or oligome
  • Binding assays may be used for the purification and cloning of the receptor, but may also identify agonists and antagonists of the polypeptide, that compete with the binding of the polypeptide to its receptor. Standard methods for conducting screening assays are well understood in the art.
  • the invention also includes a screening kit useful in the methods for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, that are described above.
  • the invention includes the agonists, antagonists, ligands, receptors, substrates and enzymes, and other compounds which modulate the activity or antigenicity of the polypeptide of the invention discovered by the methods that are described above.
  • compositions comprising a polypeptide, nucleic acid, ligand or compound of the invention in combination with a suitable pharmaceutical carrier.
  • suitable pharmaceutical carrier may be suitable as therapeutic or diagnostic reagents, as vaccines, or as other immunogenic compositions, as outlined in detail below.
  • a composition containing a polypeptide, nucleic acid, ligand or compound [X] is "substantially free of impurities [herein, Y] when at least 85% by weight of the total X+Y in the composition is X.
  • X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95%, 98% or even 99% by weight.
  • compositions should preferably comprise a therapeutically effective amount of the polypeptide, nucleic acid molecule, ligand, or compound of the invention.
  • therapeutically effective amount refers to an amount of a therapeutic agent needed to treat, ameliorate, or prevent a targeted disease or condition, or to exhibit a detectable therapeutic or preventative effect.
  • the therapeutically effective dose can be estimated initially either in cell culture assays, for example, of neoplastic cells, or in animal models, usually mice, rabbits, dogs, or pigs. The animal model may also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
  • an effective amount for a human subject will depend upon the severity of the disease state, general health of the subject, age, weight, and gender of the subject, diet, time and frequency of administration, drug combination(s), reaction sensitivities, and tolerance/response to therapy. This amount can be determined by routine experimentation and is within the judgement of the clinician. Generally, an effective dose will be from 0.01 mg/kg to 50 mg/kg, preferably 0.05 mg/kg to 10 mg/kg.
  • Compositions may be administered individually to a patient or may be administered in combination with other agents, drugs or hormones.
  • a pharmaceutical composition may also contain a pharmaceutically acceptable carrier, for administration of a therapeutic agent.
  • Such carriers include antibodies and other polypeptides, genes and other therapeutic agents such as liposomes, provided that the carrier does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
  • Suitable carriers may be large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
  • Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like
  • organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • Pharmaceutically acceptable carriers in therapeutic compositions may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for ingestion by the patient.
  • compositions of the invention can be administered directly to the subject.
  • the subjects to be treated can be animals; in particular, human subjects can be treated.
  • compositions utilised in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra- arterial, intramedullary, intrathecal, intraventricular, transdermal or transcutaneous applications (for example, see WO98/20734), subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal means.
  • Gene guns or hyposprays may also be used to administer the pharmaceutical compositions of the invention.
  • the therapeutic compositions may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
  • Direct delivery of the compositions will generally be accomplished by injection, subcutaneously, intraperitoneally, intravenously or intramuscularly, or delivered to the interstitial space of a tissue.
  • the compositions can also be administered into a lesion. Dosage treatment may be a single dose schedule or a multiple dose schedule. If the activity of the polypeptide of the invention is in excess in a particular disease state, several approaches are available.
  • One approach comprises administering to a subject an inhibitor compound (antagonist) as described above, along with a pharmaceutically acceptable carrier in an amount effective to inhibit the function of the polypeptide, such as by blocking the binding of ligands, substrates, enzymes, receptors, or by inhibiting a second signal, and thereby alleviating the abnormal condition.
  • such antagonists are antibodies. Most preferably, such antibodies are chimeric and/or humanised to minimise their immunogenicity, as described previously.
  • polypeptide that retain binding affinity for the ligand, substrate, enzyme, receptor, in question, may be administered.
  • polypeptide may be administered in the form of fragments that retain the relevant portions.
  • expression of the gene encoding the polypeptide can be inhibited using expression blocking techniques, such as the use of antisense nucleic acid molecules (as described above), either internally generated or separately administered.
  • Modifications of gene expression can be obtained by designing complementary sequences or antisense molecules (DNA, RNA, or PNA) to the control, 5' or regulatory regions (signal sequence, promoters, enhancers and introns) of the gene encoding the polypeptide.
  • inhibition can be achieved using "triple helix" base-pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or regulatory molecules.
  • the complementary sequence or antisense molecule may also be designed to block translation of mRNA by preventing the transcript from binding to ribosomes.
  • Such oligonucleotides may be administered or may be generated in situ from expression in vivo.
  • Ribozymes are catalytically active RNAs that can be natural or synthetic (see for example Usman, N, et al, Curr. Opin. Struct. Biol (1996) 6(4), 527-33). Synthetic ribozymes can be designed to specifically cleave mRNAs at selected positions thereby preventing translation of the mRNAs into functional polypeptide. Ribozymes may be synthesised with a natural ribose phosphate backbone and natural bases, as normally found in RNA molecules. Alternatively the ribozymes may be synthesised with non-natural backbones, for example, 2'-O-methyl RNA, to provide protection from ribonuclease degradation and may contain modified bases.
  • RNA molecules may be modified to increase intracellular stability and half-life. Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends of the molecule or the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages within the backbone of the molecule. This concept is inherent in the production of PNAs and can be extended in all of these molecules by the inclusion of non-traditional bases such as inosine, queosine and butosine, as well as acetyl-, methyl-, thio- and similarly modified forms of adenine, cytidine, guanine, thymine and uridine which are not as easily recognised by endogenous endonucleases.
  • One approach comprises administering to a subject a therapeutically effective amount of a compound that activates the polypeptide, i.e., an agonist as described above, to alleviate the abnormal condition.
  • a therapeutic amount of the polypeptide in combination with a suitable pharmaceutical carrier may be administered to restore the relevant physiological balance of polypeptide.
  • Gene therapy may be employed to effect the endogenous production of the polypeptide by the relevant cells in the subject. Gene therapy is used to treat permanently the inappropriate production of the polypeptide by replacing a defective gene with a corrected therapeutic gene.
  • Gene therapy of the present invention can occur in vivo or ex vivo.
  • Ex vivo gene therapy requires the isolation and purification of patient cells, the introduction of a therapeutic gene and introduction of the genetically altered cells back into the patient.
  • in vivo gene therapy does not require isolation and purification of a patient's cells.
  • the therapeutic gene is typically "packaged" for administration to a patient.
  • Gene delivery vehicles may be non-viral, such as liposom.es, or replication-deficient viruses, such as adenovirus as described by Berkner, K.L., in Curr. Top. Microbiol.
  • a nucleic acid molecule encoding a polypeptide of the invention may be engineered for expression in a replication-defective retroviral vector. This expression construct may then be isolated and introduced into a packaging cell transduced with a retroviral plasmid vector containing RNA encoding the polypeptide, such that the packaging cell now produces infectious viral particles containing the gene of interest.
  • producer cells may be administered to a subject for engineering cells in vivo and expression of the polypeptide in vivo (see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics (1996), T Strachan and A P Read, BIOS Scientific Publishers Ltd).
  • Another approach is the administration of "naked DNA" in which the therapeutic gene is directly injected into the bloodstream or muscle tissue.
  • the invention provides that they can be used in vaccines to raise antibodies against the disease causing agent.
  • Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat disease after infection).
  • Such vaccines comprise immunising antigen(s), immunogen(s), polypeptide(s), protein(s) or nucleic acid, usually in combination with pharmaceutically-acceptable carriers as described above, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Additionally, these carriers may function as immunostimulating agents ("adjuvants").
  • the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, and other pathogens.
  • vaccines comprising polypeptides are preferably administered parenterally (for instance, subcutaneous, intramuscular, intravenous, or intradermal injection).
  • parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents.
  • the vaccine formulations of the invention may be presented in unit-dose or multi-dose containers. For example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use. The dosage will depend on the specific activity of the vaccine and can be readily determined by routine experimentation.
  • jet injection see, for example, www.powderject.com
  • jet injection may also be useful in the formulation of vaccine compositions.
  • This invention also relates to the use of nucleic acid molecules according to the present invention as diagnostic reagents. Detection of a mutated form of the gene characterised by the nucleic acid molecules of the invention which is associated with a dysfunction will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, or susceptibility to a disease, which results from under-expression, over-expression or altered spatial or temporal expression of the gene. Individuals carrying mutations in the gene may be detected at the DNA level by a variety of techniques. Nucleic acid molecules for diagnosis may be obtained from a subject's cells, such as from blood, urine, saliva, tissue biopsy or autopsy material.
  • the genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR, ligase chain reaction (LCR), strand displacement amplification (SDA), or other amplification techniques (see Saiki et al, Nature, 324, 163-166 (1986); Bej, et al, Crit. Rev. Biochem. Molec. Biol., 26, 301-334 (1991); Birkenmeyer et al, J. Virol. Meth., 35, 117-126 (1991); Van Brunt, J., Bio/Technology, 8, 291-294 (1990)) prior to analysis.
  • LCR ligase chain reaction
  • SDA strand displacement amplification
  • this aspect of the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide according to the invention and comparing said level of expression to a control level, wherein a level that is different to said control level is indicative of disease.
  • the method may comprise the steps of: a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule of the invention and the probe; b) contacting a control sample with said probe under the same conditions used in step a); c) and detecting the presence of hybrid complexes in said samples; wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
  • a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule of the invention and the probe b) contacting a control sample with said probe under the same conditions used in step a); c) and detecting the presence of hybrid complexes in said samples; wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
  • transcripts of this gene are altered in a variety of tumour types. Identifying the tumour types that possess elevated or suppressed LBDG14 transcript levels may be of value in diagnostics for particular cancer subtypes and thereby, define the particular therapeutic approach for individual patients. In addition, development of agonists and antagonists for LDBG14 will be of value in treating cancer. The finding of an elevation of LBDG14 transcripts in activated monrophils suggests that this nuclear receptor is involved in regulating neutrophil function.
  • agonists and antagonists will be of value in treating disease conditions in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD).
  • infections particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD);
  • a further aspect of the invention comprises a diagnostic method comprising the steps of: a) obtaining a tissue sample from a patient being tested for disease; b) isolating a nucleic acid molecule according to the invention from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation in the nucleic acid molecule which is associated with disease.
  • an amplification step for example using PCR, may be included. Suitable probes are discussed in some detail above. Deletions and insertions can be detected by a change in the size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to labelled RNA of the invention or alternatively, labelled antisense DNA sequences of the invention. Perfectly-matched sequences can be distinguished from mismatched duplexes by RNase digestion or by assessing differences in melting temperatures.
  • the presence or absence of the mutation in the patient may be detected by contacting DNA with a nucleic acid probe that hybridises to the DNA under stringent conditions to form a hybrid double-stranded molecule, the hybrid double-stranded molecule having an unhybridised portion of the nucleic acid probe strand at any portion corresponding to a mutation associated with disease; and detecting the presence or absence of an unhybridised portion of the probe strand as an indication of the presence or absence of a disease-associated mutation in the corresponding portion of the DNA strand.
  • Such diagnostics are particularly useful for prenatal and even neonatal testing.
  • Point mutations and other sequence differences between the reference gene and "mutant" genes can be identified by other well-known techniques, such as direct DNA sequencing or single-strand conformational polymorphism, (see Orita et al, Genomics, 5, 874-879 (1989)).
  • a sequencing primer may be used with double-stranded PCR product or a single-stranded template molecule generated by a modified PCR.
  • the sequence determination is performed by conventional procedures with radiolabelled nucleotides or by automatic sequencing procedures with fluorescent-tags.
  • Cloned DNA segments may also be used as probes to detect specific DNA segments. The sensitivity of this method is greatly enhanced when combined with PCR.
  • point mutations and other sequence variations, such as polymorphisms can be detected as described above, for example, through the use of allele-specific oligonucleotides for PCR amplification of sequences that differ by single nucleotides.
  • DNA sequence differences may also be detected by alterations in the electrophoretic mobility of DNA fragments in gels, with or without denaturing agents, or by direct DNA sequencing (for example, Myers et al, Science (1985) 230:1242). Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and SI protection or the chemical cleavage method (see Cotton et al, Proc. Natl. Acad. Sci. USA (1985) 85: 4397-4401).
  • FISH Fluorescence in situ hybridization
  • an array of oligonucleotide probes comprising a nucleic acid molecule according to the invention can be constructed to conduct efficient screening of genetic variants, mutations and polymorphisms.
  • Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see for example: M.Chee et al, Science (1996) 274: 610-613).
  • the array is prepared and used according to the methods described in PCT application WO95/11995 (Chee et al); Lockhart, D. J. et al. (1996) Nat. Biotech. 14: 1675-1680); and Schena, M. et al (1996) Proc. Natl. Acad. Sci. 93: 10614-10619).
  • Oligonucleotide pairs may range from two to over one million.
  • the oligomers are synthesized at designated areas on a substrate using a light-directed chemical process.
  • the substrate may be paper, nylon or other type of membrane, filter, chip, glass slide or any other suitable solid support.
  • an oligonucleotide may be synthesized on the surface of the substrate by using a chemical coupling procedure and an ink jet application apparatus, as described in PCT application WO95/25116 (Baldeschweiler et al).
  • a "gridded" array analogous to a dot (or slot) blot may be used to arrange and link cDNA fragments or oligonucleotides to the surface of a substrate using a vacuum system, thermal, UV, mechanical or chemical bonding procedures.
  • An array such as those described above, may be produced by hand or by using available devices (slot blot or dot blot apparatus), materials (any suitable solid support), and machines (including robotic instruments), and may contain 8, 24, 96, 384, 1536 or 6144 oligonucleotides, or any other number between two and over one million which lends itself to the efficient use of commercially-available instrumentation.
  • diseases may be diagnosed by methods comprising determining, from a sample derived from a subject, an abnormally decreased or increased level of polypeptide or mRNA. Decreased or increased expression can be measured at the RNA level using any of the methods well known in the art for the quantitation of polynucleotides, such as, for example, nucleic acid amplification, for instance PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods.
  • nucleic acid amplification for instance PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods.
  • Assay techniques that can be used to determine levels of a polypeptide of the present invention in a sample derived from a host are well-known to those of skill in the art and are discussed in some detail above (including radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays).
  • This aspect of the invention provides a diagnostic method which comprises the steps of: (a) contacting a ligand as described above with a biological sample under conditions suitable for the formation of a ligand- polypeptide complex; and (b) detecting said complex.
  • Protocols such as ELISA, RIA, and FACS for measuring polypeptide levels may additionally provide a basis for diagnosing altered or abnormal levels of polypeptide expression.
  • Normal or standard values for polypeptide expression are established by combining body fluids or cell extracts taken from normal mammalian subjects, preferably humans, with antibody to the polypeptide under conditions suitable for complex formation The amount of standard complex formation may be quantified by various methods, such as by photometric means.
  • Antibodies which specifically bind to a polypeptide of the invention may be used for the diagnosis of conditions or diseases characterised by expression of the polypeptide, or in assays to monitor patients being treated with the polypeptides, nucleic acid molecules, ligands and other compounds of the invention.
  • Antibodies useful for diagnostic purposes may be prepared in the same manner as those described above for therapeutics. Diagnostic assays for the polypeptide include methods that utilise the antibody and a label to detect the polypeptide in human body fluids or extracts of cells or tissues.
  • the antibodies may be used with or without modification, and may be labelled by joining them, either covalently or non-covalently, with a reporter molecule.
  • a wide variety of reporter molecules known in the art may be used, several of which are described above.
  • Diagnostic assays may be used to distinguish between absence, presence, and excess expression of polypeptide and to monitor regulation of polypeptide levels during therapeutic intervention. Such assays may also be used to evaluate the efficacy of a particular therapeutic treatment regimen in animal studies, in clinical trials or in monitoring the treatment of an individual patient.
  • a diagnostic kit of the present invention may comprise:
  • a diagnostic kit may comprise a first container containing a nucleic acid probe that hybridises under stringent conditions with a nucleic acid molecule according to the invention; a second container containing primers useful for amplifying the nucleic acid molecule; and instructions for using the probe and primers for facilitating the diagnosis of disease.
  • the kit may further comprise a third container holding an agent for digesting unhybridised RNA.
  • a diagnostic kit may comprise an array of nucleic acid molecules, at least one of which may be a nucleic acid molecule according to the invention.
  • a diagnostic kit may comprise one or more antibodies that bind to a polypeptide according to the invention; and a reagent useful for the detection of a binding reaction between the antibody and the polypeptide.
  • kits will be of use in diagnosing a disease or susceptibility to diseases in which Nuclear Hormone Receptors are implicated, particularly cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, uterus, prostate, pancreas, head and neck and other solid tumours, myeloproliferative disorders, such as leukemia, non- Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma, autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection, cardiovascular disorders, including hypertension, hypotension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, heart arrhythmia, and ischemia, neurological disorders including, central nervous system disease, Alzheimer's disease, Parkinson's disease, brain injury, stroke, amyotrophic
  • tumours examples of which include Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis, lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas.
  • the disease may alternatively be one in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD).
  • IBD irritable bowel syndrome
  • COPD chronic obstructive pulmonary disease
  • regulating neutrophil function is of value in treating infections and wound healing.
  • Figure 1 Inpharmatica Genome ThreaderTM results of search using BAB 13403.1 (LBDG14).
  • the top hit is 1FM9:A, the Human RXRalpha Ligand Binding Domain.
  • FIG. 1 Genome ThreaderTM alignment of BAB13403.1 (LBDG14) and 1FM9:A.
  • Figure 3 InterPro search results for BAB13403.1 (LBDG14).
  • Figure 4 NCBI Conserved Domain Database search results for BAB 13403.1 (LBDGl 4).
  • Figure 5 Graphical view of NCBI PSI-Blast (10 iterations) results for BAB 13403.1 (LBDG14).
  • Figure 6 List of NCBI PSI-Blast (10 iterations) results for BAB13403.1 (LBDG14).
  • Figure 7 NCBI protein report for BAB13403.1 (LBDG14).
  • Figure 8 Dose response curve for an LBDGl 4 agonist in the GAL4 assay.
  • Figure 9 Two representative experiments depicting the partial constitutive transcriptional activity of the Gal4 NR14 LBD construct.
  • Figure 10 Normalised expression of LBDG14 in 22 samples from 18 normal human tissues.
  • Figure 11 Normalised expression of LBDG14 in 17 cell line samples.
  • Figure 12 Expression profiling results - Differential gene expression with respect to disease/mo ⁇ hology.
  • Figure 13 Expression profiling using Affymetrix U133 microarrays for LBDG14 in normal human tissues
  • Figure 15 Location of the SWIM domain and the LBD.
  • Figure 16 Alignment of the original sequence prediction (SEQ ID NO: 2) and the extended sequence prediction (SEQ ID NO: 32).
  • Inpharmatica Genome ThreaderTM a proprietary prediction bioinformatics program, is queried with the protein sequence BAB 13403.1 (LBDGl 4). The results are shown in figure 1. The top hit is to a structure from the PDB databank, 1FM9:A, the Human RXRalpha Ligand Binding Domain, at 90% confidence.
  • the Inpharmatica Genome ThreaderTM has identified residues 248-433 of a sequence, BAB13403.1 (LBDG14), as having an equivalent structure to residues 7-215 of Human RXRalpha Ligand Binding Domain (PDB code: 1FM9:A).
  • BAB13403.1 (LBDG14) is a protein that functions as a Nuclear Hormone Receptor Ligand Binding Domain.
  • the h pharmatica Genome ThreaderTM identifies this with 90% confidence.
  • 1FM9:A is chosen (highlighted) against which to view the sequence alignment of BAB13403.1 (the LBDG14 polypeptide). Viewing the alignment ( Figure 2) of the query protein against the protein identified as being of a similar structure helps to visualize the areas of homology.
  • Figure 2 illustrates the point that the residues of Human RXRalpha Ligand Binding Domain which are involved in the binding of Nuclear hormone receptor coactivators (ALA57, LYS58, PHE63, LEU66, ASP70 and LEU74) are conserved as ALA298, LYS299, PHE302, LEU305, ASP309 and LEU312, respectively in BAB13403.1 (the LBDG14 polypeptide). h addition, some of the other 1FM9:A residues involved in the binding of the Nuclear Hormone Receptor Coactivators (TRP56 and LEU75) are conservatively substituted by PHE297 and ALA313, respectively in BAB13403.1 (the LBDG14 polypeptide).
  • BAB13403.1 (the LBDG14 polypeptide) supports the Genome ThreaderTM annotation of BAB13403.1 (the LBDG14 polypeptide) as containing a Nuclear Hormone Receptor Ligand Binding Domain.
  • the InterPro database is queried with BAB13403.1 (LBDG14; Figure 3).
  • InterPro returns zero hits to BAB 13403.1 (LBDGl 4). Returning zero hits from InterPro means that BAB13403.1 (LBDG14) is unidentifiable as a Nuclear Hormone Receptor Ligand Binding Domain member using InterPro.
  • NCBI conserveed Domain Database (CDD) is queried with BAB13403.1 (LBDG14; Figure 4). CDD returns zero hits to BAB13403.1 (LBDG14). Returning zero hits from CDD means that BAB 13403.1 (LBDGl 4) is unidentifiable as a Nuclear Hormone Receptor Ligand Binding Domain member using CDD.
  • NCBI provides a public domain PSI-Blast server. Querying NCBI PSI-Blast with BAB13403.1 (LBDG14) through 10 positive iterations fails to annotate any region of BAB13403.1 (LBDG14) as having a relationship to any known Nuclear Hormone Receptor Ligand Binding Domain.
  • Figure 5 shows the graphical display of NCBI PSI-Blast results for BAB 13403.1 (LBDGl 4).
  • the horizontal axis corresponds to N-terminal to C-terminal residue numbering along the BAB13403.1 (LBDG14) protein.
  • the accession codes of the sequences hit in NCBI PSI-Blast are listed in Figure 6. None of these sequences have been annotated in the public domain as containing a Nuclear Hormone Receptor Ligand Binding Domain. Thus NCBI PSI-Blast does not annotate any region of BAB13403.1 (LBDG14) as having a relationship to any known Nuclear Hormone Receptor Ligand Binding Domain.
  • BAB13403.1 The National Centre for Biotechnology Information (NCBI) GenBank protein database is viewed to examine if there is any further information that is known in the public domain relating to BAB13403.1 (LBDG14). This is the U.S. public domain database for protein and gene sequence deposition ( Figure 5). BAB 13403.1 was cloned by a group of scientists at the Kazusa DNA Research Institute, Japan. The protein is called KIAA1577 and has no functional annotation. There is no further annotation for BAB 13403.1. The public domain information for this gene does not annotate it as a Nuclear Hormone Receptor Ligand Binding Domain family member.
  • BAB13403.1 (LBDG14) is not annotated as a Nuclear Hormone Receptor Ligand Binding Domain family member. Only the Inpharmatica Genome ThreaderTM is able to annotate residues 248 to residues 433 of this protein as a Nuclear Hormone Receptor Ligand Binding Domain.
  • cDNA source for PCR of the LBD 500ng total RNA (Ambion Europe, UK or Clontech Europe, Belgium) from different human tissues was used to generate cDNA using the Superscript RT (Invitrogen) and oligo dT primer following the manufacturer's protocol. 2 ⁇ l of the reaction were used in the PCR.
  • flanking sequences may be added to either side of the LBD as defined by Genome Threader.
  • primers LBDGl 4 F and LBDGl 4 R were used to amplify the proposed LBD encompassing amino acids 248- 433 of LBDG14 from human cDNA synthesized from RNA prepared from stomach, testis, ovary, placenta and brain.
  • PCR was carried out using the DyNAzyme EXT DNA Polymerase (Finnzymes Oy, Espoo, Finland) in 2 mM MgCl 2 .
  • the resulting PCR product from stomach cDNA was then cloned into the vector pGEMTEasy (Promega UK Ltd, Southampton, UK) and verified by sequence analysis. Sequences were identical to the published sequence of LBDG14. Inserts were then cloned into the vector pFA-CMV (Sfratagene Europe, Amsterdam, The Netherlands) by restriction digest with the enzymes BamHI and Bglll.
  • Example 3 Identification of nuclear receptor agonists in a cellular assay
  • the pFA-CMV LBDGl 4 LBD construct is cotransfected into mammalian cells together with a reporter plasmid, pFR-Luc (Sfratagene Europe, Amsterdam, The Netherlands) which contains a synthetic promoter with five tandem repeats of the GAL4 binding sites that control the expression of the luciferase gene.
  • pFR-Luc Sfratagene Europe, Amsterdam, The Netherlands
  • a potential nuclear receptor ligand When a potential nuclear receptor ligand is added to the cells, it will bind the GAL4-LBD and induce transcription of the luciferase gene.
  • the level of the luciferase expression is monitored by its activity using a luminescence reader (Lehman et al. JBC 270, 12953, 1995; Pawar et al. JBC, 277, 39243, 2002).
  • the cotransfection of the GAL4 construct and reporter constructs has been carried out in HEK 293 cell line. Subsequently, the assay was repeated in a different cell line in which the nuclear receptor endogenous expression was highest.
  • the GAL4-LBD and the reporter construct were transiently transfected using the Fugene reagent (Roche) and conditions optimised for each cell line.
  • Fugene reagent Fugene reagent
  • HEK 293 cells were fransiently transfected with the reporter pFR-Luc in the absence or presence of the GAL4-LBDG14 LBD or a control GAL4 construct. Luciferase expression was quantified 48h following the transfection.
  • TRF Time resolved fluorescence
  • a critical step in NHR action is the ligand-dependent recruitment of transcriptional coactivators to target gene promoters. Specifically it has been shown that agonist binding to the receptor induces a conformational change that permits the formation of a hydrophobic pocket enabling the receptor to interact with the LXXLL motif (where L is leucine and X any amino acid) contained in most coactivators. Building on this observation, an in vitro assay has been designed to screen for putative ligands that will bind the novel NHR in the presence of a peptide containing the LXXLL motif. Biotinylated peptides based on known coactivators sequence, and control peptides (for example a peptide which interacts specifically with ERa) have been synthesized. As an example, the SRC-1 based peptide:
  • TRF assay is performed in solution, by incubating a GST fusion protein containing the LBD of the NHR of interest, europium-labelled anti GST antibody, biotinylated LXXLL containing peptide and streptavidin APC. In the presence of a ligand that binds the LBD, the fluorescent reagents are brought in close proximity and the TRF can occur. A fluorescent signal, which reflects the extent of binding, is read at 665 nm (J. Biol. Mol. Screen. 7, 3; 2002).
  • Example 5 Identification of a DNA motif recognised by the DNA binding domain.
  • the DNA Binding Domains (DBDs) of NHR make specific base-specific contacts with the nucleotide bases in the DNA and are responsible for the sequence-specificity of DNA recognition.
  • the NHR response elements contain similar motifs frequently arranged as direct or inverted repeats with a variable spacer.
  • the specificity of NHRs DNA recognition motifs is further enhanced by the formation of homodimers or heterodimers with different partners (e.g. retinoic acid receptor, RXR).
  • RXR retinoic acid receptor
  • Biotinylated oligonucleotides based on a number of binding elements were generated, annealed to form a double-stranded DNA molecule and bound to the 96-well streptavidin coated plates. Excess unbound DNA was washed twice using washing buffer (PBS, 0.1% Tween 20) and following blocking with 2% BSA in PBS, purified recombinant NHR either alone or in the presence of a putative partner protein was added to the plates in binding buffer (PBS, 0.1% Tween 20, 0.1% BSA, 0.1 mg/ml salmon sperm DNA). The bound receptor was detected using general ELISA methodology (Ed Harlow and David Lane, Antibodies - A laboratory manual, Cold Spring Harbor, 1988) by a specific antibody, followed by a secondary HRP conjugated antibody.
  • Example 6 Quantitative Expression Profiling of LBDGl 4
  • TaqMan RT-PCR quantitation was used.
  • the TaqMan 3'- 5' exonuclease assay signals the formation of PCR amplicons by a process involving the nucleolytic degradation of a doublelabeled fluorogenic probe that hybridises to the target template at a site between the two primer recognition sequences (cf. U. S. Patent 5,876,930).
  • the ABI Prism 7000 and ABI Prism 7700 automates the detection and quantitative measurement of these signals, which are stoichiometrically related to the quantities of amplicons produced, during each cycle of amplification. In addition to providing substantial reductions in the time and labour requirements for PCR analyses, this technology permits simplified and potentially highly accurate quantification of target sequences in the reactions.
  • B. RNA samples are stoichiometrically related to the quantities of amplicons produced, during each cycle of amplification.
  • RNA prepared from diseased or non-diseased organs is purchased from either Ambion Europe (Huntingdon, UK), Clontech (BD, Franklin Lakes, NJ), Biochain (AMS Biotechnology (Europe) Ltd, Abingdon, UK) or Clinomics (Pittsfield, MA). Cell lines are passaged using standard tissue culture protocols. Cells are maintained in a humidified atmosphere at 37°C; 5% CO 2 .
  • Culture medium consists of lx DMEM (Invitrogen, UK) with the addition of 10% foetal bovine serum (Invitrogen, UK); 2mM glutamine (Sigma, Poole, UK); 100 u/ml penicillin G (Invitrogen, UK) and lOOu/ml streptomycin sulfate (Invitrogen, UK). Cell treatments are carried out as follows:
  • RNA is prepared from cell lines using RNeasy kits following manufacturer's protocols (Qiagen, UK)
  • Oligonucleotide primers and probes are designed using Primer Express software (Applied Biosystems, Foster City CA) with a GC-content of 40-60%, no G-nucleotide at the 5 '-end of the probe, and no more than 4 contiguous Gs.
  • Primer probe sets are designed within the 3 'exon of the proposed LBDGl 4 and also over an exon-exon junction of the proposed LBDG14.
  • BLAST ® Basic Local Alignment Search Tool, Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ.: J Mol Biol 1990 Oct 5;215(3):403-10. Results confirm that each oligonucleotide recognises the target sequence with a specificity >3 bp when compared to other known cDNAs or genomic sequence represented in the Unigene and GoldenPath publicly available databases.
  • the sequence of the primers and probes are:
  • Primer/probe concentrations were titrated in the range of 50nM to 900nM and optimal concentrations for efficient PCR reactions are determined. Optimal primer and probe concentrations varied in between lOOnM and 900nM depending on the target gene that was amplified.
  • D. cDN A reaction cDNA was prepared using components from Applied Biosystems, Foster City CA. 50 ⁇ l reactions were prepared in 0.5ml RNase free tubes. Reactions contain 500ng total RNA; lx reverse transcriptase buffer; 5.5mM MgC12; ImM dNTP's; 2.5 ⁇ l random hexamers; 20U RNase inhibitor; and 62.5U reverse transcriptase.
  • E. PCR reactions contain 500ng total RNA; lx reverse transcriptase buffer; 5.5mM MgC12; ImM dNTP's; 2.5 ⁇ l random hexamers; 20U RNase inhibitor; and 62.5U reverse transcriptase.
  • reaction 25 ⁇ l reactions were prepared in 0.5 ml thin- walled, optical grade PCR 96 well plates (Applied Biosystems, Foster City CA). Reactions contained: lx final concenfration of TaqMan Universal Master Mix (a proprietary mixture of AmpliTaq Gold DNA polymerase, AmpEraseX UNG, dNTPs with UTP, passive reference dye and optimised buffer components, Applied Biosystems, Foster City CA); lOOnM Taqman probe; 900nM forward primer; 900nM reverse primer and the relevant amount of cDNA template. For the normal and diseased tissue analysis, reactions contained the same amounts of reagents except for the probe, which was used at a final concentration of 200nM. F. Performance of Assay
  • the levels of target cDNA in each sample are normalised to the level of expression of target in a comparative sample.
  • the levels of internal control cDNA in each sample are normalised to the level of expression of internal control in a comparative sample.
  • the data is then represented as fold expression of normalised target sequence relative to the level of expression in the comparative sample, which is set arbitrarily to 1.
  • Taqman RT-PCR was carried out using 15ng of the indicated cDNA using primers/probes specific for LBDG14 and 18s rRNA as described in the detailed description.
  • a standard curve for target and internal control was also carried out, using between 25ng to 0.39ng of cDNA template of a typical tissue sample. Using linear regression analysis of the standard curves, the amount of actual starting target or 18s cDNA in each test sample was calculated.
  • the levels of target and reference cDNA in each sample were normalised to the level of expression in a comparative sample, in this case, stomach.
  • Figure 10 represents the fold expression of normalised target sequence relative to the level of expression in stomach cDNA, which is set arbitrarily to 1.
  • the target expression profile was determined using 2 primer probe sets - one within the 3'exon of the proposed LDBG14 and one over an exon-exon junction of LBDGl 4. Each sample was quantitated in 2 or more individual experiments.
  • Figure 10 shows the mean ⁇ SEM for the multiple experiments.
  • LBDGl 4 appears to be expressed in all of the tissues tested with the highest expression observed in brain and testis. There is no marked difference between the expression profiles from the two primer/probe sets suggesting that the splicing of this gene across the exon 4-5 boundary is not variable between the tissues tested, when compared to the UTR profile.
  • the PCR reaction was also carried out on cDNA made in the absence of reverse transcriptase enzyme. A signal was not seen in these reactions (data not shown), indicating that the levels of LBDGl 4 detected are present in cDNA.
  • Taqman RT-PCR was carried out using 15ng of the indicated cDNA using primers/probes specific for LBDG14 and 18s rRNA as described in the detailed description.
  • a standard curve for target and internal control was also carried out, using between 25ng to 0.39ng of cDNA template of a typical cell line sample. Using linear regression analysis of the standard curves, the amount of actual starting target or 18s cDNA in each test sample was calculated.
  • FIG. 11 represents the fold expression of normalised target sequence relative to the level of expression in HEK293 cells, which is set arbitrarily to 1.
  • the target expression profile was determined using 2 primer probe sets - one within the 3'exon of the proposed LBDG14 and one over an exon-exon junction of LBDG14. Each sample was quantitated in 2 or more individual experiments.
  • Figure 11 shows the mean ⁇ SEM for the multiple experiments.
  • LBDGl 4 For LBDGl 4, the relative levels of expression across the different tissues is very similar for both primer/probe sets (3' and exon spanning), indicating the absence of differential splicing of LBDG14 in these samples. All cell samples give detectable expression of LBDG14 with the highest levels in HEK293, THP 1, MCF-7 and HT29. In general, treatment of cells does not result in a significant change in expression of LBDGl 4.
  • the PCR reaction was also carried out on cDNA made in the absence of reverse transcriptase enzyme. A signal was not seen in these reactions (data not shown), indicating that the levels of LBDGl 4 detected are present in cDNA.
  • Figure 12 shows normalised expression of LBDG14 in 26 disease and clinically matched normal samples.
  • Taqman RT-PCR was carried out using 25ng of the indicated cDNA using primers/probes specific for LBDG14 and 18S rRNA as described in the detailed description.
  • a standard curve for target and internal control was also carried out, using between 50ng to 0.78ng of cDNA template of a typical sample. Using linear regression analysis of the standard curves, the amount of actual starting target or 18S cDNA in each test sample was calculated.
  • FIG. 12 represents the fold expression of normalised target sequence relative to the level of expression in COPD, which is set arbitrarily to 1.
  • the target expression profile was determined using the primer probe set within the 3'utr of the proposed LBDGl 4.
  • Each sample was quantitated in at least 3 individual experiments from 3 individual batches of cDNA synthesis.
  • Figure 12 shows the mean and SEM of three experiments.
  • LBDGl 4 expression is detected in all tissues tested. Expression is low in the diabetic skeletal muscle, adrenal cortical tumour and adenomatous polyposis samples.
  • Figure 12 it can be seen that LBDG14 is up-regulated 3.3 fold in prostate cancer when compared to the normal sample; and 4.2 fold in rheumatoid arthritis compared to normal control.
  • the PCR reaction was also carried out on cDNA made in the absence of reverse transcriptase enzyme. No signal was seen in these reactions (data not shown), indicating that the levels of LBDGl 4 detected are present in cDNA.
  • Example 7 Expression profiling using Affymetrix U133 microarrays for LBDG14 in normal and tumour human tissues
  • cDNA was synthesized using T7-(dT) 24 oligos and Superscript II RT followed by T4 polymerase and was purified using Phase Lock Gel (PLG) and phenol: chloroform extraction.
  • PLG Phase Lock Gel
  • cRNA was carried out using biotinylated CTP in an in vitro transcription reaction. Labelled product cRNA was then cleaned up using RNeasy columns (Qiagen, UK Ltd.) and assessed by spectrophotometry. cRNA was then fragmented and analysed using the Agilent LabCbip (Agilent, Palo Alto, CA). cRNA was analysed using the latest version of the Affymetrix U-1333 GeneChip. Approximately lO ⁇ g of cRNA was used per GeneChip. Hybridisation and washing protocols were carried out in accordance with Affymetrix protocols.
  • the probe set 226208_at was used to detect transcript for LBDG14. Details of the 10 probes within this set are available at the Affymetrix website (www.Affymetrix.com), NetAffx section.
  • transcript for LBDGl 4 One probe set was used to detect transcript for LBDGl 4. RNAs from 2063 normal human tissues were screened for the presence of the transcript of LBDGl 4 using this probe set. Transcripts were detected as "present” in 2045 of these RNA samples. Transcript profiling using the U133 chip demonstrates that the transcript for LBDG14 could be detected in the majority of samples from all the tissues tested. Transcript levels were highest in the cortical regions of the brain notably, frontal cortex, parietal cortex, temporal cortex. High levels of expression were also observed in the white blood cells. Lowest levels of expression were found in the muscle samples (see Figure 13).
  • transcript levels were observed in activated congestionrophils and in Schwannomas and sarcomas of the small intestine and stomach (see Figure 14).
  • a small reduction in expression of transcript for LBDGl 4 was observed in squamous cell carcinoma of the lung, neuroendocrine carcinoma of the lung, malignant lymphomas adenocarcinoma of the colon and seminoma of the testis.
  • This data indicates that transcripts of this gene are altered in a variety of tumour types. Identifying the tumour types that possess elevated or suppressed LBDGl 4 transcript levels may be of value in diagnostics for particular cancer subtypes and thereby, define the particular therapeutic approach for individual patients.
  • agonists and antagonists for LDBG14 will be of value in freating cancer.
  • the finding of an elevation of LBDGl 4 transcripts in activated monrophils suggests that this nuclear receptor is involved in regulating neutrophil function.
  • agonists and antagonists will be of value in treating inflammatory conditions including but not exclusively rheumatoid arthritis, multiple sclerosis, psoriasis, inflammatory bowel disease, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis and conjunctivitis.
  • regulating neutrophil function is of value in treating infections and wound healing.
  • SEQ ID NO:l Nucleotide coding sequence for BAB13403.1 ( BDG14) protein
  • SEQ ID NO: 7 (LBDG14 nucleotide sequence exon C) 1 GTGCTCCTGA TCCAACAGCA GGTGCTAGTA TAGATGATGA AAACTGCTGG
  • SEQ ID NO: 8 (LBDG14 protein sequence exon C)
  • SEQ ID NO: 9 (LBDG14 nucleotide sequence exon D) 1 GTGCGGGAGA TGTTAAAGAT GAGGGACTCC AATGGGGCCC GCATGTTGAC
  • SEQ ID NO: 12 (LBDG14 protein sequence exon E)
  • SEQ ID NO : 14 (LBDG14 protein sequence exon F) 1 SSNRPHRTVF TRAIEACDLH WQDSHLQHII SSDLYTNYCY HDDTENSLFD
  • SEQ ID NO : 21 (LBDG14 nucleotide sequence exon J) 1 CCGGACCATA TAGTGGTTTA GGTGAAATAA TCCATCGGGA GAGCGTTCCA
  • SEQ ID NO : 23 (LBDG14 nucleotide sequence exon K) 1 GTTACTAGTA TTGGAATCTA CTGCTCCATC AGGAGACCTC ACCCGCCCAC
  • SEQ ID NO: 25 (LBDG14 nucleotide sequence exon L) 1 GCGATGTTCG GAGGCTGGAA ACAGTATTAG AATCCATCCA GAAAAACATT 51 CACTCCTCAT CACACATCTT CAAGCTTGCC CAAGATGCAT TTAAAATAGC 101 AACTCTCATG GACAGTTTGC CAGACATCAC TCTTTTGAAA GTGTCTCTGG 151 AGCTGGGCCT GCAG SEQ ID NO: 26 (LBDG14 protein sequence exon L)
  • SEQ ID NO: 32 (LBDG14 full known protein sequence)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • High Energy & Nuclear Physics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

This invention relates to the protein, termed BAB13403.1, herein identified as containing a Nuclear Hormone Receptor Ligand Binding Domain and to the use of this protein and nucleic acid sequence from the encoding gene in the diagnosis, prevention and treatment of disease.

Description

NUCLEAR HORMONE RECEPTOR
This invention relates to a protein, termed BAB13403.1 (also referred to as NHR14, NR14 and LBDG14) herein identified as a Nuclear Hormone Receptor and to the use of this protein and nucleic acid sequence from the encoding gene in the diagnosis, prevention and treatment of disease.
All publications, patents and patent applications cited herein are incorporated in full by reference.
BACKGROUND
The process of drug discovery is presently undergoing a fundamental revolution as the era of functional genomics comes of age. The term "functional genomics" applies to an approach utilising bioinformatics tools to ascribe function to protein sequences of interest. Such tools are becoming increasingly necessary as the speed of generation of sequence data is rapidly outpacing the ability of research laboratories to assign functions to these protein sequences. As bioinformatics tools increase in potency and in accuracy, these tools are rapidly replacing the conventional techniques of biochemical characterisation. Indeed, the advanced bioinformatics tools used in identifying the present invention are now capable of outputting results in which a high degree of confidence can be placed.
Various institutions and commercial organisations are examining sequence data as they become available and significant discoveries are being made on an on-going basis. However, there remains a continuing need to identify and characterise further genes and the polypeptides that they encode, as targets for research and for drug discovery.
Recently, a remarkable tool for the evaluation of sequences of unknown function has been developed by the Applicant for the present invention. This tool is a database system, termed the Biopendium search database, that is the subject of co-pending International Patent Application No. PCT/GB01/01105. This database system consists of an integrated data resource created using proprietary technology and containing information generated from an all-by-all comparison of all available protein or nucleic acid sequences. The aim behind the integration of these sequence data from separate data resources is to combine as much data as possible, relating both to the sequences themselves and to information relevant to each sequence, into one integrated resource. All the available data relating to each sequence, including data on the three-dimensional structure of the encoded protein, if this is available, are integrated together to make best use of the information that is known about each sequence and thus to allow the most educated predictions to be made from comparisons of these sequences. The annotation that is generated in the database and which accompanies each sequence entry imparts a biologically relevant context to the sequence information. This data resource has made possible the accurate prediction of protein function from sequence alone. Using conventional technology, this is only possible for proteins that exhibit a high degree of sequence identity (above about 20%-30% identity) to other proteins in the same functional family. Accurate predictions are not possible for proteins that exhibit a very low degree of sequence homology to other related proteins of known function.
In the present case, a protein whose sequence is recorded in a publicly available database as KIAA1577 (NCBI Genebank nucleotide accession number AB046797.1 and a Genebank protein accession number BAB 13403.1), is implicated as a novel member of the Nuclear Hormone Receptor Ligand Binding Domain family. Introduction to the Nuclear Hormone Receptor Family
The Nuclear Hormone Receptor family (see Table 1) encodes structurally related proteins that regulate the transcription of target genes. These proteins include receptors for steroid and thyroid hormones, vitamins, and other proteins for which no ligands have been found. To be classified as a "Nuclear Hormone Receptor" a protein must possess at least one of two key domains; a C4-type zinc finger DNA-Binding Domain (DBD) or a Ligand Binding Domain (LBD). The DBD is required for binding DNA in the vicinity of target genes, and the LBD is required for steroid-like ligand responsiveness. It is the Ligand Binding Domain of Nuclear Hormone Receptors which is the binding site for pharmacological agents such as Tamoxifen. Many Nuclear Hormone Receptors possess both a DBD and an LBD, and a well-known example of this is Estrogen receptor alpha, which possesses both a DBD and an LBD. Nuclear Hormone Receptors which possess both a DBD and an LBD can be referred to as "Classical Nuclear Honnone Receptors". There are also members of the Nuclear Hormone Receptor family which possess a DBD but lack an LBD; for example the proteins Knirps (SWISS-PROT code P10734) and ODR7 (SWISS-PROT code P41933) possess DBDs, but both lack LBDs. Implicit in the existence of proteins such as Knirps and ODR7 is the fact that possession of a DBD does not mean that a LBD will be concomitantly present. There are also members of the Nuclear Hormone Receptor family that possess an LBD but lack a DBD; for example the protein "Short Heterodimer Partner", SHP (SWISS- PROT code Q15466) possesses an LBD but lacks a DBD.
A further refinement in the classification of Nuclear Hormone Receptors is to classify on the basis of possession of an LBD. Nuclear Hormone Receptors which possess an LBD can be sub-classified as "Nuclear Hormone Receptor Ligand Binding Domain" family members. Thus Estrogen receptor alpha and SHP are "Nuclear Hormone Receptor Ligand Binding Domain" family members whereas Knirps and ODR7 are excluded. Similarly, Nuclear Hormone Receptors can also be sub-classified on the basis of possession of a DBD. Nuclear Hormone Receptors which possess a C4-type zinc finger DBD can be sub- classified as "Nuclear Hormone Receptor DNA Binding Domain" family members. Thus Estrogen Receptor alpha, Knirps and ODR7 are "Nuclear Hormone Receptor DNA Binding Domain" family members whereas SHP is excluded.
The DBD directs the protein to bind specific DNA sequences in the vicinity of target genes. The Ligand Binding Domain (LBD) binds and responds to the cognate hormone. Ligand binding to the LBD triggers a conformational change which expels a bound "Nuclear Receptor Co-Repressor". The site previously occupied by the Co-Repressor is then free to recruit a "Nuclear Receptor Co-Activator". This Ligand-triggered swap of a Co- Repressor for a Co-Activator is the mechanism by which Ligand binding leads to the transcriptional activation of target genes. The LBD is the binding site for all Nuclear Hormone Receptor targeted drugs to date and it is thus desirable to identify Ligand Binding Domains since these will be attractive drug targets. The LBD also directs dimerisation with other LBDs. For example, the Estrogen receptor alpha ligand binding domain can homodimerise with itself, or heterodimerise with the Estrogen receptor beta ligand binding domain. Ligand Binding Domains share low sequence identity (~15%) but have very similar structures and so present ideal targets for a structure-based relationship tool such as Inpharmatica Genome Threader .TM
Table 1: Nuclear Hormone Receptor Superfamily
Class ID Nuclear Hormone Receptor Name Species Accession
NR1 group
NR1A1 Thyroid Hormone Receptor alpha HUMAN M24748
NR1A2 Thyroid Hormone Receptor beta HUMAN X04707
NR1A3 Thyroid Hormone Receptor Ciona CIONA AF077403
NR1 B1 Retinoic Acid Receptor alpha HUMAN X06538
NR1 B2 Retinoic Acid Receptor beta HUMAN Y00291
NR1 B3 Retinoic Acid Receptor gamma HUMAN M57707
NR1 B4 Retinoic Acid Receptor Polyandrocarpa POLYANDROCARPA D86615
NR1C1 Peroxisome Prol iterator Activated Receptor alpha HUMAN L02932
NR1C2 Peroxisome Prol iterator Activated Receptor beta HUMAN L07592
NR1C3 Peroxisome Prol iterator Activated Receptor gamma HUMAN L40904
NR1D1 Rev-erbA HUMAN M24898
NR1 D2 Rev-erbB HUMAN L31785
NR1D3 E75 FLY X51548
NR1 E1 E78 FLY U01087
NR1 F1 RAR-related Orphan Receptor alpha HUMAN U04897
NR1 F2 RAR-related Orphan Receptor beta HUMAN Y08639
NR1 F3 RAR-related Orphan Receptor gamma HUMAN U16997
NR1 F4 DHR3 FLY M90806
NR1G1 CNR14 WORM U 13074
NR1H1 Ecdysone Receptor FLY M74078
NR1 H2 Liver X Receptor beta HUMAN U07132
NR1 H3 Liver X Receptor alpha HUMAN U22662
NR1 H4 Famesoid X Receptor HUMAN U68233
NR111 Vitamin D Receptor HUMAN J03258
NR112 Pregnane X Receptor HUMAN AF061056
NR113 Constitutive Androstane Receptor alpha HUMAN Z30425
NR114 Constitutive Androstane Receptor beta MOUSE AF009327
NR1J1 DHR96 FLY U36792
NR1K1 NHR1 WORM U 19360
NR2 group
NR2A1 Hepatocyte Nuclear Factor 4 alpha HUMAN X76930
NR2A2 Hepatocyte Nuclear Factor 4 beta XENOPUS Z49827 NR2A3 Hepatocyte Nuclear Factor 4 gamma HUMAN Z49826
NR2A4 Drosophila Hepatocyte Nuclear Factor 4 FLY U70874
NR2B1 Retinoid X Receptor alpha HUMAN X52773
NR2B2 Retinoid X Receptor beta HUMAN M84820
NR2B3 Retinoid X Receptor gamma HUMAN U38480
NR2B4 Ultraspiracle FLY X53417
NR2C1 TR2 HUMAN M29960
NR2C2 TR4 HUMAN L27586
NR2D1 SpSHR2 SEAURCHIN U38281
NR2E1 TLX HUMAN Y13276
NR2E2 Tailless FLY AF019362
NR2E3 Photoreceptor-specific Nuclear Receptor HUMAN AF121129
NR2E4 Dissatisfaction FLY AF106677
NR2E5 FAX-1 WORM AF176087
NR2F1 COUP-TFI HUMAN X12795
NR2F2 COUP-TFII HUMAN M64497
NR2F3 Seven-up FLY M28863
NR2F4 Xenopus COUP-TFI 11 XENOPUS X63092
NR2F5 Zebrafish COUP-TFIII ZEBRAFISH X70300
NR2F6 EAR2 HUMAN X12794
NR3 group
NR3A1 Estrogen Receptor alpha HUMAN P03372
NR3A2 Estrogen Receptor beta HUMAN AB006590
NR3B1 Estrogen Receptor Related alpha HUMAN X51416
NR3B2 Estrogen Receptor Related beta HUMAN AF094517
NR3B3 Estrogen Receptor Related gamma HUMAN AF058291
NR3C1 Glucocorticoid Receptor HUMAN X03225
NR3C2 Mineralocorticoid Receptor HUMAN M16801
NR3C3 Progesterone Receptor HUMAN M15716
NR3C4 Androgen Receptor HUMAN M20132
NR4 group
NR4A1 NGFI-Balpha HUMAN L13740
NR4A2 NGFI-Bbeta HUMAN X75918
NR4A3 NGFI-Bgamma HUMAN D78579
NR4A4 DHR38 FLY X89246
NR5 group
NR5A1 FTZ-F1 HUMAN U76388
NR5A2 FTF HUMAN U93553
NR5A3 Drosophila FTZ-F1 FLY M98397
NR5A4 Zebrafish FTZ-F1 ZEBRAFISH AF198086
NR5B1 FTZ-F1 B FLY L06423
NR6 group
NR6A1 Germ Cell Nuclear Factor HUMAN U64876
NR6A2 GCNF Related Factor TENEBRIO AF124981
NRO group (have only one characteristic domain)
NR0A1 sub-group (have only DBD no LBD)
NR0A1 Knirps FLY X13331
NR0A2 Knirps-related FLY X14153
NR0A3 Embryonic gonad FLY X16631
NR0A4 ODR7 WORM U16708 NROB sub-group (have only LBD no DBD)
NR0B1 DAX1 HUMAN S74720
NR0B2 Short Heterodimer Partner SHP HUMAN L76571
Table data taken from Laudet and Gronemeyer "The Nuclear Receptor Facts Book", Academic Press. Class ID refers to a classification code for each member, and accession refers to NCBI GenBank nucleotide accession code.
II. Nuclear Hormone Receptor Ligand Binding Domain Family and Disease
Nuclear Hormone Receptor Ligand Binding Domain family members have been shown to play a role in diverse physiological functions, many of which can play a role in disease processes (see Table 2).
A. Table 2. Nuclear Hormone Rece tors and disease
Alteration of Nuclear Hormone Receptor family members by ligands which bind to their LBD thus provides a means to alter the disease phenotype. There is thus a great need for the identification of novel Nuclear Hormone Receptors, as these proteins may play a role in the diseases identified above, as well as in other disease states. The identification of novel Nuclear Hormone Receptors is thus highly relevant for the treatment and diagnosis of disease, particularly those identified in Table 2.
THE INVENTION
The invention is based on the discovery that the BAB 13403.1 protein functions as a Nuclear Hormone Receptor Ligand Binding Domain.
For the BAB 13403.1 protein, it has been found that a region including residues 248-433 of this protein sequence adopts an equivalent fold to residues 7 to 215 of the Human RXRalpha Ligand Binding Domain (PDB code 1FM9:A). Human RXRalpha Ligand Binding Domain is known to function as a Nuclear Hormone Receptor Ligand Binding Domain. This relationship is not just to the Human RXRalpha Ligand Binding Domain, but rather to the Nuclear Hormone Receptor Ligand Binding Domain family as a whole.
The combination of sharing an equivalent fold allows the functional annotation of this region of BAB 13403.1, and therefore proteins that include this region, as possessing Nuclear Hormone Receptor Ligand Binding Domain activity.
In addition, results presented herein clearly indicate that the LBDG14 transcript is present at detectable levels in a variety of human tissues and cell lines. This confirms the relevance of the LBDG14 polypeptides as important targets for futher biochemical characterisation. The particular tissues and cell lines identified herein as expressing LBDG14 represent ideal targets for further studies of LBDG14 function in vivo. Such studies may, for example, make use of the ligands identified using the assays and screening methods disclosed herein to investigate the effects of inducing or inhibiting LBDG14 function. In addition, the cloning of the full-length LBDG14 polypeptide allows for high-level expression, purification and characterisation of these polypeptides. For example, the cloning, purification and partial characterisation of the LBD of LBDG14 is described herein. Notably, it is disclosed herein that the expression level of LBDG14 is increased in a number of diseased tissues relative to undiseased tissues, particularly in certain tumour samples including Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis. Down regulation of LBDG14 expression has been noted in lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas. An upregulation has also been noted in activated neutrophils. This is useful as it allows the treatment of diseases in which neutrophil activation is known to play a role by targeting LBDG14. Such disease conditions include all infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as D3D; multiple sclerosis; rheumatoid arthritis and chronic obstructive pulmonary disease (COPD).
Accordingly, agonists and antagonists of LBDG14 are likely to be of great value in the treatment of diseases in which Nuclear Hormone Receptors are implicated, especially those disclosed above. As decribed herein, agonists and antagonists of the LBDG14 polypeptides can be readily identified using the assays and screening methods disclosed. Once identified, the effect of agonists and antagonists on diseased cell lines and tissue types may then be investigated using the methods disclosed herein or known to those of skill in the art. It is likely that certain agonists or antagonists identified using the assays and methods disclosed herein will be useful in the prophylaxis or treatment of diseases associated with LBDG14.
Furthermore, since specific tumour types are identified herein in which elevated LBDG14 transcript levels are observed, the polypeptides of the invention are therefore of value in the development of diagnostic methods for the identification of patients with those particular disease conditions and for the development of suitable prophylactic and therapeutic treatments.
For example, the present invention allows the development of molecular diagnostic tools, such as monoclonal antibodies, for the detection of LBDG14 in vivo, that preferably target the ligand binding domain or DNA binding domain specifically. It is the teaching of the invention, that the LBDG14 polypeptide is a Nuclear Hormone Receptor, that allows the skilled reader to use this knowledge to generate bespoke compounds that bind to areas of interest and biochemical importance in the polypeptide. Furthermore, the identification of patients affected by particular cancer conditions using such diagnostic methods will enable specific therapeutic approaches for individual patients to be selected.
For example, the present invention allows the design of specific therapies for the treatment of the specific cancer conditions identified herein; such therapies may, for example, target LBDG14 expression or function in the relevant tumour cells.
In a first aspect, the invention provides a polypeptide, which polypeptide:
(i) comprises the amino acid sequence as recited in SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO: 16, SEQ ID NO: 18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30 and/or SEQ ID NO:32;
(ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding Domain activity or having an antigenic determinant in common with the polypeptides of (i); or
(iii) is a functional equivalent of (i) or (ii).
Preferably, a polypeptide according to the first aspect of the invention:
(i) comprises the amino acid sequence as recited in SEQ ID NO: 2 and/or SEQ ID NO: 32; (ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding Domain activity, or having an antigenic determinant in common with the polypeptides of (i); or
(iii) is a functional equivalent of (i) or (ii).
According to a second embodiment of this first aspect of the invention, there is provided a polypeptide which:
(i) consists of the amino acid sequence as recited in SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 12, SEQ ID NO: 14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26, SEQ ID NO:28, SEQ ID NO:30 and/or SEQ ID NO:32; (ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding Domain activity, or having an antigenic determinant in common with the polypeptides of (i); or (iii) is a functional equivalent of (i) or (ii).
The polypeptide having the sequence recited in SEQ ID NO:2 is referred to hereafter as "the LBDG14 polypeptide". It is anticipated that additional N terminal sequence will exist that is N terminal to the sequence recited in SEQ ID NO:2, such that the sequence presently recited is not that of the full length protein. Proposed missing exons A, B, C, D, E, F, G, H, I, J, K, L, M and N are recited herein as SEQ ID NOs: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28 and 30 respectively. The full amount of LBDG14 polypeptide sequence that is currently known is rected in SEQ ID NO: 32 (coding sequence given in SEQ ID NO:31). This sequence is referred to herein as "the extended LBDG14 polypeptide". It is suspected that there is at least one missing exon between exons A and B (SEQ ID NO: 4 and SEQ ID NO: 6, respectively), encoding sequence that is represented in SEQ ID NO:32 as (X)n, "X" denoting any amino acid, and "n" an integer between 1 and 1000, preferably between 1 and 200, more preferably between 1 and 100. It will be apparent to the skilled reader how the missing sequence may be identified using the various molecular biology techniques that are recited herein (see below). According to this aspect of the invention, a preferred polypeptide fragment according to part ii) above includes the region of the LBDG14 polypeptide or the extended LBDG14 polypeptide that is predicted as that responsible for Nuclear Hormone Receptor Ligand Binding Domain activity (hereafter, the "LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region"), or is a variant thereof. As defined herein, the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region is considered to extend between residue 248 and residue 433 of the LBDG14 polypeptide sequence (SEQ ID NO:2).
This aspect of the invention also includes fusion proteins that incorporate polypeptide fragments and variants of these polypeptide fragments as defined above, provided that said fusion proteins possess activity as a Nuclear Hormone Receptor Ligand Binding Domain.
By "possesses activity as a Nuclear Hormone Receptor Ligand Binding Domain" we refer to polypeptides that comprise amino acid sequence or structural features that can be identified as conserved features within the polypeptides of the Nuclear Hormone Receptor family, such that the polypeptide' s interaction with receptor or ligand is not substantially affected detrimentally in comparison to the function of the full length wild type polypeptide. In particular, we refer to the presence of cysteine residues in specific positions within the polypeptide that allow the formation of disulphide bonds.
Preferably, a polypeptide according to the first aspect of the invention functions as a nuclear hormone receptor. In a second aspect, the invention provides a purified nucleic acid molecule that encodes a polypeptide of the first aspect of the invention, or a fragment thereof. Preferably, the purified nucleic acid molecule has the nucleic acid sequence as recited in SEQ ID NO:l (encoding the LBDG14 polypeptide), SEQ ID NO:31 (encoding the extended LBDG14 polypeptide) or is a redundant equivalent or fragment of this sequence. A preferred nucleic acid fragment is one that encodes a polypeptide fragment according to part ii) above, preferably a polypeptide fragment that includes the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region, or that encodes a variant of these fragments as this term is defined above. Preferably, an nucleic acid molecule according to the second aspect of the invention further comprises nucleic acid sequences selected from the group comprising SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO:l l, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:27, SEQ ID NO:29 and SEQ ID NO: 31. It is anticipated that at least one further exon exists in the LBDG14 gene, corresponding to further nucleic acid sequence between SEQ ID NO: 3 and SEQ ID NO: 5. Most preferably, a nucleic acid molecule according to the second aspect of the invention consists of the nucleic acid sequence recited in SEQ ID NO: 31; this sequence is the full amount of LBDG14 nucleotide sequence that is currently known. The missing nucleic acid sequence is proptrayed in this SEQ ID as (X)„, "X" denoting any nucleotide, and "n" an integer between 3 and 3000, preferably 3 and 600, more preferably between 3 and 300. It will be apparent to the skilled reader how the missing sequence may be identified using the various molecular biology techniques that are recited herein (see below).
In a third aspect, the invention provides a purified nucleic acid molecule which hybridizes under high stringency conditions with a nucleic acid molecule of the second aspect of the invention.
In a fourth aspect, the invention provides a vector, such as an expression vector, that contains a nucleic acid molecule of the second or third aspect of the invention.
In a fifth aspect, the invention provides a host cell transformed with a vector of the fourth aspect of the invention. In a sixth aspect, the invention provides a ligand which binds specifically to, and which binds to and preferably inhibits or activates the Nuclear Hormone Receptor Ligand Binding Domain activity of, a polypeptide of the first aspect of the invention. Preferably, the ligand inhibits the function of a polypeptide of the first aspect of the invention which is a Nuclear Hormone Receptor Ligand Binding Domain. Ligands to a polypeptide according to the invention may come in various forms, including natural or modified substrates, enzymes, receptors, small organic molecules such as small natural or synthetic organic molecules of up to 2000Da, preferably 800Da or less, peptidomimetics, inorganic molecules, peptides, polypeptides, antibodies, structural or functional mimetics of the aforementioned. Herein, a low molecular weight compound representative of retinoid modulators has been demonstrated herein to activate with high affinity to the LBDG14 polypeptide.
For example, such ligands may bind specifically to, and inhibit the activity of a Nuclear Hormone Receptor Ligand Binding Domain of the present invention by binding to one or more residues within the LBD, or to one or more residues outside the LBD. As noted above, all known drugs that affect Nuclear Hormone Receptors bind to residues within the LBD. Accordingly, it is preferred that ligands of the invention which inhibit the Nuclear Hormone Receptor Ligand Binding Domain activity of a polypeptide of the invention bind to residues within the LBD. For example, such ligands may bind specifically to, and inhibit the activity of a Nuclear Hormone Receptor DNA Binding Domain of the present invention by binding to one or more residues within the LBD, or to one or more residues outside the LBD. It is preferred that ligands of the invention which inhibit the Nuclear Hormone Receptor DNA Binding Domain activity of a polypeptide of the invention bind to residues within the DBD. For example, such ligand may bind specifically to, and inhibit the activity of a Nuclear Hormone Receptor of the present invention by binding to either the LBD or the DBD, such that the NHR is unable to function normally.
In a seventh aspect, the invention provides a compound that is effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the first aspect of the invention. Such compounds may be identified using the assays and screening methods dislcosed herein.
A compound of the seventh aspect of the invention may either increase agonise) or decrease (antagonise) the level of expression of the gene or the activity of the polypeptide. Importantly, the identification of the function of the region defined herein as the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide, respectively, allows for the design of screening methods capable of identifying compounds that are effective in the treatment and/or diagnosis of diseases in which Nuclear Hormone Receptor Ligand Binding Domains are implicated. In an eighth aspect, the invention provides a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in therapy or diagnosis. These molecules may also be used in the manufacture of a medicament for the treatment of such diseases. Examples of diseases in which Nuclear Hormone Receptor Ligand Binding Domains are implicated include cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, uterus, prostate, pancreas, head and neck and other solid tumours, myeloproliferative disorders, such as leukemia, non- Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma, autoimmv e/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection, cardiovascular disorders, including hypertension, hypotension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, heart arrhythmia, and ischemia, neurological disorders including, central nervous system disease, Alzheimer's disease, Parkinson's disease, brain injury, stroke, amyotrophic lateral sclerosis, anxiety, depression, and pain, cognition enhancement, learning and memory enhancement, developmental disorders, metabolic disorders including diabetes mellitus, osteoporosis, lipid metabolism disorder, hyperthyroidism, hvpeφarathyroidism, thyroid hormone resistance syndrome, hypercalcemia, hypocalcaemia, hypercholestrolemia, hyperlipidemia, and obesity, renal disorders, including glomerulonephritis, renovascular hypertension, blood disorders including hemophilia, dermatological disorders, including, cellulite, acne, eczema, psoriasis and wound healing, scarring, negative effects of aging, fertility enhancement, contraception, pregnancy temiination, progesterone antagonism, hormone replacement therapies, steroid hormone-like mediated hair characteristics, immunomodulation, AIDS, vision disorders, glucocorticoid resistance, mineralocorticoid resistance, androgen resistance, pseudohypoaldosteronism, spinal/bulbar muscular atrophy, extraskeletal myxoid chrondrosarcomas, adrenal insufficiency, sexual reversal, infections including viral infection, bacterial infection, fungal infection and parasitic infection and other pathological conditions. Preferably the disease is proliferative in nature such as inflammation or cancer.
Preferably, the disease is a tumour, examples of which include Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis, lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas. The disease may alternatively be one in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD). In addition, regulating neutrophil function is of value in treating infections and wound healing.
In a ninth aspect, the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide of the first aspect of the invention or the activity of a polypeptide of the first aspect of the invention in tissue from said patient and comparing said level of expression or activity to a control level, wherein a level that is different to said control level is indicative of disease. Such a method will preferably be carried out in vitro. Similar methods may be used for monitoring the therapeutic treatment of disease in a patient, wherein altering the level of expression or activity of a polypeptide or nucleic acid molecule over the period of time towards a control level is indicative of regression of disease. A preferred method for detecting polypeptides of the first aspect of the invention comprises the steps of: (a) contacting a ligand, such as an antibody, of the sixth aspect of the invention with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex. In such methods the ligand of the sixth aspect of the invention may be any suitable ligand, such as an antibody, hormone or nucleic acid sequence.
Preferably, the disease diagnosed by a method of the ninth aspect of the invention is a disease in which Nuclear Hormone Receptors are implicated, as described above.
A number of different such methods according to the ninth aspect of the invention exist, as the skilled reader will be aware, such as methods of nucleic acid hybridization with short probes, point mutation analysis, polymerase chain reaction (PCR) amplification and methods using antibodies to detect aberrant protein levels. Similar methods may be used on a short or long-term basis to allow therapeutic treatment of a disease to be monitored in a patient. The invention also provides kits that are useful in these methods for diagnosing disease.
In a tenth aspect, the invention provides for the use of a polypeptide of the first aspect of the invention, or a fragment thereof, as a Nuclear Hormone Receptor Ligand Binding Domain. The invention also provides for the use of a nucleic acid molecule according to the second or third aspects of the invention to express a protein that possesses Nuclear Hormone Receptor Ligand Binding Domain activity. The invention also provides a method for effecting Nuclear Hormone Receptor Ligand Binding Domain activity, said method utilising a polypeptide of the first aspect of the invention.
In an eleventh aspect, the invention provides a pharmaceutical composition comprising a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell according to the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, in conjunction with a pharmaceutically-acceptable carrier.
In a twelfth aspect, the present invention provides a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell according to the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in the manufacture of a medicament for the diagnosis or treatment of a disease in which Nuclear Hormone Receptors are implicated, examples of which are given above.
In a thirteenth aspect, the invention provides a method of treating a disease in a patient comprising administering to the patient a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, or a pharmaceutical composition of the eleventh aspect of the invention.
For diseases in which the expression of a natural gene encoding a polypeptide of the first aspect of the invention, or in which the activity of a polypeptide of the first aspect of the invention, is lower in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an agonist. Conversely, for diseases in which the expression of the natural gene or activity of the polypeptide is higher in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an antagonist. Examples of such antagonists include antisense nucleic acid molecules, ribozymes and ligands, such as antibodies.
Preferably, the disease is a disease in which Nuclear Hormone Receptors are implicated, as described above. In a fourteenth aspect, the invention provides transgenic or knockout non-human animals that have been transformed to express higher, lower or absent levels of a polypeptide of the first aspect of the invention. Such transgenic animals are very useful models for the study of disease and may also be used in screening regimes for the identification of compounds that are effective in the treatment or diagnosis of such a disease. Preferably, the disease is a disease in which Nuclear Hormone Receptors are implicated, as described above.
A summary of standard techniques and procedures which may be employed in order to utilise the invention is given below. It will be understood that this invention is not limited to the particular methodology, protocols, cell lines, vectors and reagents described. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and it is not intended that this terminology should limit the scope of the present invention. The extent of the invention is limited only by the terms of the appended claims. Standard abbreviations for nucleotides and amino acids are used in this specification.
The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA technology and immunology, which are within the skill of those working in the art.
Such techniques are explained fully in the literature. Examples of particularly suitable texts for consultation include the following: Sambrook Molecular Cloning; A Laboratory
Manual, Second Edition (1989); DNA Cloning, Volumes I and II (D.N. Glover ed. 1985);
Oligonucleotide Synthesis (MJ. Gait ed. 1984); Nucleic Acid Hybridization (B.D.
Hames & S.J. Higgins eds. 1984); Transcription and Translation (B.D. Hames & S.J.
Higgins eds. 1984); Animal Cell Culture (R.I. Freshney ed. 1986); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide to Molecular Cloning (1984); the Methods in Enzymology series (Academic Press, Inc.), especially volumes 154 &
155; Gene Transfer Vectors for Mammalian Cells (J.H. Miller and M.P. Calos eds. 1987,
Cold Spring Harbor Laboratory); Immunochemical Methods in Cell and Molecular
Biology (Mayer and Walker, eds. 1987, Academic Press, London); Scopes, (1987) Protein Purification: Principles and Practice, Second Edition (Springer Verlag, N.Y.); and
Handbook of Experimental Immunology, Volumes I-IV (D.M. Weir and C. C. Blackwell eds. 1986).
As used herein, the term "polypeptide" includes any peptide or protein comprising two or more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e. peptide isosteres. This term refers both to short chains (peptides and oligopeptides) and to longer chains (proteins).
The polypeptide of the present invention may be in the form of a mature protein or may be a pre-, pro- or prepro- protein that can be activated by cleavage of the pre-, pro- or prepro- portion to produce an active mature polypeptide. In such polypeptides, the pre-, pro- or prepro- sequence may be a leader or secretory sequence or may be a sequence that is employed for purification of the mature polypeptide sequence.
The polypeptide of the first aspect of the invention may form part of a fusion protein. For example, it is often advantageous to include one or more additional amino acid sequences which may contain secretory or leader sequences, pro-sequences, sequences which aid in purification, or sequences that confer higher protein stability, for example during recombinant production. Alternatively or additionally, the mature polypeptide may be fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol).
Polypeptides may contain amino acids other than the 20 gene-encoded amino acids, modified either by natural processes, such as by post-translational processing or by chemical modification techniques which are well known in the art. Among the known modifications which may commonly be present in polypeptides of the present invention are glycosylation, lipid attachment, sulphation, gamma-carboxylation, for instance of glutamic acid residues, hydroxylation and ADP-ribosylation. Other potential modifications include acetylation, acylation, amidation, covalent attachment of flavin, covalent attachment of a haeme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulphide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, GPI anchor formation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. In fact, blockage of the amino or carboxyl terminus in a polypeptide, or both, by a covalent modification is common in naturally-occurring and synthetic polypeptides and such modifications may be present in polypeptides of the present invention.
The modifications that occur in a polypeptide often will be a function of how the polypeptide is made. For polypeptides that are made recombinantly, the nature and extent of the modifications in large part will be determined by the post-translational modification capacity of the particular host cell and the modification signals that are present in the amino acid sequence of the polypeptide in question. For instance, glycosylation patterns vary between different types of host cell. The polypeptides of the present invention can be prepared in any suitable manner. Such polypeptides include isolated naturally-occurring polypeptides (for example purified from cell culture), recombinantly-produced polypeptides (including fusion proteins), synthetically-produced polypeptides or polypeptides that are produced by a combination of these methods. The functionally-equivalent polypeptides of the first aspect of the invention may be polypeptides that are homologous to the LBDG14 polypeptide or the extended LBDG14 polypeptide. Two polypeptides are said to be "homologous", as the term is used herein, if the sequence of one of the polypeptides has a high enough degree of identity or similarity to the sequence of the other polypeptide. "Identity" indicates that at any particular position in the aligned sequences, the amino acid residue is identical between the sequences. "Similarity" indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences. Degrees of identity and similarity can be readily calculated (Computational Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988; Biocomputing. Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991). Homologous polypeptides therefore include natural biological variants (for example, allelic variants or geographical variations within the species from which the polypeptides are derived) and mutants (such as mutants containing amino acid substitutions, insertions or deletions) of the LBDG14 polypeptide or the extended LBDG14 polypeptide. Such mutants may include polypeptides in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code. Typical such substitutions are among Ala, Val, Leu and He; among Ser and Thr; among the acidic residues Asp and Glu; among Asn and Gin; among the basic residues Lys and Arg; or among the aromatic residues Phe and Tyr. Particularly preferred are variants in which several, i.e. between 5 and 10, 1 and 5, 1 and 3, 1 and 2 or just 1 amino acids are substituted, deleted or added in any combination. Especially preferred are silent substitutions, additions and deletions, which do not alter the properties and activities of the protein. Also especially preferred in this regard are conservative substitutions.
Such mutants also include polypeptides in which one or more of the amino acid residues includes a substituent group.
Typically, greater than 30% identity between two polypeptides (preferably, over a specified region) is considered to be an indication of functional equivalence. Preferably, functionally equivalent polypeptides of the first aspect of the invention have a degree of sequence identity with the LBDG14 polypeptide or the extended LBDG14 polypeptide, or with active fragments thereof, of greater than 80%. More preferred polypeptides have degrees of identity of greater than 85%, 90%, 95%, 98% or 99%, respectively with the LBDG14 polypeptide or the extended LBDG14 polypeptide, or with active fragments thereof.
Percentage identity, as referred to herein, is as determined using BLAST version 2.1.3 using the default parameters specified by the NCBI (the National Center for Biotechnology Information; http://www.ncbi.nlm.nih.gov/) [Blosum 62 matrix; gap open penalty=ll and gap extension penalty=l]. The functionally-equivalent polypeptides of the first aspect of the invention may also be polypeptides which have been identified using one or more techniques of structural alignment. For example, the Inpharmatica Genome Threader™ technology that forms one aspect of the search tools used to generate the Biopendium search database may be used (see PCT application published as WO 01/67507) to identify polypeptides of presently- unknown function which, while having low sequence identity as compared to the LBDG14 polypeptide or the extended LBDG14 polypeptide, are predicted to have Nuclear Hormone Receptor activity, by virtue of sharing significant structural homology with the LBDG14 polypeptide or the extended LBDG14 polypeptide sequence. By "significant structural homology" is meant that the Inpharmatica Genome Threader™ predicts two proteins, or protein regions, to share structural homology with a certainty of at least 10% more preferably, at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% and above. The certainty value of the Inpharmatica Genome Threader™ is calculated as follows. A set of comparisons was initially performed using the Inpharmatica Genome Threader™ exclusively using sequences of known structure. Some of the comparisons were between proteins that were known to be related (on the basis of structure). A neural network was then trained on the basis that it needed to best distinguish between the known relationships and known not-relationships taken from the CATH structure classification (www.biochem.ucl.ac.uk/bsm/cath). This resulted in a neural network score between 0 and 1. However, again as the number of proteins that are related and the number that are unrelated were known, it was possible to partition the neural network results into packets and calculate empirically the percentage of the results that were correct. In this manner, any genuine prediction in the Biopendium search database has an attached neural network score and the percentage confidence is a reflection of how successful the Inpharmatica Genome Threader™ was in the training/testing set.
Structural homologues to the Ligand Binding Domain of LBDG14 should share structural homology with the LBDG14LBD region. Such structural homologues are predicted to have Nuclear Hormone Receptor Ligand Binding Domain activity by virtue of sharing significant structural homology with this polypeptide sequence. The polypeptides of the first aspect of the invention also include fragments of the LBDG14 polypeptide or the extended LBDG14 polypeptide, functional equivalents of the fragments of the LBDG14 polypeptide or the extended LBDG14 polypeptide, and fragments of the functional equivalents of the LBDG14 polypeptides, provided that those functional equivalents and fragments retain Nuclear Hormone Receptor activity or have an antigenic determinant in common with the LBDG14 polypeptide or the extended LBDG14 polypeptide.
As used herein, the term "fragment" refers to a polypeptide having an amino acid sequence that is the same as part, but not all, of the amino acid sequence of the LBDG14 polypeptide or the extended LBDG14 polypeptides or one of its functional equivalents. The fragments should comprise at least n consecutive amino acids from the sequence and, depending on the particular sequence, n preferably is 7 or more (for example, 8, 10, 12, 14, 16, 18, 20 or more). Small fragments may form an antigenic determinant.
Preferred polypeptide fragments according to this aspect of the invention are fragments that include a region defined herein as the LBDG14LBD region of the LBDG14 polypeptide. This region is the region that has been annotated as a Nuclear Hormone Receptor Ligand Binding Domain. For the LBDG14 polypeptide, this region is considered to extend between residues 248-433. Variants of this fragment are included as embodiments of this aspect of the invention, provided that these variants possess activity as a Nuclear Hormone Receptor Ligand Binding Domain.
In one respect, the term "variant" is meant to include extended or truncated versions of this polypeptide fragment.
For extended variants, it is considered highly likely that the LBDG14LBD region of the LBDG14 polypeptide will fold correctly and show Nuclear Hormone Receptor Ligand Binding Domain activity if additional residues C terminal and/or N terminal of these boundaries in the LBDG14 polypeptide sequence are included in the polypeptide fragment. For example, an additional 5, 10, 20, 30, 40 or even 50 or more amino acid residues from the LBDG14 polypeptide sequence, or from a homologous sequence, may be included at either or both the C terminal and/or N terminal of the boundaries of the LBDG14LBD region of the LBDG14 polypeptide, without prejudicing the ability of the polypeptide fragment to fold correctly and exhibit Nuclear Hormone Receptor Ligand Binding Domain activity. For truncated variants of the LBDG14 polypeptide, one or more amino acid residues, even 5, 10, 20, 30, 40, 50 or more amino acid residues may be deleted at either or both the C terminus or the N terminus of the LBDG14LBD region of the LBDG14 polypeptide.
In a second respect, the term "variant" includes homologues of the polypeptide fragments described above, that possess significant sequence homology with the Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide, provided that said variants retain activity as an Nuclear Hormone Receptor Ligand Binding Domain. Homologues include those polypeptide molecules that possess greater than 30% identity with the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain regions, of the LBDG14 polypeptide or the extended LBDG14 polypeptides, respectively. Percentage identity is as determined using BLAST version 2.1.3 using the default parameters specified by the NCBI (the National Center for Biotechnology Information; http://www.ncbi.nlm.nih.gov/) [Blosum 62 matrix; gap open penalty=ll and gap extension penalty=l]. Preferably, variant homologues of polypeptide fragments of this aspect of the invention have a degree of sequence identity with the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain regions, of the LBDG14 polypeptides, respectively, of greater than 40%. More preferred variant polypeptides have degrees of identity of greater than 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99%, respectively with the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain regions of the LBDG14 polypeptide or the extended LBDG14 polypeptides, provided that said variants retain activity as a Nuclear Hormone Receptor Ligand Binding Domain. Variant polypeptides also include homologues of the truncated forms of the polypeptide fragments discussed above, provided that said variants retain activity as a Nuclear Hormone Receptor Ligand Binding Domain.
The polypeptide fragments of the first aspect of the invention may be polypeptide fragments that exhibit significant structural homology with the structure of the polypeptide fragment defined by the LBDG14LBD region of the LBDG14 polypeptide sequence, for example, as identified by the Inpharmatica Genome Threader™. Accordingly, polypeptide fragments that are structural homologues of the polypeptide fragments defined by the LBDG14LBD region of the LBDG14 polypeptide sequence should adopt the same fold as that adopted by this polypeptide fragment, as this fold is defined above. Such fragments may be "free-standing", t.e. not part of or fused to other amino acids or polypeptides, or they may be comprised within a larger polypeptide of which they form a part or region. When comprised within a larger polypeptide, the fragment of the invention most preferably forms a single continuous region. For instance, certain preferred embodiments relate to a fragment having a pre- and/or pro- polypeptide region fused to the amino terminus of the fragment and/or an additional region fused to the carboxyl terminus of the fragment. However, several fragments may be comprised within a single larger polypeptide.
The polypeptides of the present invention or their immunogenic fragments (comprising at least one antigenic determinant) can be used to generate ligands, such as polyclonal or monoclonal antibodies, that are immunospecific for the polypeptides. Such antibodies may be employed to isolate or to identify clones expressing the polypeptides of the invention or to purify the polypeptides by affinity chromatography. The antibodies may also be employed as diagnostic or therapeutic aids, amongst other applications, as will be apparent to the skilled reader. The term "immunospecific" means that the antibodies have substantially greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art. As used herein, the term "antibody" refers to intact molecules as well as to fragments thereof, such as Fab, F(ab')2 and Fv, which are capable of binding to the antigenic determinant in question. Such antibodies thus bind to the polypeptides of the first aspect of the invention.
By "substantially greater affinity" we mean that there is a measurable increase in the affinity for a polypeptide of the invention as compared with the affinity for known Nuclear Hormone Receptors.
Preferably, the affinity is at least 1.5-fold, 2-fold, 5-fold 10-fold, 100-fold, 103-fold, 104- fold, 105-fold, 106-fold or greater for a polypeptide of the invention than for known Nuclear Hormone Receptors.
If polyclonal antibodies are desired, a selected mammal, such as a mouse, rabbit, goat or horse, may be immunised with a polypeptide of the first aspect of the invention. The polypeptide used to immunise the animal can be derived by recombinant DNA technology or can be synthesized chemically. If desired, the polypeptide can be conjugated to a carrier protein. Commonly used carriers to which the polypeptides may be chemically coupled include bovine serum albumin, thyroglobulin and keyhole limpet haemocyanin. The coupled polypeptide is then used to immunise the animal. Serum from the immunised animal is collected and treated according to known procedures, for example by immunoaffinity chromatography.
Monoclonal antibodies to the polypeptides of the first aspect of the invention can also be readily produced by one skilled in the art. The general methodology for making monoclonal antibodies using hybridoma technology is well known (see, for example, Kohler, G. and Milstein, C, Nature 256: 495-497 (1975); Kozbor et al, Immunology Today 4: 72 (1983); Cole et al., 77-96 in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985).
Panels of monoclonal antibodies produced against the polypeptides of the first aspect of the invention can be screened for various properties, i.e., for isotype, epitope, affinity, etc. Monoclonal antibodies are particularly useful in purification of the individual polypeptides against which they are directed. Alternatively, genes encoding the monoclonal antibodies of interest may be isolated from hybridomas, for instance by PCR techniques known in the art, and cloned and expressed in appropriate vectors.
Chimeric antibodies, in which non-human variable regions are joined or fused to human constant regions (see, for example, Liu et al, Proc. Natl. Acad. Sci. USA, 84, 3439 (1987)), may also be of use.
The antibody may be modified to make it less immunogenic in an individual, for example by humanisation (see Jones et al, Nature, 321, 522 (1986); Verhoeyen et al, Science, 239: 1534 (1988); Kabat et al, J. Immunol., 147: 1709 (1991); Queen et al, Proc. Natl Acad. Sci. USA, 86, 10029 (1989); Gorman et al, Proc. Natl Acad. Sci. USA, 88: 34181 (1991); and Hodgson et al, Bio/Technology 9: 421 (1991)). The term "humanised antibody", as used herein, refers to antibody molecules in which the CDR amino acids and selected other amino acids in the variable domains of the heavy and/or light chains of a non-human donor antibody have been substituted in place of the equivalent amino acids in a human antibody. The humanised antibody thus closely resembles a human antibody but has the binding ability of the donor antibody.
In a further alternative, the antibody may be a "bispecific" antibody, that is an antibody having two different antigen-binding domains, each domain being directed against a different epitope.
Phage display technology may be utilised to select genes which encode antibodies with binding activities towards the polypeptides of the invention either from repertoires of PCR amplified V-genes of lymphocytes from humans screened for possessing the relevant antibodies, or from naive libraries (McCafferty, J. et al, (1990), Nature 348, 552-554; Marks, J. et al, (1992) Biotechnology 10, 779-783). The affinity of these antibodies can also be improved by chain shuffling (Clackson, T. et al, (1991) Nature 352, 624-628).
Antibodies generated by the above techniques, whether polyclonal or monoclonal, have additional utility in that they may be employed as reagents in immunoassays, radioimmunoassays (RIA) or enzyme-linked immunosorbent assays (ELISA). In these applications, the antibodies can be labelled with an analytically-detectable reagent such as a radioisotope, a fluorescent molecule or an enzyme.
Preferred nucleic acid molecules of the second and third aspects of the invention are those which encode the polypeptide sequence recited in SEQ ID NO:2, and functionally equivalent polypeptides, including active fragments of the LBDG14 polypeptide, such as a fragment including the LBDG14LBD region of the LBDG14 polypeptide sequence, or a homologue thereof. Nucleic acid molecules encompassing these stretches of sequence form a preferred embodiment of this aspect of the invention.
These nucleic acid molecules may be used in the methods and applications described herein. The nucleic acid molecules of the invention preferably comprise at least n consecutive nucleotides from the sequences disclosed herein where, depending on the particular sequence, n is 10 or more (for example, 12, 14, 15, 18, 20, 25, 30, 35, 40 or more).
The nucleic acid molecules of the invention also include sequences that are complementary to nucleic acid molecules described above (for example, for antisense or probing purposes). Nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance cDNA, synthetic DNA or genomic DNA. Such nucleic acid molecules may be obtained by cloning, by chemical synthetic techniques or by a combination thereof. The nucleic acid molecules can be prepared, for example, by chemical synthesis using techniques such as solid phase phosphoramidite chemical synthesis, from genomic or cDNA libraries or by separation from an organism. RNA molecules may generally be generated by the in vitro or in vivo transcription of DNA sequences.
The nucleic acid molecules may be double-stranded or single-stranded. Single-stranded DNA may be the coding strand, also known as the sense strand, or it may be the non- coding strand, also referred to as the anti-sense strand.
The term "nucleic acid molecule" also includes analogues of DNA and RNA, such as those containing modified backbones, and peptide nucleic acids (PNA). The term "PNA", as used herein, refers to an antisense molecule or an anti-gene agent which comprises an oligonucleotide of at least five nucleotides in length linked to a peptide backbone of amino acid residues, which preferably ends in lysine. The terminal lysine confers solubility to the composition. PNAs may be pegylated to extend their lifespan in a cell, where they preferentially bind complementary single stranded DNA and RNA and stop transcript elongation (Nielsen, P.E. et al. (1993) Anticancer Drug Des. 8:53-63).
A nucleic acid molecule which encodes the polypeptide of SEQ ID NO:2, or an active fragment thereof, may be identical to the coding sequence of the nucleic acid molecule shown in SEQ ID NO:l. A nucleic acid molecule which encodes the polypeptide of SEQ ID NO:32, or an active fragment thereof, may be identical to the coding sequence of the nucleic acid molecule shown in SEQ ID NO:31. These molecules also may have a different sequence which, as a result of the degeneracy of the genetic code, encodes the polypeptide SEQ ID NO:2, or an active fragment of the LBDG14 polypeptide, such as a fragment including the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region, or a homologue thereof. The LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region is considered to extend between residue 248 and residue 433 of the LBDG14 polypeptide sequence. In SEQ ID NO:l the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region is thus encoded by a nucleic acid molecule including nucleotide 742 to nucleotide 1299. Nucleic acid molecules encompassing this stretch of sequence, and homologues of this sequence, form a preferred embodiment of this aspect of the invention.
Such nucleic acid molecules that encode the polypeptide of SEQ ID NO:2 or SEQ ID NO:32 may include, but are not limited to, the coding sequence for the mature polypeptide by itself; the coding sequence for the mature polypeptide and additional coding sequences, such as those encoding a leader or secretory sequence, such as a pro-, pre- or prepro- polypeptide sequence; the coding sequence of the mature polypeptide, with or without the aforementioned additional coding sequences, together with further additional, non-coding sequences, including non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription (including termination signals), ribosome binding and mRNA stability. The nucleic acid molecules may also include additional sequences which encode additional amino acids, such as those which provide additional functionalities. The nucleic acid molecules of the second and third aspects of the invention may also encode the fragments or the functional equivalents of the polypeptides and fragments of the first aspect of the invention.
As discussed above, a preferred fragment of the LBDG14 polypeptide is a fragment including the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region, or a homologue thereof. The Nuclear Hormone Receptor Ligand Binding Domain region is encoded by, at the most, a nucleic acid molecule including nucleotides 742 to 1299 of SEQ ID NO:l. For extended variants of these fragment, also included within the scope of this aspect of the invention, polynucleotide sequences which encode the Nuclear Hormone Receptor Ligand Binding Domain regions of the LBDG14 polypeptide will encode correctly folded LBDs that show Nuclear Hormone Receptor Ligand Binding Domain activity if additional residues 5' and/or 3' nucleotides terminal of these boundaries in the polynucleotide sequence are included in the polynucleotide fragment. For example, an additional 5, 15, 60, 90, 120 or even 150 or more nucleotides from the LBDG14 sequence may be included. Functionally-equivalent nucleic acid molecules according to the invention may be naturally-occurring variants such as a naturally-occurring allelic variant, or the molecules may be a variant that is not known to occur naturally. Such non-naturally occurring variants of the nucleic acid molecule may be made by mutagenesis techniques, including those applied to nucleic acid molecules, cells or organisms. Among variants in this regard are variants that differ from the aforementioned nucleic acid molecules by nucleotide substitutions, deletions or insertions. The substitutions, deletions or insertions may involve one or more nucleotides. The variants may be altered in coding or non-coding regions or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or insertions. The nucleic acid molecules of the invention can also be engineered, using methods generally known in the art, for a variety of reasons, including modifying the cloning, processing, and/or expression of the gene product (the polypeptide). DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides are included as techniques which may be used to engineer the nucleotide sequences. Site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, introduce mutations and so forth.
Nucleic acid molecules which encode a polypeptide of the first aspect of the invention may be ligated to a heterologous sequence so that the combined nucleic acid molecule encodes a fusion protein. Such combined nucleic acid molecules are included within the second or third aspects of the invention. For example, to screen peptide libraries for inhibitors of the activity of the polypeptide, it may be useful to express, using such a combined nucleic acid molecule, a fusion protein that can be recognised by a commercially-available antibody. A fusion protein may also be engineered to contain a cleavage site located between the sequence of the polypeptide of the invention and the sequence of a heterologous protein so that the polypeptide may be cleaved and purified away from the heterologous protein.
The nucleic acid molecules of the invention also include antisense molecules that are partially complementary to nucleic acid molecules encoding polypeptides of the present invention and that therefore hybridize to the encoding nucleic acid molecules (hybridization). Such antisense molecules, such as oligonucleotides, can be designed to recognise, specifically bind to and prevent transcription of a target nucleic acid encoding a polypeptide of the invention, as will be known by those of ordinary skill in the art (see, for example, Cohen, J.S., Trends in Pharm. Sci., 10, 435 (1989), Okano, J. Neurochem. 56, 560 (1991); O'Connor, J. Neurochem 56, 560 (1991); Lee et al, Nucleic Acids Res 6, 3073 (1979); Cooney et al, Science 241, 456 (1988); Dervan et al, Science 251, 1360 (1991).
The term "hybridization" as used here refers to the association of two nucleic acid molecules with one another by hydrogen bonding. Typically, one molecule will be fixed to a solid support and the other will be free in solution. Then, the two molecules may be placed in contact with one another under conditions that favour hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase molecule to the solid support (Denhardt's reagent or BLOTTO); the concentration of the molecules; use of compounds to increase the rate of association of molecules (dextran sulphate or polyethylene glycol); and the stringency of the washing conditions following hybridization (see Sambrook et al. [supra]).
The inhibition of hybridization of a completely complementary molecule to a target molecule may be examined using a hybridization assay, as known in the art (see, for example, Sambrook et al. [supra]). A substantially homologous molecule will then compete for and inhibit the binding of a completely homologous molecule to the target molecule under various conditions of stringency, as taught in Wahl, G.M. and S.L. Berger (1987; Methods Enzymol. 152:399-407) and Kimmel, A.R. (1987; Methods Enzymol. 152:507-511). "Stringency" refers to conditions in a hybridization reaction that favour the association of very similar molecules over association of molecules that differ. High stringency hybridisation conditions are defined as overnight incubation at 42°C in a solution comprising 50% formamide, 5XSSC (150mM NaCl, 15mM trisodium citrate), 50mM sodium phosphate (pH7.6), 5x Denhardts solution, 10% dextran sulphate, and 20 microgram/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1X SSC at approximately 65°C. Low stringency conditions involve the hybridisation reaction being carried out at 35°C (see Sambrook et al [supra). Preferably, the conditions used for hybridization are those of high stringency. Preferred embodiments of this aspect of the invention are nucleic acid molecules that are at least 70% identical over their entire length to a nucleic acid molecule encoding the LBDG14 polypeptide (SEQ ID NO:2) or the extended LBDG14 polypeptide (SEQ ID NO:32), and nucleic acid molecules that are substantially complementary to such nucleic acid molecules. A preferred active fragment is a fragment that includes the LBDG14LBD region of the LBDG14 polypeptide sequences, respectively. Accordingly, preferred nucleic acid molecules include those that are at least 70% identical over their entire length to a nucleic acid molecule encoding the LBDG14LBD region of the LBDG14 polypeptide sequence, wherein percentage identity is as determined using BLAST version 2.1.3 using the default parameters specified by the NCBI (the National Center for Biotechnology Information; http://www.ncbi.nlm.nih.gov/). Preferably, a nucleic acid molecule according to this aspect of the invention comprises a region that is at least 80% identical over its entire length to the nucleic acid molecule having the sequence given in SEQ ID NO:l, to a region including nucleotides 1486-2136 of this sequence, or a nucleic acid molecule that is complementary to any one of these regions of nucleic acid. In this regard, nucleic acid molecules at least 90%, preferably at least 95%, more preferably at least 98% or 99% identical over their entire length to the same are particularly preferred. Preferred embodiments in this respect are nucleic acid molecules that encode polypeptides which retain Nuclear Hormone Receptor Ligand Binding Domain activity.
The invention also provides a process for detecting a nucleic acid molecule of the invention, comprising the steps of: (a) contacting a nucleic probe according to the invention with a biological sample under hybridizing conditions to form duplexes; and (b) detecting any such duplexes that are formed.
As discussed additionally below in connection with assays that may be utilised according to the invention, a nucleic acid molecule as described above may be used as a hybridization probe for RNA, cDNA or genomic DNA, in order to isolate full-length cDNAs and genomic clones encoding the LBDG14 polypeptide and to isolate cDNA and genomic clones of homologous or orthologous genes that have a high sequence similarity to the gene encoding this polypeptide.
In this regard, the following techniques, among others known in the art, may be utilised and are discussed below for purposes of illustration. Methods for DNA sequencing and analysis are well known and are generally available in the art and may, indeed, be used to practise many of the embodiments of the invention discussed herein. Such methods may employ such enzymes as the Klenow fragment of DNA polymerase I, Sequenase (US Biochemical Corp, Cleveland, OH), Taq polymerase (Perkin Elmer), thermostable T7 polymerase (Amersham, Chicago, IL), or combinations of polymerases and proof-reading exonucleases such as those found in the ELONGASE Amplification System marketed by Gibco/BRL (Gaithersburg, MD). Preferably, the sequencing process may be automated using machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), the Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) and the ABI Catalyst and 373 and 377 DNA Sequencers (Perkin Elmer). One method for isolating a nucleic acid molecule encoding a polypeptide with an equivalent function to that of the LBDG14 polypeptide, particularly with an equivalent function to the LBDG14 Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide, is to probe a genomic or cDNA library with a natural or artificially-designed probe using standard procedures that are recognised in the art (see, for example, "Current Protocols in Molecular Biology", Ausubel et al. (eds). Greene Publishing Association and John Wiley Interscience, New York, 1989,1992). Probes comprising at least 15, preferably at least 30, and more preferably at least 50, contiguous bases that correspond to, or are complementary to, nucleic acid sequences from the appropriate encoding gene (SEQ ID NO:l), particularly a region from nucleotides 742- 1299 of SEQ ID NO: 1 , are particularly useful probes. Such probes may be labelled with an analytically-detectable reagent to facilitate their identification. Useful reagents include, but are not limited to, radioisotopes, fluorescent dyes and enzymes that are capable of catalysing the formation of a detectable product. Using these probes, the ordinarily skilled artisan will be capable of isolating complementary copies of genomic DNA, cDNA or RNA polynucleotides encoding proteins of interest from human, mammalian or other animal sources and screening such sources for related sequences, for example, for additional members of the family, type and/or subtype.
In many cases, isolated cDNA sequences will be incomplete, in that the region encoding the polypeptide will be cut short, normally at the 5' end. Several methods are available to obtain full length cDNAs, or to extend short cDNAs. Such sequences may be extended utilising a partial nucleotide sequence and employing various methods known in the art to detect upstream sequences such as promoters and regulatory elements. For example, one method which may be employed is based on the method of Rapid Amplification of cDNA Ends (RACE; see, for example, Frohman et al, Proc. Natl. Acad. Sci. USA (1988) 85: 8998-9002). Recent modifications of this technique, exemplified by the MarathonTM technology (Clontech Laboratories Inc.), for example, have significantly simplified the search for longer cDNAs. A slightly different technique, termed "restriction-site" PCR, uses universal primers to retrieve unknown nucleic acid sequence adjacent a known locus (Sarkar, G. (1993) PCR Methods Applic. 2:318-322). Inverse PCR may also be used to amplify or to extend sequences using divergent primers based on a known region (Triglia, T., et al. (1988) Nucleic Acids Res. 16:8186). Another method which may be used is capture PCR which involves PCR amplification of DNA fragments adjacent a known sequence in human and yeast artificial chromosome DNA (Lagerstrom, M. et al (1991) PCR Methods Applic. 1: 111-119). Another method which may be used to retrieve unknown sequences is that of Parker, J.D. et al (1991); Nucleic Acids Res. 19:3055- 3060). Additionally, one may use PCR, nested primers, and PromoterFinderTM libraries to walk genomic DNA (Clontech, Palo Alto, CA). This process avoids the need to screen libraries and is useful in finding intron/exon junctions. When screening for full-length cDNAs, it is preferable to use libraries that have been size-selected to include larger cDNAs. Also, random-primed libraries are preferable, in that they will contain more sequences that contain the 5' regions of genes. Use of a randomly primed library may be especially preferable for situations in which an oligo d(T) library does not yield a full-length cDNA. Genomic libraries may be useful for extension of sequence into 5' non-transcribed regulatory regions. In one embodiment of the invention, the nucleic acid molecules of the present invention may be used for chromosome localisation. In this technique, a nucleic acid molecule is specifically targeted to, and can hybridize with, a particular location on an individual human chromosome. The mapping of relevant sequences to chromosomes according to the present invention is an important step in the confirmatory correlation of those sequences with the gene-associated disease. Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found in, for example, V. McKusick, Mendelian Inheritance in Man (available on-line through Johns Hopkins University Welch Medical Library). The relationships between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes). This provides valuable information to investigators searching for disease genes using positional cloning or other gene discovery techniques. Once the disease or syndrome has been crudely localised by genetic linkage to a particular genomic region, any sequences mapping to that area may represent associated or regulatory genes for further investigation. The nucleic acid molecule may also be used to detect differences in the chromosomal location due to translocation, inversion, etc. among normal, carrier, or affected individuals.
The nucleic acid molecules of the present invention are also valuable for tissue localisation. Such techniques allow the determination of expression patterns of the polypeptide in tissues by detection of the mRNAs that encode them. These techniques include in situ hybridization techniques and nucleotide amplification techniques, such as PCR. Results from these studies provide an indication of the normal functions of the polypeptide in the organism. In addition, comparative studies of the normal expression pattern of mRNAs with that of mRNAs encoded by a mutant gene provide valuable insights into the role of mutant polypeptides in disease. Such inappropriate expression may be of a temporal, spatial or quantitative nature. Gene silencing approaches may also be undertaken to down-regulate endogenous expression of a gene encoding a polypeptide of the invention. RNA interference (RNAi) (Elbashir, SM et al. , Nature 2001, 411, 494-498) is one method of sequence specific post- transcriptional gene silencing that may be employed. Short dsRNA oligonucleotides are synthesised in vitro and introduced into a cell. The sequence specific binding of these dsRNA oligonucleotides triggers the degradation of target mRNA, reducing or ablating target protein expression.
Efficacy of the gene silencing approaches assessed above may be assessed through the measurement of polypeptide expression (for example, by Western blotting), and at the RNA level using TaqMan-based methodologies.
The vectors of the present invention comprise nucleic acid molecules of the invention and may be cloning or expression vectors. The host cells of the invention, which may be transformed, transfected or transduced with the vectors of the invention may be prokaryotic or eukaryotic. The polypeptides of the invention may be prepared in recombinant form by expression of their encoding nucleic acid molecules in vectors contained within a host cell. Such expression methods are well known to those of skill in the art and many are described in detail by Sambrook et al. (supra) and Fernandez & Hoeffler (1998, eds. "Gene expression systems. Using nature for the art of expression". Academic Press, San Diego, London, Boston, New York, Sydney, Tokyo, Toronto).
Generally, any system or vector that is suitable to maintain, propagate or express nucleic acid molecules to produce a polypeptide in the required host may be used. The appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-known and routine techniques, such as, for example, those described in Sambrook et al, (supra). Generally, the encoding gene can be placed under the control of a control element such as a promoter, ribosome binding site (for bacterial expression) and, optionally, an operator, so that the DNA sequence encoding the desired polypeptide is transcribed into RNA in the transformed host cell.
Examples of suitable expression systems include, for example, chromosomal, episomal and virus-derived systems, including, for example, vectors derived from: bacterial plasmids, bacteriophage, transposons, yeast episomes, insertion elements, yeast chromosomal elements, viruses such as baculoviruses, papova viruses such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, or combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, including cosmids and phagemids. Human artificial chromosomes (HACs) may also be employed to deliver larger fragments of DNA than can be contained and expressed in a plasmid.
Particularly suitable expression systems include microorgamsms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (for example, baculo virus); plant cell systems transformed with virus expression vectors (for example, cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (for example, Ti or pBR322 plasmids); or animal cell systems. Cell-free translation systems can also be employed to produce the polypeptides of the invention.
Introduction of nucleic acid molecules encoding a polypeptide of the present invention into host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al, Basic Methods in Molecular Biology (1986) and Sambrook et al, [supra]. Particularly suitable methods include calcium phosphate transfection, DEAE-dextran mediated transfection, fransvection, microinjection, cationic lipid- mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection (see Sambrook et al, 1989 [supra]; Ausubel et al, 1991 [supra]; Spector, Goldman & Leinwald, 1998). In eukaryotic cells, expression systems may either be transient (for example, episomal) or permanent (chromosomal integration) according to the needs of the system.
The encoding nucleic acid molecule may or may not include a sequence encoding a control sequence, such as a signal peptide or leader sequence, as desired, for example, for secretion of the translated polypeptide into the lumen of the endoplasmic reticulum, into the periplasmic space or into the extracellular environment. These signals may be endogenous to the polypeptide or they may be heterologous signals. Leader sequences can be removed by the bacterial host in post-translational processing.
In addition to control sequences, it may be desirable to add regulatory sequences that allow for regulation of the expression of the polypeptide relative to the growth of the host cell. Examples of regulatory sequences are those which cause the expression of a gene to be increased or decreased in response to a chemical or physical stimulus, including the presence of a regulatory compound or to various temperature or metabolic conditions. Regulatory sequences are those non-translated regions of the vector, such as enhancers, promoters and 5' and 3' untranslated regions. These interact with host cellular proteins to carry out transcription and translation. Such regulatory sequences may vary in their strength and specificity. Depending on the vector system and host utilised, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lacZ promoter of the Bluescript phagemid (Stratagene, LaJolla, CA) or pSportl™ plasmid (Gibco BRL) and the like may be used. The baculovirus polyhedrin promoter may be used in insect cells. Promoters or enhancers derived from the genomes of plant cells (for example, heat shock, RUBISCO and storage protein genes) or from plant viruses (for example, viral promoters or leader sequences) may be cloned into the vector. In mammalian cell systems, promoters from mammalian genes or from mammalian viruses are preferable. If it is necessary to generate a cell line that contains multiple copies of the sequence, vectors based on SV40 or EBV may be used with an appropriate selectable marker.
An expression vector is constructed so that the particular nucleic acid coding sequence is located in the vector with the appropriate regulatory sequences, the positioning and orientation of the coding sequence with respect to the regulatory sequences being such that the coding sequence is transcribed under the "control" of the regulatory sequences, i.e., RNA polymerase which binds to the DNA molecule at the control sequences transcribes the coding sequence. In some cases it may be necessary to modify the sequence so that it may be attached to the control sequences with the appropriate orientation; i.e., to maintain the reading frame. The control sequences and other regulatory sequences may be ligated to the nucleic acid coding sequence prior to insertion into a vector. Alternatively, the coding sequence can be cloned directly into an expression vector that already contains the control sequences and an appropriate restriction site. For long-term, high-yield production of a recombinant polypeptide, stable expression is preferred. For example, cell lines which stably express the polypeptide of interest may be transformed using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media. The purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type. Mammalian cell lines available as hosts for expression are known in the art and include many immortalised cell lines available from the American Type Culture Collection (ATCC) including, but not limited to, Chinese hamster ovary (CHO), HeLa, baby hamster kidney (BHK), monkey kidney (COS), C127, 3T3, BHK, HEK 293, Bowes melanoma and human hepatocellular carcinoma (for example Hep G2) cells and a number of other cell lines.
In the baculovirus system, the materials for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego CA (the "MaxBac" kit). These techniques are generally known to those skilled in the art and are described fully in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987). Particularly suitable host cells for use in this system include insect cells such as Drosophila S2 and Spodoptera Sf9 cells.
There are many plant cell culture and whole plant genetic expression systems known in the art. Examples of suitable plant cellular genetic expression systems include those described in US 5,693,506; US 5,659,122; and US 5,608,143. Additional examples of genetic expression in plant cell culture has been described by Zenk, (1991) Phytochemistry 30, 3861-3863.
In particular, all plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be utilised, so that whole plants are recovered which contain the transferred gene. Practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugar cane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
Examples of particularly preferred bacterial host cells include streptococci, staphylococci, E. coli, Streptomyces and Bacillus subtilis cells.
Examples of particularly suitable host cells for fungal expression include yeast cells (for example, S. cerevisiae) and Aspergϊllus cells.
Any number of selection systems are known in the art that may be used to recover transformed cell lines. Examples include the herpes simplex virus thymidine kinase (Wigler, M. et al (1977) Cell 11:223-32) and adenine phosphoribosylfransferase (Lowy, I. et al. (1980) Cell 22:817-23) genes that can be employed in tk" or anx cells, respectively.
Also, antimetabolite, antibiotic or herbicide resistance can be used as the basis for selection; for example, dihydrofolate reductase (DHFR) that confers resistance to methotrexate (Wigler, M. et αl. (1980) Proc. Natl. Acad. Sci. 77:3567-70); npt, which confers resistance to the aminoglycosides neomycin and G-418 (Colbere-Garapin, F. et αl. (1981) J. Mol. Biol. 150:1-14) and als or pat, which confer resistance to chlorsulfuron and phosphinotricin acetyltransferase, respectively. Additional selectable genes have been described, examples of which will be clear to those of skill in the art.
Although the presence or absence of marker gene expression suggests that the gene of interest is also present, its presence and expression may need to be confirmed. For example, if the relevant sequence is inserted within a marker gene sequence, transformed cells containing the appropriate sequences can be identified by the absence of marker gene function. Alternatively, a marker gene can be placed in tandem with a sequence encoding a polypeptide of the invention under the control of a single promoter. Expression of the marker gene in response to induction or selection usually indicates expression of the tandem gene as well.
Alternatively, host cells that contain a nucleic acid sequence encoding a polypeptide of the invention and which express said polypeptide may be identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA-DNA or DNA-RNA hybridizations and protein bioassays, for example, fluorescence activated cell sorting (FACS) or immunoassay techniques (such as the enzyme-linked immunosorbent assay [ELISA] and radioimmunoassay [RIA]), that include membrane, solution, or chip based technologies for the detection and/or quantification of nucleic acid or protein (see Hampton, R. et al. (1990) Serological Methods, a Laboratory Manual, APS Press, St Paul, MN) and Maddox, D.E. et al. (1983) J. Exp. Med, 158, 1211-1216).
A wide variety of labels and conjugation techniques are known by those skilled in the art and may be used in various nucleic acid and amino acid assays. Means for producing labelled hybridization or PCR probes for detecting sequences related to nucleic acid molecules encoding polypeptides of the present invention include oligolabelling, nick translation, end-labelling or PCR amplification using a labelled polynucleotide. Alternatively, the sequences encoding the polypeptide of the invention may be cloned into a vector for the production of an mRNA probe. Such vectors are known in the art, are commercially available, and may be used to synthesise RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3 or SP6 and labelled nucleotides. These procedures may be conducted using a variety of commercially available kits (Pharmacia & Upjohn, (Kalamazoo, MI); Promega (Madison WI); and U.S. Biochemical Corp., Cleveland, OH)).
Suitable reporter molecules or labels, which may be used for ease of detection, include radionuclides, enzymes and fluorescent, chemiluminescent or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
Nucleic acid molecules according to the present invention may also be used to create transgenic animals, particularly rodent animals. Such transgenic animals form a further aspect of the present invention. This may be done locally by modification of somatic cells, or by germ line therapy to incorporate heritable modifications. Such transgenic animals may be particularly useful in the generation of animal models for drug molecules effective as modulators of the polypeptides of the present invention.
The polypeptide can be recovered and purified from recombinant cell cultures by well- known methods including ammonium sulphate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography is particularly useful for purification. Well known techniques for refolding proteins may be employed to regenerate an active conformation when the polypeptide is denatured during isolation and or purification.
Specialised vector constructions may also be used to facilitate purification of proteins, as desired, by joining sequences encoding the polypeptides of the invention to a nucleotide sequence encoding a polypeptide domain that will facilitate purification of soluble proteins. Examples of such purification-facilitating domains include metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilised metals, protein A domains that allow purification on immobilised immunoglobulin, and the domain utilised in the FLAGS extension/affinity purification system (Immunex Corp., Seattle, WA). The inclusion of cleavable linker sequences such as those specific for Factor XA or enterokinase (Invitrogen, San Diego, CA) between the purification domain and the polypeptide of the invention may be used to facilitate purification. One such expression vector provides for expression of a fusion protein containing the polypeptide of the invention fused to several histidine residues preceding a thioredoxin or an enterokinase cleavage site. The histidine residues facilitate purification by IMAC (immobilised metal ion affinity chromatography as described in Porath, J. et al. (1992) Prot. Exp. Purif. 3: 263-281) while the thioredoxin or enterokinase cleavage site provides a means for purifying the polypeptide from the fusion protein. A discussion of vectors which contain fusion proteins is provided in Kroll, D.J. et al (DNA Cell Biol. 199312:441-453).
If the polypeptide is to be expressed for use in screening assays, generally it is preferred that it be produced at the surface of the host cell in which it is expressed. In this event, the host cells may be harvested prior to use in the screening assay, for example using techniques such as fluorescence activated cell sorting (FACS) or immunoaffinity techniques. If the polypeptide is secreted into the medium, the medium can be recovered in order to recover and purify the expressed polypeptide. If polypeptide is produced intracellularly, the cells must first be lysed before the polypeptide is recovered.
The polypeptide of the invention can be used to screen libraries of compounds in any of a variety of drug screening techniques. Such compounds may activate (agonise) or inhibit (antagonise) the level of expression of the gene or the activity of the polypeptide of the invention and form a further aspect of the present invention. Preferred compounds are effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the first aspect of the invention.
Agonist or antagonist compounds may be isolated from, for example, cells, cell-free preparations, chemical libraries or natural product mixtures. These agonists or antagonists may be natural or modified substrates, ligands, enzymes, receptors or structural or functional mimetics. For a suitable review of such screening techniques, see Coligan et al, Current Protocols in Immunology l(2):Chapter 5 (1991).
Compounds that are most likely to be good agonists and antagonists are molecules that bind to the polypeptide of the invention modulating the biological effects of the polypeptide upon binding to it. Potential agonists and antagonists include small organic molecules, peptides, polypeptides and antibodies that bind to the polypeptide of the invention and thereby activate, inhibit or extinguish its activity. In particular, a low molecular weight compound representative of retinoid modulators has been demonstrated herein to activate with high affinity to the polypeptides of the invention. In this fashion, binding of the polypeptide to normal cellular binding molecules may be modulated, such that the normal biological activity of the polypeptide is enhanced, or decreased for therapeutic utility.
The functional effects for the nuclear receptor gene family are typically modified by ligands, either with transcription being upregulated or downregulated by addition of a ligand. These ligands may either be therapeutic agents themselves, or form the basis for novel therapeutic agents. The set of ligands that known nuclear receptor ligand binding domains interact with, include, but are not limited by, steroid, fatty acid, vitamins, and similar molecules. Modulation of the transcriptional activity of nuclear receptors by such ligand is thus indicative of their functional activity.
Given the known natural ligands for established nuclear receptors, we searched for chemically similar compounds from the Available Chemical Directory (ACD), using standard compound similarity searching tools (supplied by MDL, San Leandro, CA). We additionally generated a number of 3D pharmacophores for known nuclear receptors, using our Chematica suite of software (see International patent application PCT/GB01/02177), and used these to search for compounds displaying potentially NR specific interaction properties. By following this method, which can be achieved alternatively using a variety of different 2D and 3D searching approaches, we had generated a set of 2,469 ligands, as probes for NR function.
The polypeptide of the invention that is employed in such a screening technique may be free in solution, affixed to a solid support, borne on a cell surface or located intracellularly. In general, such screening procedures may involve using appropriate cells or cell membranes that express the polypeptide that are contacted with a test compound to observe binding, or stimulation or inhibition of a functional response. The functional response of the cells contacted with the test compound is then compared with control cells that were not contacted with the test compound. Such an assay may assess whether the test compound results in a signal generated by activation of the polypeptide, using an appropriate detection system. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist in the presence of the test compound is observed.
Methods for generating detectable signals in the types of assays described herein will be known to those of skill in the art. A particular example is cotransfecting a construct expressing a polypeptide according to the invention, or a fragment such as the LBD, in fusion with the GAL4 DNA binding domain, into a cell together with a reporter plasmid, an example of which is pFR-Luc (Stratagene Europe, Amsterdam, The Netherlands). This particular plasmid contains a synthetic promoter with five tandem repeats of GAL4 binding sites that control the expression of the luciferase gene. When a potential ligand is added to the cells, it will bind the GAL4-polypeptide fusion and induce transcription of the luciferase gene. The level of the luciferase expression can be monitored by its activity using a luminescence reader (see, for example, Lehman et al JBC 270, 12953, 1995; Pawar et al. JBC, 277, 39243, 2002). A further preferred method for identifying an agonist or antagonist of a polypeptide of the invention comprises:
(a) contacting a labelled or unlabeled compound with the polypeptide immobilized on any solid support (for example beads, plates, matrix support, chip) and detection of the compound by measuring the label or the presence of the compound itself; or (b) contacting a cell expressing on the surface thereof the polypeptide, by means of artificially anchoring it to the cell membrane, or by constructing a chimeric receptor being associated with a second component capable of providing a detectable signal in response to the binding of a compound to the polypeptide, with a compound to be screened under conditions to permit binding to the polypeptide; and (c) determining whether the compound binds to and activates or inhibits the polypeptide by comparing the level of a signal generated from the interaction of the compound with the polypeptide with the level of a signal in the absence of the compound.
For example, a method such as FRET detection of a ligand bound to the polypeptide in the presence of peptide co-activators (Norris et al, Science 285, 744, 1999) might be used.
In further preferred embodiments, the general methods that are described above may further comprise conducting the identification of agonist or antagonist in the presence of labelled or unlabelled ligand for the polypeptide.
In another embodiment of the method for identifying agonist or antagonist of a polypeptide of the present invention comprises: determining the inhibition of binding of a ligand to the polypeptide of the invention on any solid or cellular surface thereof, in the presence of a candidate compound under conditions to permit binding to the polypeptide, and determining the amount of ligand bound to the polypeptide. A compound capable of causing reduction of binding of a ligand is considered to be a competitor which may act as an agonist or antagonist. Preferably the ligand is labelled.
More particularly, a method of screening for a polypeptide antagonist or agonist compound comprises the steps of: (a) incubating a labelled ligand with a polypeptide according to the invention on any solid support or the cell surface, or a cell membrane containing a polypeptide of the invention.
(b) measuring the amount of labelled ligand bound to the polypeptide on the solid support, whole cell or the cell membrane;
(c) adding a candidate compound to a mixture of labelled ligand and immobilized polypeptide on the solid support, the whole cell or the cell membrane of step (a) and allowing the mixture to attain equilibrium;
(d) measuring the amount of labelled ligand bound to the immobilized polypeptide or the whole cell or the cell membrane after step (c); and
(e) comparing the difference in the labelled ligand bound in step (b) and (d), such that the compound which causes the reduction in binding in step (d) is considered to be an agonist or antagonist.
The polypeptides may be found to modulate a variety of physiological and pathological processes in a dose-dependent manner in the above-described assays. Thus, the "functional equivalents" of the polypeptides of the invention include polypeptides that exhibit any of the same modulatory activities in the above-described assays in a dose- dependent manner. Although the degree of dose-dependent activity need not be identical to that of the polypeptides of the invention, preferably the "functional equivalents" will exhibit substantially similar dose-dependence in a given activity assay compared to the polypeptides of the invention. In certain of the embodiments described above, simple binding assays may be used, in which the adherence of a test compound to a surface bearing the polypeptide is detected by means of a label directly or indirectly associated with the test compound or in an assay involving competition with a labelled competitor. In another embodiment, competitive drug screening assays may be used, in which neutralising antibodies that are capable of binding the polypeptide specifically compete with a test compound for binding. In this manner, the antibodies can be used to detect the presence of any test compound that possesses specific binding affinity for the polypeptide.
Assays may also be designed to detect the effect of added test compounds on the production of mRNA encoding the polypeptide in cells. For example, an ELIS A may be constructed that measures secreted or cell-associated levels of polypeptide using monoclonal or polyclonal antibodies by standard methods known in the art, and this can be used to search for compounds that may inhibit or enhance the production of the polypeptide from suitably manipulated cells or tissues. The formation of binding complexes between the polypeptide and the compound being tested may then be measured.
Assay methods that are also included within the terms of the present invention are those that involve the use of the genes and polypeptides of the invention in overexpression or ablation assays. Such assays involve the manipulation of levels of these genes/polypeptides in cells and assessment of the impact of this manipulation event on the physiology of the manipulated cells. For example, such experiments reveal details of signalling and metabolic pathways in which the particular genes/polypeptides are implicated, generate information regarding the identities of polypeptides with which the studied polypeptides interact and provide clues as to methods by which related genes and proteins are regulated.
Another technique for drug screening which may be used provides for high throughput screening of compounds having suitable binding affinity to the polypeptide of interest (see International patent application WO84/03564). In this method, large numbers of different small test compounds are synthesised on a solid substrate, which may then be reacted with the polypeptide of the invention and washed. One way of immobilising the polypeptide is to use non-neutralising antibodies. Bound polypeptide may then be detected using methods that are well known in the art. Purified polypeptide can also be coated directly onto plates for use in the aforementioned drug screening techniques.
Examples of suitable assays for the identification of agonists or antagonists of the polypeptides of the invention are described in Rosen et al, Curr. Opin. Drug Discov. Devel. 2003 6(2):224-30.
The polypeptide of the invention may be used to identify membrane-bound or soluble receptors, through standard receptor binding techniques that are known in the art, such as ligand binding and crosslinking assays in which the polypeptide is labelled with a radioactive isotope, is chemically modified, or is fused to a peptide sequence that facilitates its detection or purification, and incubated with a source of the putative receptor (for example, a composition of cells, cell membranes, cell supematants, tissue extracts, or bodily fluids). The efficacy of binding may be measured using biophysical techniques such as surface plasmon resonance (supplied by Biacore AB, Uppsala, Sweden) and spectroscopy. Using such assays, it will be possible to investigate the degree to which polypeptides of the invention dimerise or oligomerise with other polypeptide molecules.
Binding assays may be used for the purification and cloning of the receptor, but may also identify agonists and antagonists of the polypeptide, that compete with the binding of the polypeptide to its receptor. Standard methods for conducting screening assays are well understood in the art.
The invention also includes a screening kit useful in the methods for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, that are described above.
The invention includes the agonists, antagonists, ligands, receptors, substrates and enzymes, and other compounds which modulate the activity or antigenicity of the polypeptide of the invention discovered by the methods that are described above.
The invention also provides pharmaceutical compositions comprising a polypeptide, nucleic acid, ligand or compound of the invention in combination with a suitable pharmaceutical carrier. These compositions may be suitable as therapeutic or diagnostic reagents, as vaccines, or as other immunogenic compositions, as outlined in detail below.
According to the terminology used herein, a composition containing a polypeptide, nucleic acid, ligand or compound [X] is "substantially free of impurities [herein, Y] when at least 85% by weight of the total X+Y in the composition is X. Preferably, X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95%, 98% or even 99% by weight.
The pharmaceutical compositions should preferably comprise a therapeutically effective amount of the polypeptide, nucleic acid molecule, ligand, or compound of the invention. The term "therapeutically effective amount" as used herein refers to an amount of a therapeutic agent needed to treat, ameliorate, or prevent a targeted disease or condition, or to exhibit a detectable therapeutic or preventative effect. For any compound, the therapeutically effective dose can be estimated initially either in cell culture assays, for example, of neoplastic cells, or in animal models, usually mice, rabbits, dogs, or pigs. The animal model may also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
The precise effective amount for a human subject will depend upon the severity of the disease state, general health of the subject, age, weight, and gender of the subject, diet, time and frequency of administration, drug combination(s), reaction sensitivities, and tolerance/response to therapy. This amount can be determined by routine experimentation and is within the judgement of the clinician. Generally, an effective dose will be from 0.01 mg/kg to 50 mg/kg, preferably 0.05 mg/kg to 10 mg/kg. Compositions may be administered individually to a patient or may be administered in combination with other agents, drugs or hormones. A pharmaceutical composition may also contain a pharmaceutically acceptable carrier, for administration of a therapeutic agent. Such carriers include antibodies and other polypeptides, genes and other therapeutic agents such as liposomes, provided that the carrier does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity. Suitable carriers may be large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharmaceutically acceptable carriers is available in Remington's Pharmaceutical Sciences (Mack Pub. Co., N.J. 1991).
Pharmaceutically acceptable carriers in therapeutic compositions may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for ingestion by the patient.
Once formulated, the compositions of the invention can be administered directly to the subject. The subjects to be treated can be animals; in particular, human subjects can be treated.
The pharmaceutical compositions utilised in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra- arterial, intramedullary, intrathecal, intraventricular, transdermal or transcutaneous applications (for example, see WO98/20734), subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal means. Gene guns or hyposprays may also be used to administer the pharmaceutical compositions of the invention. Typically, the therapeutic compositions may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
Direct delivery of the compositions will generally be accomplished by injection, subcutaneously, intraperitoneally, intravenously or intramuscularly, or delivered to the interstitial space of a tissue. The compositions can also be administered into a lesion. Dosage treatment may be a single dose schedule or a multiple dose schedule. If the activity of the polypeptide of the invention is in excess in a particular disease state, several approaches are available. One approach comprises administering to a subject an inhibitor compound (antagonist) as described above, along with a pharmaceutically acceptable carrier in an amount effective to inhibit the function of the polypeptide, such as by blocking the binding of ligands, substrates, enzymes, receptors, or by inhibiting a second signal, and thereby alleviating the abnormal condition. Preferably, such antagonists are antibodies. Most preferably, such antibodies are chimeric and/or humanised to minimise their immunogenicity, as described previously.
In another approach, soluble forms of the polypeptide that retain binding affinity for the ligand, substrate, enzyme, receptor, in question, may be administered. Typically, the polypeptide may be administered in the form of fragments that retain the relevant portions.
In an alternative approach, expression of the gene encoding the polypeptide can be inhibited using expression blocking techniques, such as the use of antisense nucleic acid molecules (as described above), either internally generated or separately administered. Modifications of gene expression can be obtained by designing complementary sequences or antisense molecules (DNA, RNA, or PNA) to the control, 5' or regulatory regions (signal sequence, promoters, enhancers and introns) of the gene encoding the polypeptide. Similarly, inhibition can be achieved using "triple helix" base-pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or regulatory molecules. Recent therapeutic advances using triplex DNA have been described in the literature (Gee, J.E. et al (1994) In: Huber, B.E. and B.I. Carr, Molecular and Immunologic Approaches, Furura Publishing Co., Mt. Kisco, NY). The complementary sequence or antisense molecule may also be designed to block translation of mRNA by preventing the transcript from binding to ribosomes. Such oligonucleotides may be administered or may be generated in situ from expression in vivo.
In addition, expression of the polypeptide of the invention may be prevented by using ribozymes specific to its encoding mRNA sequence. Ribozymes are catalytically active RNAs that can be natural or synthetic (see for example Usman, N, et al, Curr. Opin. Struct. Biol (1996) 6(4), 527-33). Synthetic ribozymes can be designed to specifically cleave mRNAs at selected positions thereby preventing translation of the mRNAs into functional polypeptide. Ribozymes may be synthesised with a natural ribose phosphate backbone and natural bases, as normally found in RNA molecules. Alternatively the ribozymes may be synthesised with non-natural backbones, for example, 2'-O-methyl RNA, to provide protection from ribonuclease degradation and may contain modified bases.
RNA molecules may be modified to increase intracellular stability and half-life. Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends of the molecule or the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages within the backbone of the molecule. This concept is inherent in the production of PNAs and can be extended in all of these molecules by the inclusion of non-traditional bases such as inosine, queosine and butosine, as well as acetyl-, methyl-, thio- and similarly modified forms of adenine, cytidine, guanine, thymine and uridine which are not as easily recognised by endogenous endonucleases. For treating abnormal conditions related to an under-expression of the polypeptide of the invention and its activity, several approaches are also available. One approach comprises administering to a subject a therapeutically effective amount of a compound that activates the polypeptide, i.e., an agonist as described above, to alleviate the abnormal condition. Alternatively, a therapeutic amount of the polypeptide in combination with a suitable pharmaceutical carrier may be administered to restore the relevant physiological balance of polypeptide.
Gene therapy may be employed to effect the endogenous production of the polypeptide by the relevant cells in the subject. Gene therapy is used to treat permanently the inappropriate production of the polypeptide by replacing a defective gene with a corrected therapeutic gene.
Gene therapy of the present invention can occur in vivo or ex vivo. Ex vivo gene therapy requires the isolation and purification of patient cells, the introduction of a therapeutic gene and introduction of the genetically altered cells back into the patient. In contrast, in vivo gene therapy does not require isolation and purification of a patient's cells. The therapeutic gene is typically "packaged" for administration to a patient. Gene delivery vehicles may be non-viral, such as liposom.es, or replication-deficient viruses, such as adenovirus as described by Berkner, K.L., in Curr. Top. Microbiol. Immunol., 158, 39-66 (1992) or adeno-associated virus (AAV) vectors as described by Muzyczka, N., in Curr. Top. Microbiol. Immunol., 158, 97-129 (1992) and U.S. Patent No. 5,252,479. For example, a nucleic acid molecule encoding a polypeptide of the invention may be engineered for expression in a replication-defective retroviral vector. This expression construct may then be isolated and introduced into a packaging cell transduced with a retroviral plasmid vector containing RNA encoding the polypeptide, such that the packaging cell now produces infectious viral particles containing the gene of interest. These producer cells may be administered to a subject for engineering cells in vivo and expression of the polypeptide in vivo (see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics (1996), T Strachan and A P Read, BIOS Scientific Publishers Ltd). Another approach is the administration of "naked DNA" in which the therapeutic gene is directly injected into the bloodstream or muscle tissue.
In situations in which the polypeptides or nucleic acid molecules of the invention are disease-causing agents, the invention provides that they can be used in vaccines to raise antibodies against the disease causing agent. Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat disease after infection). Such vaccines comprise immunising antigen(s), immunogen(s), polypeptide(s), protein(s) or nucleic acid, usually in combination with pharmaceutically-acceptable carriers as described above, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Additionally, these carriers may function as immunostimulating agents ("adjuvants"). Furthermore, the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, and other pathogens.
Since polypeptides may be broken down in the stomach, vaccines comprising polypeptides are preferably administered parenterally (for instance, subcutaneous, intramuscular, intravenous, or intradermal injection). Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents. The vaccine formulations of the invention may be presented in unit-dose or multi-dose containers. For example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use. The dosage will depend on the specific activity of the vaccine and can be readily determined by routine experimentation.
Genetic delivery of antibodies that bind to polypeptides according to the invention may also be effected, for example, as described in International patent application WO98/55607.
The technology referred to as jet injection (see, for example, www.powderject.com) may also be useful in the formulation of vaccine compositions.
A number of suitable methods for vaccination and vaccine delivery systems are described in International patent application WO00/29428.
This invention also relates to the use of nucleic acid molecules according to the present invention as diagnostic reagents. Detection of a mutated form of the gene characterised by the nucleic acid molecules of the invention which is associated with a dysfunction will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, or susceptibility to a disease, which results from under-expression, over-expression or altered spatial or temporal expression of the gene. Individuals carrying mutations in the gene may be detected at the DNA level by a variety of techniques. Nucleic acid molecules for diagnosis may be obtained from a subject's cells, such as from blood, urine, saliva, tissue biopsy or autopsy material. The genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR, ligase chain reaction (LCR), strand displacement amplification (SDA), or other amplification techniques (see Saiki et al, Nature, 324, 163-166 (1986); Bej, et al, Crit. Rev. Biochem. Molec. Biol., 26, 301-334 (1991); Birkenmeyer et al, J. Virol. Meth., 35, 117-126 (1991); Van Brunt, J., Bio/Technology, 8, 291-294 (1990)) prior to analysis.
In one embodiment, this aspect of the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide according to the invention and comparing said level of expression to a control level, wherein a level that is different to said control level is indicative of disease. The method may comprise the steps of: a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule of the invention and the probe; b) contacting a control sample with said probe under the same conditions used in step a); c) and detecting the presence of hybrid complexes in said samples; wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease. Using such methods, an approximate 2-fold elevation of transcript levels was observed in activated neufrophils and in Schwamiomas and sarcomas of the small intestine and stomach. A small reduction in expression of transcript for LBDG14 was observed in squamous cell carcinoma of the lung, neuroendocrine carcinoma of the lung, malignant lymphomas adenocarcinoma of the colon and seminoma of the testis. These data indicates that transcripts of this gene are altered in a variety of tumour types. Identifying the tumour types that possess elevated or suppressed LBDG14 transcript levels may be of value in diagnostics for particular cancer subtypes and thereby, define the particular therapeutic approach for individual patients. In addition, development of agonists and antagonists for LDBG14 will be of value in treating cancer. The finding of an elevation of LBDG14 transcripts in activated neufrophils suggests that this nuclear receptor is involved in regulating neutrophil function. Thus, agonists and antagonists will be of value in treating disease conditions in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD). In addition, regulating neutrophil function is of value in treating infections and wound healing. A further aspect of the invention comprises a diagnostic method comprising the steps of: a) obtaining a tissue sample from a patient being tested for disease; b) isolating a nucleic acid molecule according to the invention from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation in the nucleic acid molecule which is associated with disease.
To aid the detection of nucleic acid molecules in the above-described methods, an amplification step, for example using PCR, may be included. Suitable probes are discussed in some detail above. Deletions and insertions can be detected by a change in the size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to labelled RNA of the invention or alternatively, labelled antisense DNA sequences of the invention. Perfectly-matched sequences can be distinguished from mismatched duplexes by RNase digestion or by assessing differences in melting temperatures. The presence or absence of the mutation in the patient may be detected by contacting DNA with a nucleic acid probe that hybridises to the DNA under stringent conditions to form a hybrid double-stranded molecule, the hybrid double-stranded molecule having an unhybridised portion of the nucleic acid probe strand at any portion corresponding to a mutation associated with disease; and detecting the presence or absence of an unhybridised portion of the probe strand as an indication of the presence or absence of a disease-associated mutation in the corresponding portion of the DNA strand.
Such diagnostics are particularly useful for prenatal and even neonatal testing.
Point mutations and other sequence differences between the reference gene and "mutant" genes can be identified by other well-known techniques, such as direct DNA sequencing or single-strand conformational polymorphism, (see Orita et al, Genomics, 5, 874-879 (1989)). For example, a sequencing primer may be used with double-stranded PCR product or a single-stranded template molecule generated by a modified PCR. The sequence determination is performed by conventional procedures with radiolabelled nucleotides or by automatic sequencing procedures with fluorescent-tags. Cloned DNA segments may also be used as probes to detect specific DNA segments. The sensitivity of this method is greatly enhanced when combined with PCR. Further, point mutations and other sequence variations, such as polymorphisms, can be detected as described above, for example, through the use of allele-specific oligonucleotides for PCR amplification of sequences that differ by single nucleotides.
DNA sequence differences may also be detected by alterations in the electrophoretic mobility of DNA fragments in gels, with or without denaturing agents, or by direct DNA sequencing (for example, Myers et al, Science (1985) 230:1242). Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and SI protection or the chemical cleavage method (see Cotton et al, Proc. Natl. Acad. Sci. USA (1985) 85: 4397-4401).
In addition to conventional gel elecfrophoresis and DNA sequencing, mutations such as microdeletions, aneuploidies, translocations, inversions, can also be detected by in situ analysis (see, for example, Keller et al., DNA Probes, 2nd Ed., Stockton Press, New York, N.Y., USA (1993)), that is, DNA or RNA sequences in cells can be analysed for mutations without need for their isolation and/or immobilisation onto a membrane. Fluorescence in situ hybridization (FISH) is presently the most commonly applied method and numerous reviews of FISH have appeared (see, for example, Trachuck et al, Science, 250: 559-562 (1990), and Trask et al, Trends, Genet. 7:149-154 (1991)). In another embodiment of the invention, an array of oligonucleotide probes comprising a nucleic acid molecule according to the invention can be constructed to conduct efficient screening of genetic variants, mutations and polymorphisms. Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see for example: M.Chee et al, Science (1996) 274: 610-613).
In one embodiment, the array is prepared and used according to the methods described in PCT application WO95/11995 (Chee et al); Lockhart, D. J. et al. (1996) Nat. Biotech. 14: 1675-1680); and Schena, M. et al (1996) Proc. Natl. Acad. Sci. 93: 10614-10619). Oligonucleotide pairs may range from two to over one million. The oligomers are synthesized at designated areas on a substrate using a light-directed chemical process. The substrate may be paper, nylon or other type of membrane, filter, chip, glass slide or any other suitable solid support. In another aspect, an oligonucleotide may be synthesized on the surface of the substrate by using a chemical coupling procedure and an ink jet application apparatus, as described in PCT application WO95/25116 (Baldeschweiler et al). In another aspect, a "gridded" array analogous to a dot (or slot) blot may be used to arrange and link cDNA fragments or oligonucleotides to the surface of a substrate using a vacuum system, thermal, UV, mechanical or chemical bonding procedures. An array, such as those described above, may be produced by hand or by using available devices (slot blot or dot blot apparatus), materials (any suitable solid support), and machines (including robotic instruments), and may contain 8, 24, 96, 384, 1536 or 6144 oligonucleotides, or any other number between two and over one million which lends itself to the efficient use of commercially-available instrumentation.
In addition to the methods discussed above, diseases may be diagnosed by methods comprising determining, from a sample derived from a subject, an abnormally decreased or increased level of polypeptide or mRNA. Decreased or increased expression can be measured at the RNA level using any of the methods well known in the art for the quantitation of polynucleotides, such as, for example, nucleic acid amplification, for instance PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods. Assay techniques that can be used to determine levels of a polypeptide of the present invention in a sample derived from a host are well-known to those of skill in the art and are discussed in some detail above (including radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays). This aspect of the invention provides a diagnostic method which comprises the steps of: (a) contacting a ligand as described above with a biological sample under conditions suitable for the formation of a ligand- polypeptide complex; and (b) detecting said complex.
Protocols such as ELISA, RIA, and FACS for measuring polypeptide levels may additionally provide a basis for diagnosing altered or abnormal levels of polypeptide expression. Normal or standard values for polypeptide expression are established by combining body fluids or cell extracts taken from normal mammalian subjects, preferably humans, with antibody to the polypeptide under conditions suitable for complex formation The amount of standard complex formation may be quantified by various methods, such as by photometric means.
Antibodies which specifically bind to a polypeptide of the invention may be used for the diagnosis of conditions or diseases characterised by expression of the polypeptide, or in assays to monitor patients being treated with the polypeptides, nucleic acid molecules, ligands and other compounds of the invention. Antibodies useful for diagnostic purposes may be prepared in the same manner as those described above for therapeutics. Diagnostic assays for the polypeptide include methods that utilise the antibody and a label to detect the polypeptide in human body fluids or extracts of cells or tissues. The antibodies may be used with or without modification, and may be labelled by joining them, either covalently or non-covalently, with a reporter molecule. A wide variety of reporter molecules known in the art may be used, several of which are described above.
Quantities of polypeptide expressed in subject, confrol and disease samples from biopsied tissues are compared with the standard values. Deviation between standard and subject values establishes the parameters for diagnosing disease. Diagnostic assays may be used to distinguish between absence, presence, and excess expression of polypeptide and to monitor regulation of polypeptide levels during therapeutic intervention. Such assays may also be used to evaluate the efficacy of a particular therapeutic treatment regimen in animal studies, in clinical trials or in monitoring the treatment of an individual patient.
A diagnostic kit of the present invention may comprise:
(a) a nucleic acid molecule of the present invention;
(b) a polypeptide of the present invention; or
(c) a ligand of the present invention. In one aspect of the invention, a diagnostic kit may comprise a first container containing a nucleic acid probe that hybridises under stringent conditions with a nucleic acid molecule according to the invention; a second container containing primers useful for amplifying the nucleic acid molecule; and instructions for using the probe and primers for facilitating the diagnosis of disease. The kit may further comprise a third container holding an agent for digesting unhybridised RNA.
In an alternative aspect of the invention, a diagnostic kit may comprise an array of nucleic acid molecules, at least one of which may be a nucleic acid molecule according to the invention. To detect polypeptide according to the invention, a diagnostic kit may comprise one or more antibodies that bind to a polypeptide according to the invention; and a reagent useful for the detection of a binding reaction between the antibody and the polypeptide.
Such kits will be of use in diagnosing a disease or susceptibility to diseases in which Nuclear Hormone Receptors are implicated, particularly cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, uterus, prostate, pancreas, head and neck and other solid tumours, myeloproliferative disorders, such as leukemia, non- Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma, autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection, cardiovascular disorders, including hypertension, hypotension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, heart arrhythmia, and ischemia, neurological disorders including, central nervous system disease, Alzheimer's disease, Parkinson's disease, brain injury, stroke, amyotrophic lateral sclerosis, anxiety, depression, and pain, cognition enhancement, learning and memory enhancement, developmental disorders, metabolic disorders including diabetes mellitus, osteoporosis, lipid metabolism disorder, hyperthyroidism, hypeφarathyroidism, thyroid hormone resistance syndrome, hypercalcemia, hypocalcaemia, hypercholesfrolemia, hyperlipidemia, and obesity, renal disorders, including glomerulonephritis, renovascular hypertension, blood disorders including hemophilia, dermatological disorders, including, cellulite, acne, eczema, psoriasis and wound healing, scarring, negative effects of aging, fertility enhancement, contraception, pregnancy termination, progesterone antagonism, hormone replacement therapies, steroid hormonelike mediated hair characteristics, immunomodulation, AIDS, vision disorders, glucocorticoid resistance, mineralocorticoid resistance, androgen resistance, pseudohypoaldosteromsm, spinal bulbar muscular atrophy, exfraskeletal myxoid chrondrosarcomas, adrenal insufficiency, sexual reversal, infections including viral infection, bacterial infection, fungal infection and parasitic infection and other pathological conditions. Particularly relevant are the following diseases: tumours, examples of which include Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis, lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas. The disease may alternatively be one in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD). In addition, regulating neutrophil function is of value in treating infections and wound healing.
Various aspects and embodiments of the present invention will now be described in more detail by way of example, with particular reference to the LBDGl 4 polypeptide.
It will be appreciated that modification of detail may be made without departing from the scope of the invention. Brief description of the Figures
Figure 1: Inpharmatica Genome Threader™ results of search using BAB 13403.1 (LBDG14). The top hit is 1FM9:A, the Human RXRalpha Ligand Binding Domain.
Figure 2: Genome ThreaderTM alignment of BAB13403.1 (LBDG14) and 1FM9:A.
Figure 3: InterPro search results for BAB13403.1 (LBDG14). Figure 4: NCBI Conserved Domain Database search results for BAB 13403.1 (LBDGl 4).
Figure 5: Graphical view of NCBI PSI-Blast (10 iterations) results for BAB 13403.1 (LBDG14).
Figure 6: List of NCBI PSI-Blast (10 iterations) results for BAB13403.1 (LBDG14). Figure 7: NCBI protein report for BAB13403.1 (LBDG14).
Figure 8: Dose response curve for an LBDGl 4 agonist in the GAL4 assay.
Figure 9: Two representative experiments depicting the partial constitutive transcriptional activity of the Gal4 NR14 LBD construct. Figure 10: Normalised expression of LBDG14 in 22 samples from 18 normal human tissues.
Figure 11 : Normalised expression of LBDG14 in 17 cell line samples.
Figure 12: Expression profiling results - Differential gene expression with respect to disease/moφhology. Figure 13: Expression profiling using Affymetrix U133 microarrays for LBDG14 in normal human tissues
Figure 14: Differential Gene Expression with Respect to Disease/Moφhology
Figure 15: Location of the SWIM domain and the LBD.
Figure 16: Alignment of the original sequence prediction (SEQ ID NO: 2) and the extended sequence prediction (SEQ ID NO: 32).
Examples
Example 1: BAB13403.1 (LBDG14
Inpharmatica Genome Threader™, a proprietary prediction bioinformatics program, is queried with the protein sequence BAB 13403.1 (LBDGl 4). The results are shown in figure 1. The top hit is to a structure from the PDB databank, 1FM9:A, the Human RXRalpha Ligand Binding Domain, at 90% confidence. The Inpharmatica Genome Threader™ has identified residues 248-433 of a sequence, BAB13403.1 (LBDG14), as having an equivalent structure to residues 7-215 of Human RXRalpha Ligand Binding Domain (PDB code: 1FM9:A). Having a structure equivalent to 1FM9:A suggests that BAB13403.1 (LBDG14) is a protein that functions as a Nuclear Hormone Receptor Ligand Binding Domain. The h pharmatica Genome Threader™ identifies this with 90% confidence. 1FM9:A is chosen (highlighted) against which to view the sequence alignment of BAB13403.1 (the LBDG14 polypeptide). Viewing the alignment (Figure 2) of the query protein against the protein identified as being of a similar structure helps to visualize the areas of homology. Figure 2 illustrates the point that the residues of Human RXRalpha Ligand Binding Domain which are involved in the binding of Nuclear hormone receptor coactivators (ALA57, LYS58, PHE63, LEU66, ASP70 and LEU74) are conserved as ALA298, LYS299, PHE302, LEU305, ASP309 and LEU312, respectively in BAB13403.1 (the LBDG14 polypeptide). h addition, some of the other 1FM9:A residues involved in the binding of the Nuclear Hormone Receptor Coactivators (TRP56 and LEU75) are conservatively substituted by PHE297 and ALA313, respectively in BAB13403.1 (the LBDG14 polypeptide). The conservation of such functionally important residues in BAB13403.1 (the LBDG14 polypeptide) supports the Genome Threader™ annotation of BAB13403.1 (the LBDG14 polypeptide) as containing a Nuclear Hormone Receptor Ligand Binding Domain. In order to view what is known in the public domain databases about BAB 13403.1 (LBDG14), the InterPro database is queried with BAB13403.1 (LBDG14; Figure 3). InterPro returns zero hits to BAB 13403.1 (LBDGl 4). Returning zero hits from InterPro means that BAB13403.1 (LBDG14) is unidentifiable as a Nuclear Hormone Receptor Ligand Binding Domain member using InterPro. In order to view what is known in the public domain secondary databases, the NCBI Conserved Domain Database (CDD) is queried with BAB13403.1 (LBDG14; Figure 4). CDD returns zero hits to BAB13403.1 (LBDG14). Returning zero hits from CDD means that BAB 13403.1 (LBDGl 4) is unidentifiable as a Nuclear Hormone Receptor Ligand Binding Domain member using CDD. NCBI provides a public domain PSI-Blast server. Querying NCBI PSI-Blast with BAB13403.1 (LBDG14) through 10 positive iterations fails to annotate any region of BAB13403.1 (LBDG14) as having a relationship to any known Nuclear Hormone Receptor Ligand Binding Domain. Figure 5 shows the graphical display of NCBI PSI-Blast results for BAB 13403.1 (LBDGl 4). The horizontal axis corresponds to N-terminal to C-terminal residue numbering along the BAB13403.1 (LBDG14) protein. The accession codes of the sequences hit in NCBI PSI-Blast are listed in Figure 6. None of these sequences have been annotated in the public domain as containing a Nuclear Hormone Receptor Ligand Binding Domain. Thus NCBI PSI-Blast does not annotate any region of BAB13403.1 (LBDG14) as having a relationship to any known Nuclear Hormone Receptor Ligand Binding Domain. The National Centre for Biotechnology Information (NCBI) GenBank protein database is viewed to examine if there is any further information that is known in the public domain relating to BAB13403.1 (LBDG14). This is the U.S. public domain database for protein and gene sequence deposition (Figure 5). BAB 13403.1 was cloned by a group of scientists at the Kazusa DNA Research Institute, Japan. The protein is called KIAA1577 and has no functional annotation. There is no further annotation for BAB 13403.1. The public domain information for this gene does not annotate it as a Nuclear Hormone Receptor Ligand Binding Domain family member. Therefore using all public domain annotation tools, BAB13403.1 (LBDG14) is not annotated as a Nuclear Hormone Receptor Ligand Binding Domain family member. Only the Inpharmatica Genome Threader™ is able to annotate residues 248 to residues 433 of this protein as a Nuclear Hormone Receptor Ligand Binding Domain.
Example 2: Cloning of the LBD of LBDG14
A. cDNA source for PCR of the LBD 500ng total RNA (Ambion Europe, UK or Clontech Europe, Belgium) from different human tissues was used to generate cDNA using the Superscript RT (Invitrogen) and oligo dT primer following the manufacturer's protocol. 2 μl of the reaction were used in the PCR.
B. Cloning of the LBD For the puφoses of cloning, additional flanking sequences may be added to either side of the LBD as defined by Genome Threader. In this case, primers LBDGl 4 F and LBDGl 4 R (see below) were used to amplify the proposed LBD encompassing amino acids 248- 433 of LBDG14 from human cDNA synthesized from RNA prepared from stomach, testis, ovary, placenta and brain. PCR was carried out using the DyNAzyme EXT DNA Polymerase (Finnzymes Oy, Espoo, Finland) in 2 mM MgCl2. The resulting PCR product from stomach cDNA was then cloned into the vector pGEMTEasy (Promega UK Ltd, Southampton, UK) and verified by sequence analysis. Sequences were identical to the published sequence of LBDG14. Inserts were then cloned into the vector pFA-CMV (Sfratagene Europe, Amsterdam, The Netherlands) by restriction digest with the enzymes BamHI and Bglll.
LBDG14F GCT GGAATT CTT GAG CAG CTCATTTCTAAG CT
LBDG14R GGAAGATCT CATTCG CATAAC CTG CAG GC
Example 3: Identification of nuclear receptor agonists in a cellular assay
A. Assay principle and constructs
The pFA-CMV LBDGl 4 LBD construct is cotransfected into mammalian cells together with a reporter plasmid, pFR-Luc (Sfratagene Europe, Amsterdam, The Netherlands) which contains a synthetic promoter with five tandem repeats of the GAL4 binding sites that control the expression of the luciferase gene. When a potential nuclear receptor ligand is added to the cells, it will bind the GAL4-LBD and induce transcription of the luciferase gene. The level of the luciferase expression is monitored by its activity using a luminescence reader (Lehman et al. JBC 270, 12953, 1995; Pawar et al. JBC, 277, 39243, 2002).
B. Choosing a cell line and the transfection method
Initially, the cotransfection of the GAL4 construct and reporter constructs has been carried out in HEK 293 cell line. Subsequently, the assay was repeated in a different cell line in which the nuclear receptor endogenous expression was highest. The GAL4-LBD and the reporter construct were transiently transfected using the Fugene reagent (Roche) and conditions optimised for each cell line. For measurement of constitutive activity, HEK 293 cells were fransiently transfected with the reporter pFR-Luc in the absence or presence of the GAL4-LBDG14 LBD or a control GAL4 construct. Luciferase expression was quantified 48h following the transfection.
C. Compound selection and assay conditions Various compound libraries were screened in the cellular assay at lOμM final concentration and the activity of potential activators has been confirmed by dose response experiments. The retests were performed using the GAL4 and each potential activator was tested in duplicate between the concentration of lOOpM and 3 nM. EC50 values were determined using a graphical fitting program. D. Results
Dose response experiments were carried out for agonists of LBDGl 4. Figure 8 shows the results of one of these experiments. The compound was tested in duplicate at half -log dilutions and the EC50 was determined using GraphPad Prizm software.
A number of potential activators including a low molecular weight compound representative of retinoid modulators, have been identified in the GAL4 cellular assay (Figure 8).
Transcriptional Activity of GAL4-LBDG14 LBD
Transfection of the GAL4-LBDG14 LBD construct into HEK293 cells resulted in variable levels of constitutive activity dependent on the precise nature of the transfection regime (Figure 9). Thus, basal levels of transcription in the absence of ligand were on occasion high. This indicates constitutive activity for LBDGl 4 and differs from the classical nuclear receptors, which require a ligand for their transcriptional activity. However, similar constitutive activity was observed in the case of several oφhan nuclear receptors. For example, the constitutive androstane receptor (CAR) has a high level of activity in a ligand-independent manner due to novel infra-molecular interactions favoured by unique structural features (Dussault et al. Mol. Cell Biol. 22, 5270, 2002). A different mechanism seems to be responsible for the constitutive activity of another nuclear receptor, HNF4. The crystal structure of this receptor revealed the constitutive presence of a fatty acid within the ligand binding domain pocket (Wisely et al., Structure 10, 1225, 2002). Example 4: Identification of ligand binding domain agonists using an in vitro assay
Time resolved fluorescence (TRF) assay for ligand-dependent NHR interaction with coactivators.
A critical step in NHR action is the ligand-dependent recruitment of transcriptional coactivators to target gene promoters. Specifically it has been shown that agonist binding to the receptor induces a conformational change that permits the formation of a hydrophobic pocket enabling the receptor to interact with the LXXLL motif (where L is leucine and X any amino acid) contained in most coactivators. Building on this observation, an in vitro assay has been designed to screen for putative ligands that will bind the novel NHR in the presence of a peptide containing the LXXLL motif. Biotinylated peptides based on known coactivators sequence, and control peptides (for example a peptide which interacts specifically with ERa) have been synthesized. As an example, the SRC-1 based peptide:
(BIOT-CPSSHSHRLSLTERHKILHRLLQEGSPS-CONH2) binds the majority of known NHRs, and therefore is expected to interact with the novel NHRs (Mol. Endocrinol. 14, 2010; 2000). TRF assay is performed in solution, by incubating a GST fusion protein containing the LBD of the NHR of interest, europium-labelled anti GST antibody, biotinylated LXXLL containing peptide and streptavidin APC. In the presence of a ligand that binds the LBD, the fluorescent reagents are brought in close proximity and the TRF can occur. A fluorescent signal, which reflects the extent of binding, is read at 665 nm (J. Biol. Mol. Screen. 7, 3; 2002).
Example 5: Identification of a DNA motif recognised by the DNA binding domain.
The DNA Binding Domains (DBDs) of NHR make specific base-specific contacts with the nucleotide bases in the DNA and are responsible for the sequence-specificity of DNA recognition. The NHR response elements contain similar motifs frequently arranged as direct or inverted repeats with a variable spacer. The specificity of NHRs DNA recognition motifs is further enhanced by the formation of homodimers or heterodimers with different partners (e.g. retinoic acid receptor, RXR). We designed an in vitro assay to rapidly identify the DNA binding motif recognized by the novel NHR, both as a homodimer or heterodimer. The assay is based on an ELISA method carried out in 96 well plates. This approach allows the screening of a large number of putative DNA response elements. Biotinylated oligonucleotides based on a number of binding elements were generated, annealed to form a double-stranded DNA molecule and bound to the 96-well streptavidin coated plates. Excess unbound DNA was washed twice using washing buffer (PBS, 0.1% Tween 20) and following blocking with 2% BSA in PBS, purified recombinant NHR either alone or in the presence of a putative partner protein was added to the plates in binding buffer (PBS, 0.1% Tween 20, 0.1% BSA, 0.1 mg/ml salmon sperm DNA). The bound receptor was detected using general ELISA methodology (Ed Harlow and David Lane, Antibodies - A laboratory manual, Cold Spring Harbor, 1988) by a specific antibody, followed by a secondary HRP conjugated antibody.
Example 6: Quantitative Expression Profiling of LBDGl 4 In order to determine the expression profile of the proposed LBDG14, Taqman RT-PCR quantitation was used. The TaqMan 3'- 5' exonuclease assay signals the formation of PCR amplicons by a process involving the nucleolytic degradation of a doublelabeled fluorogenic probe that hybridises to the target template at a site between the two primer recognition sequences (cf. U. S. Patent 5,876,930). The ABI Prism 7000 and ABI Prism 7700 automates the detection and quantitative measurement of these signals, which are stoichiometrically related to the quantities of amplicons produced, during each cycle of amplification. In addition to providing substantial reductions in the time and labour requirements for PCR analyses, this technology permits simplified and potentially highly accurate quantification of target sequences in the reactions. B. RNA samples
Human RNA prepared from diseased or non-diseased organs is purchased from either Ambion Europe (Huntingdon, UK), Clontech (BD, Franklin Lakes, NJ), Biochain (AMS Biotechnology (Europe) Ltd, Abingdon, UK) or Clinomics (Pittsfield, MA). Cell lines are passaged using standard tissue culture protocols. Cells are maintained in a humidified atmosphere at 37°C; 5% CO2. Culture medium consists of lx DMEM (Invitrogen, UK) with the addition of 10% foetal bovine serum (Invitrogen, UK); 2mM glutamine (Sigma, Poole, UK); 100 u/ml penicillin G (Invitrogen, UK) and lOOu/ml streptomycin sulfate (Invitrogen, UK). Cell treatments are carried out as follows:
Interferon-γ: 200ng/ml for 6 hours
Dibutyryl cAMP: lmM for 24 hours
PMA: lμM for 24 hours
All compounds are purchased from Sigma (Poole, UK). RNA is prepared from cell lines using RNeasy kits following manufacturer's protocols (Qiagen, UK)
C. Oligo Design
Oligonucleotide primers and probes are designed using Primer Express software (Applied Biosystems, Foster City CA) with a GC-content of 40-60%, no G-nucleotide at the 5 '-end of the probe, and no more than 4 contiguous Gs. Primer probe sets are designed within the 3 'exon of the proposed LBDGl 4 and also over an exon-exon junction of the proposed LBDG14.
Each primer and probe is analysed using BLAST® (Basic Local Alignment Search Tool, Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ.: J Mol Biol 1990 Oct 5;215(3):403-10). Results confirm that each oligonucleotide recognises the target sequence with a specificity >3 bp when compared to other known cDNAs or genomic sequence represented in the Unigene and GoldenPath publicly available databases.
The sequence of the primers and probes are:
LBDGl 4 3' Fwd TGCGCTAACCCTTTGTGAAAA
LBDG14 3' Probe ATCACATAGCTTTTGAGACGGCGTACCAAA LBDG14 3' Rev TCGTAGCAGCGTCGAGAACA
LBDG14 exon Fwd CTGCCGCATTGATGATGAGA LBDG14 exon Probe AGACTTGCACTGTCCCATATTCTCTGTAAAATCTGAG LBDGl 4 exon Rev GTGCAGGTAGATGCTGGTATTCC
18s pre-optimised primers and probe were purchased from Applied Biosystems, Foster City, CA.
Probes were covalently conjugated with a fluorescent reporter dye (e.g. 6carboxy- fluorescein [FAM]; Xem = 518nm) and a fluorescent quencher dye (όcarboxytetram- ethyl-rhodamine [TAMRA]; Mem = 582nm) at the most 5' and most 3' base, respectively. Primers were obtained from Sigma Genosys, UK and probes were obtained from Eurogentec, Belgium.
Primer/probe concentrations were titrated in the range of 50nM to 900nM and optimal concentrations for efficient PCR reactions are determined. Optimal primer and probe concentrations varied in between lOOnM and 900nM depending on the target gene that was amplified. D. cDN A reaction cDNA was prepared using components from Applied Biosystems, Foster City CA. 50μl reactions were prepared in 0.5ml RNase free tubes. Reactions contain 500ng total RNA; lx reverse transcriptase buffer; 5.5mM MgC12; ImM dNTP's; 2.5μl random hexamers; 20U RNase inhibitor; and 62.5U reverse transcriptase. E. PCR reactions
25 μl reactions were prepared in 0.5 ml thin- walled, optical grade PCR 96 well plates (Applied Biosystems, Foster City CA). Reactions contained: lx final concenfration of TaqMan Universal Master Mix (a proprietary mixture of AmpliTaq Gold DNA polymerase, AmpEraseX UNG, dNTPs with UTP, passive reference dye and optimised buffer components, Applied Biosystems, Foster City CA); lOOnM Taqman probe; 900nM forward primer; 900nM reverse primer and the relevant amount of cDNA template. For the normal and diseased tissue analysis, reactions contained the same amounts of reagents except for the probe, which was used at a final concentration of 200nM. F. Performance of Assay
Standard procedures for the operation of the ABI Prism 7000 or similar detection system were used. This included, for example with the ABI Prism 7000, use of all default program settings with the exception of reaction volume which is changed from 50 to 25μl. Thermal cycling conditions consisted of two min at 50°C, 10 min at 95°C, followed by 40 cycles of 15 sec at 95°C and 1 min at 60°C. Cycle threshold (Ct) determinations, i.e. non-integer calculations of the number of cycles required for reporter dye fluorescence resulting from the synthesis of PCR products to become significantly higher than background fluorescence levels are automatically performed by the instrument for each reaction using default parameters. Assays for target sequences and ribosomal 18s (reference) sequences in the same cDNA samples are performed in separate reaction tubes.
Within each experiment, a standard curve is carried out of a typical tissue sample. From this standard curve, the amount of actual starting target or reference cDNA in each test sample is determined.
The levels of target cDNA in each sample are normalised to the level of expression of target in a comparative sample. The levels of internal control cDNA in each sample are normalised to the level of expression of internal control in a comparative sample. The data is then represented as fold expression of normalised target sequence relative to the level of expression in the comparative sample, which is set arbitrarily to 1.
Results
A. Expression in Normal Human Tissues
Taqman RT-PCR was carried out using 15ng of the indicated cDNA using primers/probes specific for LBDG14 and 18s rRNA as described in the detailed description. A standard curve for target and internal control was also carried out, using between 25ng to 0.39ng of cDNA template of a typical tissue sample. Using linear regression analysis of the standard curves, the amount of actual starting target or 18s cDNA in each test sample was calculated. The levels of target and reference cDNA in each sample were normalised to the level of expression in a comparative sample, in this case, stomach. Figure 10 represents the fold expression of normalised target sequence relative to the level of expression in stomach cDNA, which is set arbitrarily to 1. The target expression profile was determined using 2 primer probe sets - one within the 3'exon of the proposed LDBG14 and one over an exon-exon junction of LBDGl 4. Each sample was quantitated in 2 or more individual experiments. Figure 10 shows the mean ±SEM for the multiple experiments.
LBDGl 4 appears to be expressed in all of the tissues tested with the highest expression observed in brain and testis. There is no marked difference between the expression profiles from the two primer/probe sets suggesting that the splicing of this gene across the exon 4-5 boundary is not variable between the tissues tested, when compared to the UTR profile. The PCR reaction was also carried out on cDNA made in the absence of reverse transcriptase enzyme. A signal was not seen in these reactions (data not shown), indicating that the levels of LBDGl 4 detected are present in cDNA. B. Expression in cell line samples
Taqman RT-PCR was carried out using 15ng of the indicated cDNA using primers/probes specific for LBDG14 and 18s rRNA as described in the detailed description. A standard curve for target and internal control was also carried out, using between 25ng to 0.39ng of cDNA template of a typical cell line sample. Using linear regression analysis of the standard curves, the amount of actual starting target or 18s cDNA in each test sample was calculated.
The levels of target and reference cDNA in each sample were normalised to the level of expression of target in a comparative sample, in this case, HEK293 cells. Figure 11 represents the fold expression of normalised target sequence relative to the level of expression in HEK293 cells, which is set arbitrarily to 1. The target expression profile was determined using 2 primer probe sets - one within the 3'exon of the proposed LBDG14 and one over an exon-exon junction of LBDG14. Each sample was quantitated in 2 or more individual experiments. Figure 11 shows the mean ±SEM for the multiple experiments. For LBDGl 4, the relative levels of expression across the different tissues is very similar for both primer/probe sets (3' and exon spanning), indicating the absence of differential splicing of LBDG14 in these samples. All cell samples give detectable expression of LBDG14 with the highest levels in HEK293, THP 1, MCF-7 and HT29. In general, treatment of cells does not result in a significant change in expression of LBDGl 4. The PCR reaction was also carried out on cDNA made in the absence of reverse transcriptase enzyme. A signal was not seen in these reactions (data not shown), indicating that the levels of LBDGl 4 detected are present in cDNA.
Figure 12 shows normalised expression of LBDG14 in 26 disease and clinically matched normal samples.
Taqman RT-PCR was carried out using 25ng of the indicated cDNA using primers/probes specific for LBDG14 and 18S rRNA as described in the detailed description. A standard curve for target and internal control was also carried out, using between 50ng to 0.78ng of cDNA template of a typical sample. Using linear regression analysis of the standard curves, the amount of actual starting target or 18S cDNA in each test sample was calculated.
The levels of target and reference cDNA in each sample were normalised to the level of expression of target in a comparative sample, in this case, COPD. Figure 12 represents the fold expression of normalised target sequence relative to the level of expression in COPD, which is set arbitrarily to 1. The target expression profile was determined using the primer probe set within the 3'utr of the proposed LBDGl 4. Each sample was quantitated in at least 3 individual experiments from 3 individual batches of cDNA synthesis. Figure 12 shows the mean and SEM of three experiments.
LBDGl 4 expression is detected in all tissues tested. Expression is low in the diabetic skeletal muscle, adrenal cortical tumour and adenomatous polyposis samples. In Figure 12, it can be seen that LBDG14 is up-regulated 3.3 fold in prostate cancer when compared to the normal sample; and 4.2 fold in rheumatoid arthritis compared to normal control. For these samples, the PCR reaction was also carried out on cDNA made in the absence of reverse transcriptase enzyme. No signal was seen in these reactions (data not shown), indicating that the levels of LBDGl 4 detected are present in cDNA.
Example 7: Expression profiling using Affymetrix U133 microarrays for LBDG14 in normal and tumour human tissues
The quantitative expression profiling microarray analysis of gene expression was carried out in accordance to Affymetrix instructions (Palo Alto, CA www.affymetrix.com). Essentially, cDNA was synthesized using T7-(dT)24 oligos and Superscript II RT followed by T4 polymerase and was purified using Phase Lock Gel (PLG) and phenol: chloroform extraction.
Labelling of cRNA was carried out using biotinylated CTP in an in vitro transcription reaction. Labelled product cRNA was then cleaned up using RNeasy columns (Qiagen, UK Ltd.) and assessed by spectrophotometry. cRNA was then fragmented and analysed using the Agilent LabCbip (Agilent, Palo Alto, CA). cRNA was analysed using the latest version of the Affymetrix U-1333 GeneChip. Approximately lOμg of cRNA was used per GeneChip. Hybridisation and washing protocols were carried out in accordance with Affymetrix protocols.
The probe set 226208_at was used to detect transcript for LBDG14. Details of the 10 probes within this set are available at the Affymetrix website (www.Affymetrix.com), NetAffx section.
One probe set was used to detect transcript for LBDGl 4. RNAs from 2063 normal human tissues were screened for the presence of the transcript of LBDGl 4 using this probe set. Transcripts were detected as "present" in 2045 of these RNA samples. Transcript profiling using the U133 chip demonstrates that the transcript for LBDG14 could be detected in the majority of samples from all the tissues tested. Transcript levels were highest in the cortical regions of the brain notably, frontal cortex, parietal cortex, temporal cortex. High levels of expression were also observed in the white blood cells. Lowest levels of expression were found in the muscle samples (see Figure 13). An approximate 2-fold elevation of transcript levels was observed in activated neufrophils and in Schwannomas and sarcomas of the small intestine and stomach (see Figure 14). A small reduction in expression of transcript for LBDGl 4 was observed in squamous cell carcinoma of the lung, neuroendocrine carcinoma of the lung, malignant lymphomas adenocarcinoma of the colon and seminoma of the testis. This data indicates that transcripts of this gene are altered in a variety of tumour types. Identifying the tumour types that possess elevated or suppressed LBDGl 4 transcript levels may be of value in diagnostics for particular cancer subtypes and thereby, define the particular therapeutic approach for individual patients. In addition, development of agonists and antagonists for LDBG14 will be of value in freating cancer. The finding of an elevation of LBDGl 4 transcripts in activated neufrophils suggests that this nuclear receptor is involved in regulating neutrophil function. Thus, agonists and antagonists will be of value in treating inflammatory conditions including but not exclusively rheumatoid arthritis, multiple sclerosis, psoriasis, inflammatory bowel disease, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis and conjunctivitis. In addition, regulating neutrophil function is of value in treating infections and wound healing.
Example 8: SWIM domain
Upon further analysis of the initial predicted sequence (SEQ ID NO:2) it was discovered that there were further exons N-terminal to this sequence. It has now also been discovered that in this N-terminal portion of SEQ ID NO: 32 there is a SWIM domain. SWIM domains are found in multiple protein families, but particularly in the SWI/SNF family of chromatin modulators. This fits with the prediction that SEQ ID NO: 32 encodes a nuclear receptor. An alignment of the original sequence prediction (SEQ ID NO: 2) with the extended sequence prediction (SEQ ID NO: 32) can be seen in Figure 16. Figure 15 shows which regions of SEQ ID NO: 32 encodes which domains. NHR14 sequences
SEQ ID NO:l (Nucleotide coding sequence for BAB13403.1 ( BDG14) protein)
1 AATAGTGTTG ATGTCTGTCC ATGGGAAGAT GGAAATCATG GCAGTGAATT ACCCAACTTA
61 ACCAATGCTC TGCCTCAGGG TGCAAATGCC AACCAAGATT CATCGAACAG GCCACATCGG
121 ACAGTGTTCA CCCGAGCCAT CGAGGCATGC GATCTCCACT GGCAGGATAG CCACTTGCAG
181 CACATTATCA GCAGTGACCT ATACACCAAC TACTGTTACC ATGACGACAC TGAAAACTCC
241 CTCTTCGACT CCCGCGGGTG GCCCCTCTGG CATGAACATG TTCCTACAGC CTGTGCAAGA
301 GTGGACGCAT TACGTTCTCA TGGGTACCCC AGAGAAGCAC TGAGACTAGC AATAGCTATT
361 GTTAATACAT TAAGACGACA GCAGCAGAAA CAGTTGGAAA TGTTCCGAAC CCAAAAAAAA
421 GAGCTACCCC ATAAAAACAT AACCTCGATA ACCAATCTGG AGGGCTGGGT TGGACATCCC
481 CTGGACCCTG TGGGCACTCT CTTCAGTAGC CTTATGGAAG CCTGCCGCAT TGATGATGAG
541 AACCTCTCTG GGTTCTCAGA TTTTACAGAG AATATGGGAC AGTGCAAGTC TCTGGAATAC
601 CAGCATCTAC CTGCACACAA ATTCTTAGAA GAAGGGGAAT CCTATTTAAC GCTGGCTGTG
661 GAAGTAGCCC TGATAGGGCT AGGACAGCAG CGTATCATGC CTGATGGGCT GTACACACAA
721 GAGAAAGTTT GCCGGAATGA GGAGCAGCTC ATTTCTAAGC TTCAGGAAAT TGAATTGGAT
781 GACACACTGG TGAAAATTTT TCGCAAGCAA GCAGTCTTCC TATTAGAAGC CGGACCATAT
841 AGTGGTTTAG GTGAAATAAT CCATCGGGAG AGCGTTCCAA TGCACACATT TGCCAAGTAT
901 CTCTTCACCT CTCTCCTACC TCACGATGCT GAATTGGCAT ACAAAATTGC ACTGAGAGCA
961 ATGCGGTTAC TAGTATTGGA ATCTACTGCT CCATCAGGAG ACCTCACCCG CCCACACCAC
1021 ATTGCATCAG TTGTTCCCAA CCGCTACCCT CGCTGGTTCA CTCTAAGCCA CATTGAGTCC
1081 CAGCAGTGTG AGCTGGCATC CACCATGCTA ACTGCAGCCA AAGGCGATGT TCGGAGGCTG
1141 GAAACAGTAT TAGAATCCAT CCAGAAAAAC ATTCACTCCT CATCACACAT CTTCAAGCTT
1201 GCCCAAGATG CATTTAAAAT AGCAACTCTC ATGGACAGTT TGCCAGACAT CACTCTTTTG
1261 AAAGTGTCTC TGGAGCTGGG CCTGCAGGTT ATGCGAATGA CACTGTCAAC CTTAAATTGG
1321 CGACGGCGGG AGATGGTGAG GTGGCTGGTA ACGTGTGCTA CTGAAGTCGG GGTTTATGCC
1381 CTGGACAGCA TCATGCAGAC CTGGTTTACA CTCTTTACTC CCACCGAGGC CACAAGTATA
1441 GTTGCAACTA CCGTGATGTC CAACAGCACC ATCGTCCGCC TCCACCTGGA CTGCCACCAG
1501 CAGGAAAAGC TGGCCAGCAG CGCCCGGACA CTTGCACTGC AGTGTGCCAT GAAGGATCCA
1561 CAGAACTGTG CCCTCTCTGC GCTAACCCTT TGTGAAAAGG ATCACATAGC TTTTGAGACG
1621 GCGTACCAAA TTGTTCTCGA CGCTGCTACG ACTGGCATGA GCTATACACA GCTCTTTACA
1681 ATAGCACGGT ACATGGAGCA CCGCGGGTAC CCCATGAGGG CCTACAAGCT GGCCACCCTG
1741 GCCATGACCC ATCTCAACCT GAGCTACAAT CAGGACACAC ACCCTGCCAT TAATGATGTT
1801 TTGTGGGCCT GTGCGCTTAG CCACTCCCTT GGTAAAAATG AGCTTGCAGC TATAATACCT
1861 CTGGTGGTCA AGAGTGTCAA GTGTGCAACG GTACTGTCAG ACATTTTGCG CAGATGCACT
1921 CTGACCACTC CTGGCATGGT GGGACTTCAT GGGAGGAGGA ACTCTGGTAA GCTCATGTCA
1981 CTGGACAAAG CCCCCTTGAG GCAACTCTTG GATGCCACGA TCGGGGCCTA CATCAACACA
2041 ACGCACTCAC GGCTCACACA CATCAGTCCT CGGCACTATA GTGAGTTTAT AGAGTTCCTC
2101 AGCAAAGCCC GAGAGACCTT CTTAATGGCG CATGATGGAC ACATTCAGTT TACACAGTTT
2161 ATTGACAACC TGAAACAAAT CTACAAAGGC AAAAAGAAAC TGATGATGTT GGTTCGGGAG
2221 AGGTTTGGTT GA
SEQ ID NO:2 (Protein BAB13403.1; LBDG14)
1 nsvdvcpwed gnhgselpnl tnalpqgana nqdssnrphr tvftraieac dlhwqdshlq 61 hiissdlytn ycyhddtens lfdsrgwplw hehvptacar vdalrshgyp realrlaiai
121 vntlrrqqqk qlemfrtqkk elphknitsi tnleg vghp ldpvgtlfss lmeacridde
181 nlsgfsdfte nmgqcksley qhlpa kfle egesyltlav evaliglgqq rimpdglytq
241 ekvcrneeql isklqeield dtlvkifrkq avflleagpy sglgeiihre svpmhtfaky
301 lftsllp da elaykialra rllvlesta psgdltrphh iasvvpnryp r ftlshies 361 qqcelast l taakgdvrrl etvlesiqkn ihssshifkl aqdafkiatl mdslpditll
421 kvslelglqv mrmtlstlnw rrre vr lv tcatevgvya ldsimqt ft lftpteatsi
481 vattvmsnst ivrlhldchq qeklassart lalqcamkdp qncalsaltl cekdhiafet
541 ayqivldaat tgmsytqlft iarymehrgy pmrayklatl amthlnlsyn qdthpaindv
601 l acalshsl gknelaaiip lwksvkcat vlsdilrrct Ittpgmvglh grrnsgklms 661 ldkaplrqll datigayint t srlthisp rhysefiefl skaretflma hdghiqftqf
721 idnlkqiykg kkklmmlvre rfg SEQ ID NO: 3 (LBDG14 nucleotide sequence exon A)
1 ATGCTGAGCT CAGGAGTCTG GCTGCCAGCC AAACCTTTGC TTTCCTCACT 51 ACAGCTGAGG GCTTTCGAAG CTTCCCACCA GTGGGTTTGT CTGAACTGTT 101 TAGGAATGCG GCCGCGGTCG CCAGCTGAC
SEQ ID NO: 4 ( BDG14 protein sequence exon A)
1 M SSGV PA KPLLSSLQLR AFEASHQWVC LNCLGMRPRS PAD
SEQ ID NO: 5 (LBDG14 nucleotide sequence exon B)
1 TTCCACTTGA GCGGCACAGT GACAGAACCT GCAATACAAT CGGAGCCAGA
51 AACTGTTTGC AACGTGGCCA TCAGCTTTGA TCGTTGCAAG ATTACCTCAG 101 TGACCTGCAG CTGTGGAAAC AAGGACATAT TTTATTGTGC CCATGTTGTG
151 GCACTGTCTT TATACCGCAT CCGCAAGCCA GATCAGGTCA AACTGCATCT
201 TCCTATTTCA GAGACTCTCT TTCAAATGAA TAGAGACCAA CTGCAAAAGT
251 TTGTACAGTA TTTGATCACA GTGCACCACA CAGAAGTTTT GCCAACTGCT
301 CAAAAATTAG CAGATGAAAT TCTTTCCCAA AATTCAGAAA TCAACCAAGT 351 TCATG
SEQ ID NO: 6 ( BDG14 protein sequence exon B)
1 FHLSGTVTEP AIQSEPETVC NVAISFDRCK ITSVTCSCGN KDIFYCAHW 51 ALSLYRIRKP DQVKLHLPIS ETLFQMNRDQ LQKFVQYLIT VHHTEVLPTA 101 QKLADEILSQ NSEINQVHG
SEQ ID NO: 7 (LBDG14 nucleotide sequence exon C) 1 GTGCTCCTGA TCCAACAGCA GGTGCTAGTA TAGATGATGA AAACTGCTGG
51 CACTTAGATG AAGAGCAGGT TCAAGAACAG GTTAAACTGT TCCTTTCCCA
101 GGGCGGGTAC CACGGATCAG GGAAGCAGCT TAATTTGCTC TTTGCAAAG
SEQ ID NO: 8 (LBDG14 protein sequence exon C)
1 APDPTAGASI DDENCWHLDE EQVQEQVK F SQGGYHGSG KQLNL FAK
SEQ ID NO: 9 (LBDG14 nucleotide sequence exon D) 1 GTGCGGGAGA TGTTAAAGAT GAGGGACTCC AATGGGGCCC GCATGTTGAC
51 CTTGATAACA GAGCAATTCA TGGCTGACCC TCGCCTGTCA CTTTGGCGGC
101 AACAAGGCAC TGCAATGACT GACAAATACA GGCAGCTCTG GGATGAGCTG
151 G SEQ ID NO: 10 (LBDG14 protein sequence exon D)
1 VREMLKMRDS NGARMLT IT EQFMADPRLS L RQQGTAMT DKYRQLWDE 51 G SEQ ID NO: 11 (LBDG14 nucleotide sequence exon E)
1 GTGCTCTGTG GATGTGTATA GTTTTAAACC CCCACTGCAA GTTGGAGCAA
51 AAGGCCAGTT GGCTAAAACA GCTGAAGAAA TGGAATAGTG TTGATGTCTG
101 TCCATGGGAA GATGGAAATC ATGGCAGTGA ATTACCCAAC TTAACCAATG 151 CTCTGCCTCA GGGTGCAAAT GCCAACCAAG
SEQ ID NO: 12 (LBDG14 protein sequence exon E)
1 ALWMCIVLNP HCKLEQKASW KQ KKWNSV DVCP EDGNH GSELPN TNA 51 PQGANANQD SEQ ID NO: 13 (LBDG14 nucleotide sequence exon F)
1 ATTCATCGAA CAGGCCACAT CGGACAGTGT TCACCCGAGC CATCGAGGCA
51 TGCGATCTCC ACTGGCAGGA TAGCCACTTG CAGCACATTA TCAGCAGTGA
101 CCTATACACC AACTACTGTT ACCATGACGA CACTGAAAAC TCCCTCTTCG
151 ACTCCCGCGG GTGGCCCCTC TGGCATG
SEQ ID NO : 14 (LBDG14 protein sequence exon F) 1 SSNRPHRTVF TRAIEACDLH WQDSHLQHII SSDLYTNYCY HDDTENSLFD
51 SRGWPL HE
SEQ ID NO : 15 (LBDG14 nucleotide sequence exon G)
1 AACATGTTCC TACAGCCTGT GCAAGAGTGG ACGCATTACG TTCTCATGGG 51 TACCCCAGAG AAGCACTGAG ACTAGCAATA GCTATTGTTA ATACATTAAG 101 ACGACAGCAG CAGAAACAGT TGGAAATGTT CCGAACCCAA AAAAAAG SEQ ID NO : 16 (LBDG14 protein sequence exon G)
1 HVPTACARVD A RSHGYPRE ALRLAIAIVN TLRRQQQKQL EMFRTQKKE
SEQ ID NO : 17 (LBDG14 nucleotide sequence exon H)
1 AGCTACCCCA TAAAAACATA ACCTCGATAA CCAATCTGGA GGGCTGGGTT 51 GGACATCCCC TGGACCCTGT GGGCACTCTC TTCAGTAGCC TTATGGAAGC 101 CTGCCGCATT GATGATGAGA ACCTCTCTGG GTTCTCAGAT TTTACAG SEQ ID NO : 18 (LBDG14 protein sequence exon H)
1 LPHKNITSIT NLEGWVGHPL DPVGTLFSS MEACRIDDEN LSGFSDFTE
SEQ ID NO : 19 (LBDG14 nucleotide sequence exon I )
1 AGAATATGGG ACAGTGCAAG TCTCTGGAAT ACCAGCATCT ACCTGCACAC
51 AAATTCTTAG AAGAAGGGGA ATCCTATTTA ACGCTGGCTG TGGAAGTAGC
101 CCTGATAGGG CTAGGACAGC AGCGTATCAT GCCTGATGGG CTGTACACAC
151 AAGAGAAAGT TTGCCGGAAT GAGGAGCAGC TCATTTCTAA GCTTCAGGAA 201 ATTGAATTGG ATGACACACT GGTGAAAATT TTTCGCAAGC AAGCAGTCTT
251 CCTATTAGAA G
SEQ ID NO : 20 ( BDG14 protein sequence exon I ) 1 NMGQCKS EY QHLPAHKFLE EGESYLTLAV EVALIGLGQQ RIMPDGLYTQ
51 EKVCRNEEQL ISK QEIELD DTLVKIFRKQ AVFLLEA
SEQ ID NO : 21 (LBDG14 nucleotide sequence exon J) 1 CCGGACCATA TAGTGGTTTA GGTGAAATAA TCCATCGGGA GAGCGTTCCA
51 ATGCACACAT TTGCCAAGTA TCTCTTCACC TCTCTCCTAC CTCACGATGC 101 TGAATTGGCA TACAAAATTG CACTGAGAGC AATGCG
SEQ ID NO : 22 (LBDG14 protein sequence exon J)
1 GPYSGLGEII HRESVPMHTF AKYLFTSL P HDAELAYKIA RAMR
SEQ ID NO : 23 (LBDG14 nucleotide sequence exon K) 1 GTTACTAGTA TTGGAATCTA CTGCTCCATC AGGAGACCTC ACCCGCCCAC
51 ACCACATTGC ATCAGTTGTT CCCAACCGCT ACCCTCGCTG GTTCACTCTA 101 AGCCACATTG AGTCCCAGCA GTGTGAGCTG GCATCCACCA TGCTAACTGC 151 AGCCAAAG SEQ ID NO: 24 (LBDG14 protein sequence exon K)
1 L VLESTAPS GDLTRPHHIA SWPNRYPRW FT SHIESQQ CELASTMLTA 51 AKG
SEQ ID NO: 25 (LBDG14 nucleotide sequence exon L) 1 GCGATGTTCG GAGGCTGGAA ACAGTATTAG AATCCATCCA GAAAAACATT 51 CACTCCTCAT CACACATCTT CAAGCTTGCC CAAGATGCAT TTAAAATAGC 101 AACTCTCATG GACAGTTTGC CAGACATCAC TCTTTTGAAA GTGTCTCTGG 151 AGCTGGGCCT GCAG SEQ ID NO: 26 (LBDG14 protein sequence exon L)
1 DVRRLETV E SIQKNIHSSS HIFKLAQDAF KIAT MDSLP DITL KVSLE 51 G Q SEQ ID NO: 27 (LBDG14 nucleotide sequence exon M)
1 GTTATGCGAA TGACACTGTC AACCTTAAAT TGGCGACGGC GGGAGATGGT 51 GAGGTGGCTG GTAACGTGTG CTACTGAAGT CG SEQ ID NO: 28 ( BDG14 protein sequence exon M)
1 VMRMTLST N WRRREMVRW VTCATEVG
SEQ ID NO: 29 ( BDG14 nucleotide sequence exon N)
1 GGGTTTATGC CCTGGACAGC ATCATGCAGA CCTGGTTTAC ACTCTTTACT
51 CCCACCGAGG CCACAAGTAT AGTTGCAACT ACCGTGATGT CCAACAGCAC
101 CATCGTCCGC CTCCACCTGG ACTGCCACCA GCAGGAAAAG CTGGCCAGCA
151 GCGCCCGGAC ACTTGCACTG CAGTGTGCCA TGAAGGATCC ACAGAACTGT 201 GCCCTCTCTG CGCTAACCCT TTGTGAAAAG GATCACATAG CTTTTGAGAC 251 GGCGTACCAA ATTGTTCTCG ACGCTGCTAC GACTGGCATG AGCTATACAC 301 AGCTCTTTAC AATAGCACGG TACATGGAGC ACCGCGGGTA CCCCATGAGG 351 GCCTACAAGC TGGCCACCCT GGCCATGACC CATCTCAACC TGAGCTACAA 401 TCAGGACACA CACCCTGCCA TTAATGATGT TTTGTGGGCC TGTGCGCTTA 451 GCCACTCCCT TGGTAAAAAT GAGCTTGCAG CTATAATACC TCTGGTGGTC 501 AAGAGTGTCA AGTGTGCAAC GGTACTGTCA GACATTTTGC GCAGATGCAC 551 TCTGACCACT CCTGGCATGG TGGGACTTCA TGGGAGGAGG AACTCTGGTA 601 AGCTCATGTC ACTGGACAAA GCCCCCTTGA GGCAACTCTT GGATGCCACG 651 ATCGGGGCCT ACATCAACAC AACGCACTCA CGGCTCACAC ACATCAGTCC 701 TCGGCACTAT AGTGAGTTTA TAGAGTTCCT CAGCAAAGCC CGAGAGACCT 751 TCTTAATGGC GCATGATGGA GACATTCAGT TTACACAGTT TATTGACAAC 801 CTGAAACAAA TCTACAAAGG CAAAAAGAAA CTGATGATGT TGGTTCGGGA 851 GAGGTTTGGT SEQ ID NO: 30 (LBDG14 protein sequence exon N)
1 VYALDSIMQT WFTLFTPTEA TSIVATTVMS NSTIVR HLD CHQQEKLASS
51 ARTLA QCAM KDPQNCALSA LT CEKDHIA FETAYQIVLD AATTGMSYTQ
101 LFTIARYMEH RGYPMRAYKL AT AMTHLNL SYNQDTHPAI NDVL ACALS 151 HSLGKNELAA IIPLVVKSVK CATVLSDILR RCT TTPGMV GLHGRRNSGK
201 L SLDKAPLR QLLDATIGAY INTTHSRLTH ISPRHYSEFI EFLSKARETF
251 LMAHDGHIQF TQFIDNLKQI YKGKKKLMML VRERFG SEQ ID NO: 31 (LBDG14 full known nucleotide sequence)
ATGCTGAGCTCAGGAGTCTGGCTGCCAGCCAAACCTTTGCTTTCCTCACTACAGCTGAGGGCTTTCGAAGCTTCCCACC AGTGGGTTTGTCTGAACTGTTTAGGAATGCGGCCGCGGTCGCCAGCTGAC(X)nTTCCACTTGAGCGGCACAGTGACAGA- ACCTGCAATACAATCGGAGCCAGAAACTGTTTGCAACGTGGCCATCAGCTTTGATCGTTGCAAGATTACCTCAGTGACC TGCAGCTGTGGAAACAAGGACATATTTTATTGTGCCCATGTTGTGGCACTGTCTTTATACCGCATCCGCAAGCCAGATC AGGTCAAACTGCATCTTCCTATTTCAGAGACTCTCTTTCAAATGAATAGAGACCAACTGCAAAAGTTTGTACAGTATTT GATCACAGTGCACCACACAGAAGTTTTGCCAACTGCTCAAAAATTAGCAGATGAAATTCTTTCCCAAAATTCAGAAATC AACCAAGTTCATGGTGCTCCTGATCCAACAGCAGGTGCTAGTATAGATGATGAAAACTGCTGGCACTTAGATGAAGAGC AGGTTCAAGAACAGGTTAAACTGTTCCTTTCCCAGGGCGGGTACCACGGATCAGGGAAGCAGCTTAATTTGCTCTTTGC AAAGGTGCGGGAGATGTTAAAGATGAGGGACTCCAATGGGGCCCGCATGTTGACCTTGATAACAGAGCAATTCATGGCT GACCCTCGCCTGTCACTTTGGCGGCAACAAGGCACTGCAATGACTGACAAATACAGGCAGCTCTGGGATGAGCTGGGTG CTCTGTGGATGTGTATAGTTTTAAACCCCCACTGCAAGTTGGAGCAAAAGGCCAGTTGGCTAAAACAGCTGAAGAAATG GAATAGTGTTGATGTCTGTCCATGGGAAGATGGAAATCATGGCAGTGAATTACCCAACTTAACCAATGCTCTGCCTCAG GGTGCAAATGCCAACCAAGATTCATCGAACAGGCCACATCGGACAGTGTTCACCCGAGCCATCGAGGCATGCGATCTCC ACTGGCAGGATAGCCACTTGCAGCACATTATCAGCAGTGACCTATACACCAACTACTGTTACCATGACGACACTGAAAA CTCCCTCTTCGACTCCCGCGGGTGGCCCCTCTGGCATGAACATGTTCCTACAGCCTGTGCAAGAGTGGACGCATTACGT TCTCATGGGTACCCCAGAGAAGCACTGAGACTAGCAATAGCTATTGTTAATACATTAAGACGACAGCAGCAGAAACAGT TGGAAATGTTCCGAACCCAAAAAAAAGAGCTACCCCATAAAAACATAACCTCGATAACCAATCTGGAGGGCTGGGTTGG ACATCCCCTGGACCCTGTGGGCACTCTCTTCAGTAGCCTTATGGAAGCCTGCCGCATTGATGATGAGAACCTCTCTGGG TTCTCAGATTTTACAGAGAATATGGGACAGTGCAAGTCTCTGGAATACCAGCATCTACCTGCACACAAATTCTTAGAAG AAGGGGAATCCTATTTAACGCTGGCTGTGGAAGTAGCCCTGATAGGGCTAGGACAGCAGCGTATCATGCCTGATGGGCT GTACACACAAGAGAAAGTTTGCCGGAATGAGGAGCAGCTCATTTCTAAGCTTCAGGAAATTGAATTGGATGACACACTG GTGAAAATTTTTCGCAAGCAAGCAGTCTTCCTATTAGAAGCCGGACCATATAGTGGTTTAGGTGAAATAATCCATCGGG AGAGCGTTCCAATGCACACATTTGCCAAGTATCTCTTCACCTCTCTCCTACCTCACGATGCTGAATTGGCATACAAAAT TGCACTGAGAGCAATGCGGTTACTAGTATTGGAATCTACTGCTCCATCAGGAGACCTCACCCGCCCACACCACATTGCA TCAGTTGTTCCCAACCGCTACCCTCGCTGGTTCACTCTAAGCCACATTGAGTCCCAGCAGTGTGAGCTGGCATCCACCA TGCTAACTGCAGCCAAAGGCGATGTTCGGAGGCTGGAAACAGTATTAGAATCCATCCAGAAAAACATTCACTCCTCATC ACACATCTTCAAGCTTGCCCAAGATGCATTTAAAATAGCAACTCTCATGGACAGTTTGCCAGACATCACTCTTTTGAAA GTGTCTCTGGAGCTGGGCCTGCAGGTTATGCGAATGACACTGTCAACCTTAAATTGGCGACGGCGGGAGATGGTGAGGT GGCTGGTAACGTGTGCTACTGAAGTCGGGGTTTATGCCCTGGACAGCATCATGCAGACCTGGTTTACACTCTTTACTCC CACCGAGGCCACAAGTATAGTTGCAACTACCGTGATGTCCAACAGCACCATCGTCCGCCTCCACCTGGACTGCCACCAG CAGGAAAAGCTGGCCAGCAGCGCCCGGACACTTGCACTGCAGTGTGCCATGAAGGATCCACAGAACTGTGCCCTCTCTG CGCTAACCCTTTGTGAAAAGGATCACATAGCTTTTGAGACGGCGTACCAAATTGTTCTCGACGCTGCTACGACTGGCAT GAGCTATACACAGCTCTTTACAATAGCACGGTACATGGAGCACCGCGGGTACCCCATGAGGGCCTACAAGCTGGCCACC CTGGCCATGACCCATCTCAACCTGAGCTACAATCAGGACACACACCCTGCCATTAATGATGTTTTGTGGGCCTGTGCGC TTAGCCACTCCCTTGGTAAAAATGAGCTTGCAGCTATAATACCTCTGGTGGTCAAGAGTGTCAAGTGTGCAACGGTACT GTCAGACATTTTGCGCAGATGCACTCTGACCACTCCTGGCATGGTGGGACTTCATGGGAGGAGGAACTCTGGTAAGCTC ATGTCACTGGACAAAGCCCCCTTGAGGCAACTCTTGGATGCCACGATCGGGGCCTACATCAACACAACGCACTCACGGC TCACACACATCAGTCCTCGGCACTATAGTGAGTTTATAGAGTTCCTCAGCAAAGCCCGAGAGACCTTCTTAATGGCGCA TGATGGACACATTCAGTTTACACAGTTTATTGACAACCTGAAACAAATCTACAAAGGCAAAAAGAAACTGATGATGTTG GTTCGGGAGAGGTTTGGT
SEQ ID NO: 32 (LBDG14 full known protein sequence)
MLSSGVWLPAKPLLSSLQLRAFEASHQ VCLNCLGMRPRSPAD(X)nFHLSGTVTEPAIQSEPETVCNVAISFDRCKITS VTCSCGNKDIFYCAHVVALSLYRIRKPDQVKLHLPISET FQMNRDQLQKFVQYLITVHHTEV PTAQKLADEI SQNS EINQVHGAPDPTAGASIDDENCWHLDEEQVQEQVKLFLSQGGYHGSGKQLNL FAKVREMLKMRDSNGARMLTLITEQF MADPR SLWRQQGTA TDKYRQL DE GAL CIVLNPHCKLEQKASWLKQLKK NSVDVCP EDGNHGSE PN TNAL PQGANANQDSSNRPHRTVFTRAIEACDLHWQDSHLQHIISSD YTNYCYHDDTENSLFDSRGWPL HEHVPTACARVDA RSHGYPREALRLAIAIVNTLRRQQQKQLEMFRTQKKELPHΪOSIITSITN EG VGHP DPVGTLFSSLMEACRIDDENL SGFSDFTENMGQCKSLEYQHLPAHKFLEEGESYLTLAVEVALIGLGQQRIMPDGLYTQEKVCRNEEQLISKLQEIELDD TLVKIFRKQAVFLLEAGPYSGLGEIIHRESVPMHTFAKY FTSLLPHDAELAYKIALRAMRLLVLESTAPSGDLTRPHH IASWPNRYPRWFT SHIESQQCELASTMLTAAKGDVRRLETVLESIQKNIHSSSHIFK AQDAFKIATLMDSLPDITL LKVSLELGLQV R TLSTLNWRRREMVRWLVTCATEVGVYALDSIMQT FTLFTPTEATSIVATTVMSNSTIVRLHLDC HQQEK ASSARTLALQCAMKDPQNCALSALTLCEKDHIAFETAYQIVLDAATTGMSYTQLFTIARYMEHRGYPMRAYKL AT AMTHLN SYNQDTHPAINDVLWACALSHSLGKNELAAIIP WKSVKCATVLSDILRRCTLTTPGMVGLHGRRNSG KLMSLDKAP RQLLDATIGAYINTTHSRLTHISPRHYSEFIEFLSKARETFLMAHDGHIQFTQFIDN KQIYKGKKKLM VRERFG

Claims

1. A polypeptide, which polypeptide:
(i) comprises or consists of the amino acid sequence as recited in SEQ ID NO:2; (ii) is a fragment thereof having Nuclear Hormone Receptor Ligand Binding
Domain activity or having an antigenic determinant in common with the polypeptide of (i); or
(iii) is a functional equivalent of (i) or (ii).
2. A polypeptide which is a fragment according to claim 1 (ii), which includes the Nuclear Hormone Receptor Ligand Binding Domain region of the LBDGl 4 polypeptide, said Nuclear Hormone Receptor Ligand Binding Domain region being defined as including between residues 248 and 433 inclusive, of the amino acid sequence recited in SEQ ID NO:2, wherein said fragment possesses Nuclear Hormone Receptor Ligand Binding Domain activity.
3. A polypeptide which is a functional equivalent according to claim l(iii), is homologous to the amino acid sequence as recited in SEQ ID NO:2, and has Nuclear Hormone Receptor Ligand Binding Domain activity.
4. A polypeptide according to claim 3, wherein said functional equivalent is homologous to the Nuclear Hormone Receptor Ligand Binding Domain region of the LBDG14 polypeptide.
5. A fragment or functional equivalent according to any one of claims 1-4, which has greater than 30% sequence identity with an amino acid sequence as recited in SEQ ID NO:2, or with a fragment thereof that possesses Nuclear Hormone Receptor Ligand Binding Domain activity, preferably greater than 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98% or 99% sequence identity, as determined using BLAST version 2.1.3 using the default parameters specified by the NCBI (the National Center for Biotechnology Information; http://www.ncbi.nlm.nih.gov/) [Blosum 62 matrix; gap open penalty=l 1 and gap extension penalty=l].
6. A functional equivalent according to any one of claims 1-5, which exhibits significant structural homology with a polypeptide having the amino acid sequence given in any one of SEQ ID NO:2, or with a fragment thereof that possesses Nuclear Hormone Receptor Ligand Binding Domain activity.
7. A fragment as recited in claim 1, 2, or 5, having an antigenic determinant in common with the polypeptide of claim l(i), which consists of 7 or more (for example, 8, 10, 12, 14, 16, 18, 20 or more) amino acid residues from the sequence of SEQ ID NO:2.
8. A purified nucleic acid molecule which encodes a polypeptide according to any one of the preceding claims.
9. A purified nucleic acid molecule according to claim 8, which has the nucleic acid sequence as recited in SEQ ID NO:l, or is a redundant equivalent or fragment thereof.
10. A fragment of a purified nucleic acid molecule according to claim 8 or claim 9, which comprises, between nucleotides 742 and 1299 of SEQ ID NO:l, or is a redundant equivalent thereof.
11. A purified nucleic acid molecule which hybridizes under high stringency conditions with a nucleic acid molecule according to any one of claims 8-10.
12. A vector comprising a nucleic acid molecule as recited in any one of claims 8-11.
13. A host cell transformed with a vector according to claim 12.
14. A ligand which binds specifically to, and which preferably inhibits the Nuclear Hormone Receptor Ligand Binding Domain activity of, a polypeptide according to any one of claims 1-7.
15. A ligand according to claim 14, which is an antibody.
16. A compound that either increases or decreases the level of expression or activity of a polypeptide according to any one of claims 1-7.
17. A compound according to claim 16 that binds to a polypeptide according to any one of claims 1-7 without inducing any of the biological effects of the polypeptide.
18. A compound according to claim 16 or claim 17, which is a natural or modified substrate, ligand, enzyme, receptor or structural or functional mimetic.
19. A polypeptide according to any one of claim 1-7, a nucleic acid molecule according to any one of claims 8-11, a vector according to claim 12, a ligand according to claim 14 or 15, or a compound according to any one of claims 16-18, for use in therapy or diagnosis of disease.
20. A method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide according to any one of claim 1- 7, or assessing the activity of a polypeptide according to any one of claim 1-7, in tissue from said patient and comparing said level of expression or activity to a control level, wherein a level that is different to said control level is indicative of disease.
21. A method according to claim 20 that is carried out in vitro.
22. A method according to claim 20 or claim 21, which comprises the steps of: (a) contacting a ligand according to claim 14 or claim 15 with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex.
23. A method according to claim 20 or claim 21, comprising the steps of: a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule according to any one of claims 8-11 and the probe; b) contacting a control sample with said probe under the same conditions used in step a); and c) detecting the presence of hybrid complexes in said samples; wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
24. A method according to claim 20 or claim 21, comprising: a) contacting a sample of nucleic acid from tissue of the patient with a nucleic acid primer under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule according to any one of claims 8-11 and the primer; b) contacting a control sample with said primer under the same conditions used in step a); and c) amplifying the sampled nucleic acid; and d) detecting the level of amplified nucleic acid from both patient and control samples; wherein detection of levels of the amplified nucleic acid in the patient sample that differ significantly from levels of the amplified nucleic acid in the control sample is indicative of disease.
25. A method according to claim 20 or claim 21 comprising: a) obtaining a tissue sample from a patient being tested for disease; b) isolating a nucleic acid molecule according to any one of claims 8-11 from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation which is associated with disease in the nucleic acid molecule as an indication of the disease.
26. The method of claim 25, further comprising amplifying the nucleic acid molecule to form an amplified product and detecting the presence or absence of a mutation in the amplified product.
27. The method of either claim 25 or 26, wherein the presence or absence of the mutation in the patient is detected by contacting said nucleic acid molecule with a nucleic acid probe that hybridises to said nucleic acid molecule under stringent conditions to form a hybrid double-stranded molecule, the hybrid double-stranded molecule having an unhybridised portion of the nucleic acid probe strand at any portion corresponding to a mutation associated with disease; and detecting the presence or absence of an unhybridised portion of the probe strand as an indication of the presence or absence of a disease-associated mutation.
28. A method according to any one of claims 20-27, wherein said disease is a disease in which Nuclear Hormone Receptor Ligand Binding Domains are implicated, such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, uterus, prostate, pancreas, head and neck and other solid tumours, myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma, autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection, cardiovascular disorders, including hypertension, hypotension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, heart arrhythmia, and ischemia, neurological disorders including, central nervous system disease, Alzheimer's disease, Parkinson's disease, brain injury, stroke, amyotrophic lateral sclerosis, anxiety, depression, and pain, cognition enhancement, learning and memory enhancement, developmental disorders, metabolic disorders including diabetes mellitus, osteoporosis, lipid metabolism disorder, hyperthyroidism, hypeφarathyroidism, thyroid hormone resistance syndrome, hypercalcemia, hypocalcaemia, hypercholestrolemia, hyperlipidemia, and obesity, renal disorders, including glomerulonephritis, renovascular hypertension, blood disorders including hemophilia, dermatological disorders, including, acne, eczema, psoriasis, negative effects of aging, fertility enhancement, contraception, progesterone antagonism, hormone replacement therapies, steroid hormone-like mediated hair characteristics, AIDS, vision disorders, glucocorticoid resistance, mineralocorticoid resistance, androgen resistance, pseudohypoaldosteromsm, spinal/bulbar muscular atrophy, exfraskeletal myxoid chrondrosarcomas, adrenal insufficiency, sexual reversal, infections including viral infection, bacterial infection, fungal infection and parasitic infection, cancer, particular cancers originating from estrogen-responsive tissues, including breast, uterus and prostate, myeloproliferative disorders, such as leukemia, hypertension, hypotension, fertility enhancement, contraception, pregnancy termination, progesterone antagonism, wound healing, scarring, obesity, dermatological disorders including cellulite, estrogen-mediated hair characteristics, central nervous system disorders, cognition enhancement, learning and memory enhancement, immunomodulation and osteoporosis, Schwannoma, sarcomas (of stomach and small intestine), Wilms tumour of kidney, oncocytoma prostate cancer and also rheumatoid arthritis, lung carcinoma (neuroendocrine and squamous cell carcinoma), seminoma of testis, adenocarcinoma of colon and malignant lymphomas. The disease may alternatively be one in which neutrophil activation is known to play a role, including for example, infections, particularly chronic bacterial infections such as tuberculosis; cancers; sarcoidosis; Chronic granulomatous disease (CGD), ischaemic damage and remodelling, for example, after myocardial infarction; stroke; wound healing; inflammatory diseases such as irritable bowel syndrome (IBD); multiple sclerosis; rheumatoid arthritis, psoriasis, atherosclerosis, asthma, atopic dermatitis, allergic rhinitis, conjunctivitis and chronic obstructive pulmonary disease (COPD).
29. Use of a polypeptide according to any one of claims 1-7 as a Nuclear Hormone Receptor Ligand Binding Domain.
30. Use of a nucleic acid molecule according to any one of claims 8-11 to express a protein that possesses Nuclear Hormone Receptor Ligand Binding Domain activity.
31. A method for effecting cell-cell adhesion, utilising a polypeptide according to any one of claims 1-7.
32. A pharmaceutical composition comprising a polypeptide according to any one of claims 1-7, a nucleic acid molecule according to any one of claims 8-11, a vector according to claim 12, a ligand according to claim 14 or 15, or a compound according to any one of claims 16-18.
33. A vaccine composition comprising a polypeptide according to any one of claims 1-7 or a nucleic acid molecule according to any one of claims 8-11.
34. A polypeptide according to any one of claims 1-7, a nucleic acid molecule according to any one of claims 8-11, a vector according to claim 12, a ligand according to claim 14 or 15, a compound according to any one of claims 16-18, or a pharmaceutical composition according to claim 32 for use in the manufacture of a medicament for the treatment of a disease in which Nuclear Hormone Receptor Ligand Binding Domains are implicated, such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, uterus, prostate, pancreas, head and neck and other solid tumours, myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma, autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection, cardiovascular disorders, including hypertension, hypotension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, heart airhythmia, and ischemia, neurological disorders including, central nervous system disease, Alzheimer's disease, Parkinson's disease, brain injury, stroke, amyotrophic lateral sclerosis, anxiety, depression, and pain, cognition enhancement, learning and memory enhancement, developmental disorders, metabolic disorders including diabetes mellitus, osteoporosis, lipid metabolism disorder, hyperthyroidism, hypeφarathyroidism, thyroid hormone resistance syndrome, hypercalcemia, hypocalcaemia, hypercholestrolemia, hyperlipidemia, and obesity, renal disorders, including glomerulonephritis, renovascular hypertension, blood disorders including hemophilia, dermatological disorders, including, cellulite, acne, eczema, psoriasis and wound healing, scarring, negative effects of aging, fertility enhancement, contraception, pregnancy termination, progesterone antagonism, hormone replacement therapies, steroid hormone-like mediated hair characteristics, immunomodulation, AIDS, vision disorders, glucocorticoid resistance, mineralocorticoid resistance, androgen resistance, pseudohypoaldosteromsm, spinal/bulbar muscular atrophy, exfraskeletal myxoid chrondrosarcomas, adrenal insufficiency, sexual reversal, infections including viral infection, bacterial infection, fungal infection and parasitic infection, cancer, particular cancers originating from estrogen-responsive tissues, including breast, uterus and prostate, myeloproliferative disorders, such as leukemia, hypertension, hypotension, fertility enhancement, contraception, pregnancy termination, progesterone antagonism, wound healing, scarring, obesity, dermatological disorders including cellulite, estrogen-mediated hair characteristics, central nervous system disorders, Alzheimer's disease, cognition enhancement, learning and memory enhancement, immunomodulation and osteoporosis.
35. A method of treating a disease in a patient, comprising administering to the patient a polypeptide according to any one of claims 1-7, a nucleic acid molecule according to any one of claims 8-11, a vector according to claim 12, a ligand according to claim 14 or 15, a compound according to any one of claims 16-18, or a pharmaceutical composition according to claim 32.
36. A method according to claim 35, wherein, for diseases in which the expression of the natural gene or the activity of the polypeptide is lower in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, ligand, compound or composition administered to the patient is an agonist.
37. A method according to claim 35, wherein, for diseases in which the expression of the natural gene or activity of the polypeptide is higher in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, ligand, compound or composition administered to the patient is an antagonist.
38. A method of monitoring the therapeutic treatment of disease in a patient, comprising monitoring over a period of time the level of expression or activity of a polypeptide according to any one of claims 1-7, or the level of expression of a nucleic acid molecule according to any one of claims 8-11 in tissue from said patient, wherein altering said level of expression or activity over the period of time towards a control level is indicative of regression of said disease.
39. A method for the identification of a compound that is effective in the treatment and/or diagnosis of disease, comprising contacting a polypeptide according to any one of claims 1 -7, a nucleic acid molecule according to any one of claims 8-11 , or a host cell according to claim 13 with one or more compounds suspected of possessing binding affinity for said polypeptide or nucleic acid molecule, and selecting a compound that binds specifically to said nucleic acid molecule or polypeptide.
40. A kit useful for diagnosing disease comprising a first container containing a nucleic acid probe that hybridises under stringent conditions with a nucleic acid molecule according to any one of claims 8-11; a second container containing primers useful for amplifying said nucleic acid molecule; and instructions for using the probe and primers for facilitating the diagnosis of disease.
41. The kit of claim 40, further comprising a third container holding an agent for digesting unhybridised RNA.
42. A kit comprising an array of nucleic acid molecules, at least one of which is a nucleic acid molecule according to any one of claims 8-11.
43. A kit comprising one or more antibodies that bind to a polypeptide as recited in any one of claims 1-7; and a reagent useful for the detection of a binding reaction between said antibody and said polypeptide.
44. A transgenic or knockout non-human animal that has been transformed to express higher, lower or absent levels of a polypeptide according to any one of claims 1-7.
45. A method for screening for a compound effective to treat disease, by contacting a non-human transgenic animal according to claim 44 with a candidate compound and determining the effect of the compound on the disease of the animal.
EP03738307A 2002-07-03 2003-07-03 Human nuclear hormone receptor Withdrawn EP1520023A2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
GB0215406A GB0215406D0 (en) 2002-07-03 2002-07-03 Protein
GB0215406 2002-07-03
PCT/GB2003/002848 WO2004005346A2 (en) 2002-07-03 2003-07-03 Human nuclear hormone receptor

Publications (1)

Publication Number Publication Date
EP1520023A2 true EP1520023A2 (en) 2005-04-06

Family

ID=9939789

Family Applications (1)

Application Number Title Priority Date Filing Date
EP03738307A Withdrawn EP1520023A2 (en) 2002-07-03 2003-07-03 Human nuclear hormone receptor

Country Status (4)

Country Link
EP (1) EP1520023A2 (en)
AU (1) AU2003244831A1 (en)
GB (1) GB0215406D0 (en)
WO (1) WO2004005346A2 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2941385B1 (en) 2009-01-23 2011-04-01 Millipore Corp METHOD FOR PROVIDING A CIRCUIT FOR BIOLOGICAL LIQUID AND CIRCUIT OBTAINED

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2004507202A (en) * 1999-03-31 2004-03-11 キュラジェン　コーポレイション Nucleic acid containing an open reading frame encoding a polypeptide; "ORFX"
US6783969B1 (en) * 2001-03-05 2004-08-31 Nuvelo, Inc. Cathepsin V-like polypeptides

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2004005346A3 *

Also Published As

Publication number Publication date
AU2003244831A1 (en) 2004-01-23
WO2004005346A8 (en) 2004-03-25
WO2004005346A3 (en) 2004-04-29
GB0215406D0 (en) 2002-08-14
WO2004005346A2 (en) 2004-01-15
AU2003244831A8 (en) 2004-01-23

Similar Documents

Publication Publication Date Title
US20040249123A1 (en) Nuclear hormone receptor ligand binding domain
EP1520023A2 (en) Human nuclear hormone receptor
WO2004003018A1 (en) Nuclear hormone receptor
WO2003099865A1 (en) Cation channel proteins
WO2004003010A2 (en) Nuclear hormone receptor ligano-binding domain containing protein
WO2004005344A1 (en) Ligand binding domains of nuclear hormone receptors
US20040170999A1 (en) Nuclear hormone receptor ligand binding domain
EP1519955A2 (en) Nuclear hormone receptor
WO2004101618A2 (en) Progestin-yol002c-cgi-45 receptor-related proteins
WO2003072605A1 (en) Nuclear hormone receptor ligand binding domain-containing protein
US20070148655A1 (en) Leucine rich repeat containing protein
WO2004081170A2 (en) Progestin receptor-like protein
WO2003089469A2 (en) Cation channel proteins
WO2004026905A2 (en) Transporter/channel proteins

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20050131

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR

AX Request for extension of the european patent

Extension state: AL LT LV MK

DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN

18W Application withdrawn

Effective date: 20051207