EP1280899A2 - Gene and sequence variation associated with sensing carbohydrate compounds and other sweeteners - Google Patents
Gene and sequence variation associated with sensing carbohydrate compounds and other sweetenersInfo
- Publication number
- EP1280899A2 EP1280899A2 EP01928871A EP01928871A EP1280899A2 EP 1280899 A2 EP1280899 A2 EP 1280899A2 EP 01928871 A EP01928871 A EP 01928871A EP 01928871 A EP01928871 A EP 01928871A EP 1280899 A2 EP1280899 A2 EP 1280899A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- polynucleotide
- sacl
- polypeptide
- gene
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/30—Drugs for disorders of the nervous system for treating abuse or dependence
- A61P25/32—Alcohol-abuse
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates generally to the field of mouse and human genetics and sensing of extracellular carbohydrates. Specifically, the present invention relates to the discovery of a gene and its sequence variation associated with a differential preference for sweet compounds in laboratory strains of mice.
- Mammals vary in their ad libitum consumption of sweeteners. To investigate the genetic contribution to this complex behavior, behavioral, electrophysiological, and genetic studies were conducted using two strains of mice that differ markedly in their preference for sucrose and saccharin (Bachmanov et al., Behavior Genetics, 1996;26:563-573).
- the present invention provides a gene and its sequence variation associated with a preference for carbohydrate compounds, other sweeteners, or alcohol.
- the present invention provides a gene and its sequence variation associated a differential response by the pancreas and/or muscle in response to dietary carbohydrates.
- the present invention also relates to sequence variation and its use in the diagnosis and prognosis of predisposition to diabetes, other obesity-related disorders, or alcohol consumption.
- the present invention also relates to the study of taste to identify molecules responsible for signal transduction, other receptors and genes and relationships that contribute to taste preference.
- the present invention also relates to the study of diabetes to identify molecules responsible for sensing extra-cellular carbohydrate, other receptors and genes and relationships that contribute to a diabetic state.
- the present invention also relates to a sequence variation and its use in the identification of specific alleles altered in their specificity for carbohydrate compounds.
- the present invention also relates to a recombinant construct comprising
- SAC1 also referred to as Sac
- Sac polynucleotide suitable for expression in a transformed host cell
- the present invention also provides primers and probes specific for the detection and analysis of the SAC1 locus.
- the present invention also relates to kits for detecting a polynucleotide comprising a portion of the SAC1 locus.
- the present invention also relates to transgenic animals, which carry an altered SAC1 allele, such as a knockout mouse.
- the present invention also relates to methods for screening drugs for inhibition or restoration of SAC1 function as a taste receptor.
- the present invention also relates to identification of sweeteners or alcohols using the SAC1 gene and its sequence variations.
- the present invention also relates to methods for screening drugs for inhibition or restoration of SAC 1 function in homeostatic regulation of glucose levels.
- the present invention also relates to methods for screening drugs for modification of SAC 1 function in the consumption of alcohol.
- the present invention provides therapies directed to diabetic or obesity disorders.
- Therapies of diabetes and obesity include gene therapy, protein replacement, protein mimetics, and inhibitors.
- Fig. 1A shows genetic mapping of the SAC1 locus, using 632 F2 mice from a cross between the B6 (high preference) and 129 (low preference) strains. Mapping results were obtained with MAPMAKER/QTL Version 1.1, using an unconstrained model. A black triangle at the bottom indicates peak LOD score at M134G01 marker. Horizontal line at the bottom shows a 1-LOD confidence interval.
- Fig. IB shows SAC 1 -containing chromosomal region defined by a donor fragment of the 129.
- B6-Sac partially congenic mice.
- the partially congenic strains were constructed by identifying several founder F2 mice with small fragments of the telomeric region of mouse chromosome 4 from the B6 strain and successive backcrossing to the 129 strain. Presence and size of donor fragment were determined by genotyping polymorphic markers in mice from the N4, N6, N7, N4F4, and N3F5 generations.
- Fig. IC shows average daily saccharin consumption by N6, N7, N4F4, and
- N3F5 segregating partially congenic 129.B6-S ⁇ c mice in 4-days two-bottle tests with water (means ⁇ SE).
- the open bar indicates intakes of mice that did not inherit the donor fragment.
- the black bar indicates intakes of mice with one or two copies of the donor fragment, which is flanked by 280G12-T7 proximally and D4Monl distally.
- the complete donor fragment is represented by overlapping sequences of the BAC RPCI-23-118E21 and a genomic clone (Accession AF185591), as indicated at the bottom.
- the size of the SAC 1 -containing donor fragment is 194, 478 kb.
- Fig. ID shows BAC contig of distal chromosome 4 in the SAC1 region.
- BAC library (RPCI-23) was screened; positive clones were confirmed by PCR analysis and only clones positive by hybridization and by PCR are included in the contig.
- BAC ends were sequenced and PCR primers designed. The STS content of each BAC, using all BAC ends was determined.
- BAC size was determined by digesting the BAC with Not/, and the insert size determined using pulse field gel electrophoresis.
- Fig. IE shows genes contained within the SAC1 nonrecombinant interval. Arrows indicate predicted direction of transcription. See Table 1 for a description of gene prediction, and details concerning function.
- Fig. 2 A shows the mouse SAC1 gene (mSac; Accession AF311386), its human ortholog (hSac), and the previously described gene T1R1, now Gpr70, are aligned above. Residues shaded in black are identical between at least two identical residues; residues in gray indicate conservative changes.
- the human ortholog was identified by sequence homology search within the htgs database (Accession AC026283). The amino acid sequence of the human ortholog was predicted using GE ⁇ SCA ⁇ .
- the amino acid sequence of mouse GprlO was obtained by constructing primers based upon the nucleotide sequence, and taste cD ⁇ A was amplified and sequenced. This amino acid and nucleotide sequence for Gpr70 differed slightly from the initial report; the sequence reported in this paper has been deposited in GenBank (AF301161, AF301162). The location of the missense mutation is indicated by an *.
- Fig. 2B shows structure of the SAC1 gene. The six exons are shown as black boxes.
- Fig. 2C shows conformation of a protein predicted from the Sac gene. To determine the transmembrane regions, the hydrophobicity was determined using the computer program HMMTOP, and drawn with TOPO. The missense mutation is denoted with an asterisk.
- Fig. 3 shows saccharin and sucrose preferences by mice from inbred strains with two different haplotypes of the Sac gene.
- the haplotype found in the B6 mice and the other high sweetener-preferring inbred strains consisted of four variants, two variants were 5' of the predicted translation start codon, one variant was a missense mutation (Ile61Thr), and the last variant was located in the intron between exon 2 and 3.
- Fig. 4 A shows tissue expression of the SAC1 gene. Note that cDNA was obtained from a commercial source for the multiple tissue panel, with the exception of tongue cDNA, which was as isolated by the investigator, as described within the text. Relative band intensities may differ due to differences in cDNA isolation methods or concentration.
- Fig. 4B shows RNA from human fungiform papillae was obtained from biopsy material, reversed transcribed, and the resulting bands from genomic and cDNA were amplified using primers, described in the text. The bands were excised from the agarose gel, purified and reamplified. The PCR product was sequenced to confirm that the bands amplified the human otholog to Sac.
- Fig. 5 shows amino acid sequence alignment of the mouse cDNA sequence for the SAC1 gene and the cDNA for a calcium sensing metabotropic receptor. Dark areas indicated regions of shared similarity.
- Fig. 6 plots the hydrophobicity of the SAC1 amino acid sequence as predicted by the computer program Top Pred. Note the seven transmembrane domains characteristic of G-protein coupled receptors. DETAILED DESCRIPTION OF THE INVENTION
- polynucleotide and “nucleic acid” refer to naturally occurring polynucleotides, e.g., DNA or RNA. These terms do not refer to a specific length. Thus, these terms include oligonucleotide, primer, probe, etc. These terms also refer to analogs of naturally occurring polynucleotides.
- the polynucleotide may be double stranded or single stranded.
- the polynucleotides may be labeled with radiolabels, fluorescent labels, enzymatic labels, proteins, haptens, antibodies, sequence tags.
- RNA RNA, cDNA, genomic DNA, synthetic forms, and mixed polymers, both sense and antisense strands, and may be chemically or biochemically modified or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those skilled in the art.
- Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, etc.), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, etc.).
- uncharged linkages e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.
- charged linkages e.g., phosphorothioates, phosphorodithioates, etc.
- pendent moieties
- synthetic molecules that mimic polynucleotides in their ability to bind to a designated sequence via hydrogen bonding and other chemical interactions.
- Such molecules are known in the art and include, for example, those in which peptide linkages substitute for phosphate linkages in the backbone of the molecule.
- polynucleotide amplification refers to a broad range of techniques for increasing the number of copies of specific polynucleotide sequences.
- amplification of either or both strand of the target nucleic acid comprises the use of one or more nucleic acid-modifying enzymes, such as a DNA polymerase, a ligase, an RNA polymerase, or an RNA-dependent reverse transcriptase.
- polynucleotide amplification reaction examples include, but not limited to, polymerase chain reaction (PCR), nucleic acid sequence based amplification (NASB), self-sustained sequence replication (3SR), strand displacement activation (SDA), ligase chain reaction (LCR), Q ⁇ replicase system, and the like.
- PCR polymerase chain reaction
- NNB nucleic acid sequence based amplification
- SDA self-sustained sequence replication
- SDA strand displacement activation
- LCR ligase chain reaction
- Q ⁇ replicase system examples include, but not limited to, polymerase chain reaction (PCR), nucleic acid sequence based amplification (NASB), self-sustained sequence replication (3SR), strand displacement activation (SDA), ligase chain reaction (LCR), Q ⁇ replicase system, and the like.
- the term "primer” refers to a nucleic acid, e.g., synthetic polynucleotide, which is capable of annealing to
- a primer will include a free hydroxyl group at the 3' end.
- the appropriate length of a primer depends on the intended use of the primer but typically ranges from 12 to 30 nucleotides.
- primer pair means a set of primers including a 5' upstream primer that hybridizes with the 5' end of the target sequence to be amplified and a 3' downstream primer that hybridizes with the complement of the 3' end of the target sequence to be amplified.
- the present invention includes all novel primers having at least eight nucleotides derived from the SAC1 locus for amplifying the SAC1 gene, its complement or functionally equivalent nucleic acid sequences.
- the present invention does not include primers which exist in the prior art. That is, the present invention includes all primers having at least 8 nucleotides with the proviso that it does not include primers existing in the prior art.
- Target polynucleotide refers to a single- or double-stranded polynucleotide which is suspected of containing a target sequence, and which may be present in a variety of types of samples, including biological samples.
- Antibody refers to polyclonal and/or monoclonal antibody and fragments thereof, and immunologic binding equivalents thereof, which are capable of specifically binding to the SAC1 polypeptides and fragments thereof or to polynucleotide sequences from the SAC1 region, particularly from the SAC1 locus or a portion thereof.
- Antibody may be a homogeneous molecular entity, or a mixture such as a serum product made up of a plurality of different molecular entities.
- Antibodies may be produced by in vitro or in vivo techniques well-known in the art. For example, for production of polyclonal antibodies, an appropriate target immune system, typically mouse or rabbit, is selected. Substantially purified antigen is presented to the immune system. Typical sites for injection are in footpads, intramuscularly, intraperitoneally, or intradermally. Polyclonal antibodies may then be purified and tested for immunological response, e.g., using an immunoassay.
- an appropriate target immune system typically mouse or rabbit
- Substantially purified antigen is presented to the immune system. Typical sites for injection are in footpads, intramuscularly, intraperitoneally, or intradermally.
- Polyclonal antibodies may then be purified and tested for immunological response, e.g., using an immunoassay.
- protein, polypeptide, fusion protein, or fragments thereof may be injected into mice.
- the spleens may be excised and individual spleen cells fused, typically, to immortalized myeloma cells under appropriate selection conditions. Thereafter, the cells are clonally separated and the supernatants of each clone tested for their production of an appropriate antibody specific for the desired region of the antigen.
- Affinities of monoclonal antibodies are typically 10" ⁇ M"* or preferably 10"9 to 10 ⁇ ® M"l or stronger.
- antibodies are labeled by joining, either covalently or non- covalently, a substance which provides for a detectable signal.
- labels and conjugation techniques include radionuclides, enzymes, substrates, cofactors, inhibitors, fluorescent agents, chemiluminescent agents, magnetic particles, and the like.
- recombinant immunoglobulins may be produced.
- Binding partner refers to a molecule capable of binding another molecule with specificity, as for example, an antigen and an antigen-specific antibody or an enzyme and its inhibitor.
- Binding partners are known in the art and include, for example, biotin and avidin or streptavidin, IgG and protein A, receptor-ligand couples, and complementary polynucleotide strands.
- the partners are normally at least about 15, 20, 25, 30, 40 bases in length.
- a “biological sample” refers to a sample of tissue or fluid suspected of containing an analyte (e.g., polynucleotide, polypeptide) including, but not limited to, e.g., plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, blood cells, organs, tissue and samples of in vitro cell culture constituents.
- analyte e.g., polynucleotide, polypeptide
- a biological sample is typically from human or other animal.
- Encode A polynucleotide is said to "encode” a polypeptide if, in its native state or when manipulated by methods well-known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA and/or the polypeptide or a fragment thereof.
- the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
- isolated or substantially pure polynucleotide or polypeptide is one which is substantially separated from other cellular components which naturally accompany a native human nucleic acid or protein, e.g., ribosomes, polymerases, many other human genome sequences and proteins.
- the term embraces a nucleic acid or peptide sequence which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogs or analogs biologically synthesized by heterologous systems.
- SAC1 Allele refers to normal alleles of the SAC1 locus as well as alleles carrying variations that predispose individuals to develop obesity, diabetes, or for alcohol consumption or alcoholism.
- SAC1 Locus refers to polynucleotides, which are in the SAC1 region, that are likely to be expressed in normal individual, certain alleles of which predispose an individual to develop obesity, diabetes, or alcohol consumption or alcoholism.
- the SAC1 locus includes coding sequences, intervening sequences and regulatory elements controlling transcription and/or translation.
- the SAC1 locus includes all allelic variations of the DNA sequence.
- the DNA sequences used in this invention will usually comprise at least about 5 codons (15 nucleotides), 7, 10, 15, 20, or 30 codons, and most preferably, at least about 35 codons. One or more nitrons may also be present. This number of nucleotides is usually about the minimal length required for a successful probe that would hybridize specifically with a SAC1 locus.
- SAC1 Region refers to a portion of mouse chromosome 4 bounded by the markers 280G12-T7 and D4Monl GenBank Accession number is YG7772 (SEQ ID NO: 652) and is
- a "portion" or “fragment” of the SAC1 gene, locus, region, or allele is defined as having a minimal size of at least about 15 nucleotides, or preferably at least about 20, or more preferably at least about 25 nucleotides, and may have a minimal size of at least about 40 nucleotides.
- polypeptide refers to a polymer of amino acids without referring to a specific length. This term includes to naturally occurring protein. The term also refers to modifications, analogues and functional mimetics thereof. For example, modifications of the polypeptide may include glycosylations, acetylations, phosphorylations, and the like. Analogues of polypeptide include unnatural amino acid, substituted linkage, etc. Also included are polypeptides encoded by DNA which hybridize under high or low stringency conditions, to the nucleic acids of interest. Modification of polypeptides includes those substantially homologous to primary structural sequence, e.g., in vivo or in vitro chemical and biochemical modifications or incorporation unusual amino acids.
- Such modifications include, for example, acetylation, carboxylation, phosphorylation, glycosylation, ubiquitination, labeling, e.g., with radionuclides, and various enzymatic modifications, as will be readily appreciated by those well-skilled in the art.
- a variety of methods for labeling polypeptides and of substituents or labels useful for such purposes are well-known in the art, and include radioactive isotopes such -l ias 32p 3 ligands which bind to labeled antiligands (e.g., antibodies), fluorophores, chemiluminescent agents, enzymes, and antiligands which can serve as specific binding pair members for a labeled ligand.
- the present invention provides for biologically active fragments of the polypeptides.
- Significant biological activities include ligand-binding, immunological activity, and other biological activities characteristic of SACl polypeptides.
- Immunological activities include both immunogenic function in a target immune system, as well as sharing of immunological epitopes for binding, serving as either a competitor or substitute antigen for an epitope of the SACl protein.
- epitope refers to an antigenic determinant of a polypeptide.
- An epitope could comprise three amino acids in a spatial conformation that is unique to the epitope. Generally, an epitope consists of at least five such amino acids, and more usually consists of at least 8 to 10 such amino acids. Methods of determining the spatial conformation of such amino acids are known in the art.
- tandem-repeat polypeptide segments may be used as immunogens, thereby producing highly antigenic proteins.
- polypeptides will serve as highly efficient competitors for specific binding.
- Fusion proteins comprise SACl polypeptides and fragments.
- Homologous polypeptides may be fusions between two or more SACl polypeptide sequences or between the sequences of SACl and a related protein.
- heterologous fusions may be constructed which would exhibit a combination of properties or activities of the derivative proteins. For example, ligand-binding or other domains may be "swapped" between different new fusion polypeptides or fragments.
- Such homologous or heterologous fusion polypeptides may display, for example, altered strength or specificity of binding.
- Fusion partners include immunoglobulins, bacterial ⁇ -galactosidase, trpE, protein A, ⁇ -lactamase, -amylase, alcohol dehydrogenase, and yeast mating factor. Fusion proteins will typically be made by either recombinant nucleic acid methods or may be chemically synthesized. Techniques for the synthesis of polypeptides are known in the art.
- polypeptides may be least about 50% homologous to the native amino acid sequence, preferably in excess of about 70%, and more preferably at least about 90% homologous.
- Substitutions typically contain the exchange of one amino acid for another at one or more sites within the polypeptide, and may be designed to modulate one or more properties of the polypeptide, such as stability against proteolytic cleavage, without the loss of other functions or properties.
- Amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
- substitutions are ones which are conservative, that is, one amino acid is replaced with one of similar shape and charge.
- Conservative substitutions are well-known in the art and typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and tyrosine, phenylalanine.
- Certain amino acids may be substituted for other amino acids in a polypeptide structure without appreciable loss of interactive binding capacity with structures such as, for example, antigen-binding regions of antibodies or binding sites on substrate molecules or binding sites on proteins interacting with a polypeptide. Since it is the interactive capacity and nature of a polypeptide which defines that polypeptide' s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and its underlying DNA coding sequence, and nevertheless obtain a protein with like properties. In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydrophobic amino acid index in conferring interactive biological function on a protein is generally understood in the art. Alternatively, the substitution of like amino acids can be made effectively on the basis of hydrophilicity.
- a peptide mimetic may be a peptide-containing molecule that mimics elements of protein secondary structure.
- the underlying rationale behind the use of peptide mimetics is that the peptide backbone of proteins exists chiefly to orient amino acid side chains in such a way as to facilitate molecular interactions, such as those of antibody and antigen, enzyme and substrate or scaffolding proteins.
- a peptide mimetic is designed to permit molecular interactions similar to the natural molecule.
- a mimetic may not be a peptide at all, but it will retain the essential biological activity of a natural polypeptide.
- Polypeptides may be produced by expression in a prokaryotic cell or produced synthetically. These polypeptides typically lack native post-translational processing, such as glycosylation. Polypeptides may be labeled with radiolabels, fluorescent labels, enzymatic labels, proteins, haptens, antibodies, sequence tags.
- SACl polypeptide refers to a protein or polypeptide encoded by the SACl locus, variants, fragments or functional mimics thereof.
- a SAC polypeptide may be that derived from any of the exons described herein which may be in isolated and/or purified form.
- the length of SACl polypeptide sequences is generally at least about 5 amino acids, usually at least about 10, 15, 20, 30 residues.
- Alcohol consumption relates to the intake and/or preference of an animal for ethanol.
- Diabetes refers to any disorder that exhibits phenotypic features of an increased or decreased level of a biological substance associated with glucose or fatty acid metabolism.
- carbohydrate refers to simple mono and disaccharides.
- sequence variation or “variant form” encompass all forms of polymorphism and mutations.
- a sequence variation may range from a single nucleotide variation to the insertion, modification, or deletion of more than one nucleotide.
- a sequence variation may be located at the exon, intron, or regulatory region of a gene.
- Polymorphism refers to the occurrence of two or more genetically determined alternative sequences or alleles in a population. A biallelic polymorphism has two forms.
- a triallelic polymorphism has three forms.
- a polymorphic site is the locus at which sequence divergence occurs. Diploid organisms may be homozygous or heterozygous for allelic forms. Polymorphic sites have at least two alleles, each occurring at frequency of greater than 1% of a selected population. Polymorphic sites also include restriction fragment length polymorphisms, variable number of tandem repeats (VNTRs), hypervariable regions, minisatellites, dinucleotide repeats, trinucleotide repeats, tetranucleotide repeats, simple sequence repeats, and insertion elements.
- the first identified allelic form may be arbitrarily designated as the reference sequence and other allelic forms may be designated as alternative or variant alleles. The allelic form occurring most frequently in a selected population is sometimes referred to as the wild type form or the consensus sequence.
- Mutations include deletions, insertions and point mutations in the coding and noncoding regions. Deletions may be of the entire gene or of only a portion of the gene. Point mutations may result in stop codons, frameshift mutations, or amino acid substitutions. Somatic mutations are those which occur only in certain tissues, such as liver, heart, etc. and are not inherited in the germline. Germline mutations can be found in any of a body's tissues and are inherited.
- “Operably linked” refers to a juxtaposition wherein the components are in a relationship permitting them to function in their intended manner. For instance, a promoter is operably linked to a coding sequence if the promoter affects its transcription or expression.
- probes refers to polynucleotide of any suitable length which allows specific hybridization to the target region. Probes may be attached to a label or reporter molecule using known methods in the art. Probes may be selected by using homologous polynucleotides. Alternatively, polynucleotides encoding these or similar polypeptides may be synthesized or selected by use of the redundancy in the genetic code. Various codon substitutions may be introduced, e.g., by silent changes (thereby producing various restriction sites) or to optimize expression for a particular system. Mutations may be introduced to modify the properties of the polypeptide, perhaps to change ligand-binding affinities, interchain affinities, or the polypeptide degradation or turnover rate.
- Probes comprising synthetic oligonucleotides or other polynucleotides of the present invention may be derived from naturally occurring or recombinant single- or double-stranded polynucleotides, or be chemically synthesized. Probes may also be labeled by nick translation, Klenow fill-in reaction, or other methods known in the art.
- Portions of the polynucleotide sequence having at least about 8 nucleotides, usually at least about 15 nucleotides, and fewer than about 6 kb, usually fewer than about 1.0 kb, from a polynucleotide sequence encoding SACl are preferred as probes.
- isolated is used interchangeably to describe a protein or polypeptide which has been separated from components which accompany it in its natural state.
- a monomeric protein is substantially pure when at least about 60% to 75% of a sample exhibits a single polypeptide sequence.
- a substantially pure protein will typically comprise about 60% to 90% W/W of a protein sample, more usually about 95%, and preferably will be over about 99% pure. Protein purity or homogeneity may be indicated by a number of means well-known in the art, such as polyacrylamide gel electrophoresis of a protein sample, followed by visualizing a single polypeptide band upon staining the gel. For certain purposes, higher resolution may be provided by using HPLC or other means well-known in the art which are utilized for purification.
- a SACl protein is substantially free of naturally associated components when it is separated from the native contaminants which accompany it in its natural state.
- a polypeptide which is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be substantially free from its naturally associated components.
- a protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well-known in the art.
- Recombinant nucleic acid is a nucleic acid which is not naturally occurring, or which is made by the artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by either chemical synthesis means, or by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques. Such is usually done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a sequence recognition site. Alternatively, it is performed to join together nucleic acid segments of desired functions to generate a desired combination of functions.
- regulatory sequences refers to those sequences normally within 100 kb of the coding region of a locus, but they may also be more distant from the coding region, which affect the expression of the gene (including transcription of the gene, and translation, splicing, stability or the like of the messenger RNA).
- nucleic acid or fragment thereof is of substantially homologous ("or substantially similar") to another if, when optimally aligned (with appropriate nucleotide insertions or deletions) with the other nucleic acid (or its complementary strand), there is nucleotide sequence identity in at least about 60% of the nucleotide bases, usually at least about 70%, more usually at least about 80%, preferably at least about 90%, and more preferably at least about 95-98% of the nucleotide bases.
- Identity means the degree of sequence relatedness between two polypeptide or two polynucleotides sequences as determined by the identity of the match between two strings of such sequences. Identity can be readily calculated (Lesk A.M., ed., Computational Molecular Biology, New York: Oxford
- nucleic acid or fragment thereof will hybridize to another nucleic acid (or a complementary strand thereof) under selective hybridization conditions, to a strand, or to its complement.
- Selectivity of hybridization exists when hybridization which is substantially more selective than total lack of specificity occurs.
- selective hybridization will occur when there is at least about 55% homology over a stretch of at least about 14 nucleotides, preferably at least about 65%, more preferably at least about 75%, and most preferably at least about 90%.
- the length of homology comparison, as described, may be over longer stretches, and in certain embodiments will often be over a stretch of at least about 9 nucleotides, usually at least about 20 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32 nucleotides, and preferably at least about 36 or more nucleotides.
- Nucleic acid hybridization will be affected by such conditions as salt concentration, temperature, or organic solvents, in addition to the base composition, length of the complementary strands, and the number of nucleotide base mismatches between the hybridizing nucleic acids, as will be readily appreciated by those skilled in the art.
- Stringent temperature conditions will generally include temperatures in excess of 30°C, typically in excess of 37°C, and preferably in excess of 45°C.
- Stringent salt conditions will ordinarily be less than 1000 mM, typically less than 500 mM, and preferably less than 200 mM. However, the combination of parameters is much more important than the measure of any single parameter.
- substantially homology or “substantial identity,” when referring to polypeptides, indicate that the polypeptide or protein in question exhibits at least about 30% identity with an entire naturally-occurring protein or a portion thereof, usually at least about 70% identity, and preferably at least about 95% identity.
- homology for polypeptides, is typically measured using sequence analysis software (see, e.g., the Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center). Protein analysis software matches similar sequences using measures of homology assigned to various substitutions, deletions and other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- Substantially similar function refers to the function of a modified nucleic acid or a modified protein, with reference to the wild-type SACl nucleic acid or wild-type SACl polypeptide.
- the modified polypeptide will be substantially homologous to the wild-type SACl polypeptide and will have substantially the same function.
- the modified polypeptide may have an altered amino acid sequence and/or may contain modified amino acids.
- the modified polypeptide may have other useful properties, such as a longer half-life.
- the similarity of function (activity) of the modified polypeptide may be substantially the same as the activity of the wild-type SACl polypeptide.
- the similarity of function (activity) of the modified polypeptide may be higher than the activity of the wild-type SACl polypeptide.
- the modified polypeptide is synthesized using conventional techniques, or is encoded by a modified nucleic acid and produced using conventional techniques.
- the modified nucleic acid is prepared by conventional techniques.
- a nucleic acid with a function substantially similar to the wild-type SACl gene function produces the modified protein described above.
- a polypeptide "fragment,” “portion,” or “segment” is a stretch of amino acid residues of at least about 5 to 7 contiguous amino acids, often at least about 7 to 9 contiguous amino acids, typically at least about 9 to 13 contiguous amino acids and, most preferably, at least about 20 to 30 or more contiguous amino acids.
- the polypeptides of the present invention may be coupled to a solid-phase support, e.g., nitrocellulose, nylon, column packing materials (e.g., Sepharose beads), magnetic beads, glass wool, plastic, metal, polymer gels, cells, or other substrates.
- a solid-phase support e.g., nitrocellulose, nylon, column packing materials (e.g., Sepharose beads), magnetic beads, glass wool, plastic, metal, polymer gels, cells, or other substrates.
- Such supports may take the form, for example, of beads, wells, dipsticks, or membranes.
- Target region refers to a region of the nucleic acid which is amplified and/or detected.
- target sequence refers to a sequence with which a probe or primer will form a stable hybrid under desired conditions.
- mice differ in their intake of sweeteners (Bachmanov A. A., Reed D.R., Tordoff M.G., Price R.A., and Beauchamp G.K. Intake of ethanol, sodium chloride, sucrose, citric acid, and quinine hydrochloride solutions by mice: a genetic analysis. Behavior Genetics, 1996;26:563-573; Lush I.E., The genetics of tasting in mice. VI. Saccharin, acesulfame, dulcin and sucrose.
- BAC sequencing within this interval led to the identification of a gene that has a 30% amino acid homology with other putative taste receptors (Hoon M.A. et al. Putative mammalian taste receptors: a class of taste-specific GPCRs with distinct topographic selectivity. Cell, 1999;96:541-551). This gene is expressed in mouse tongue. Mutation detection on this gene revealed a missense mutation (Ile61Thr) with four other sequence variants define a haplotype found in mice with low sweetener preference (129, Balb/c, AKR, and DBA2). An alternative five variant haplotype is found in mice with a high preference for sweet fluids (B6, SWR, IS, ST, and SEA). A human ortholog of this gene exists, and is expressed in human taste papillae. We therefore suggest that this gene is a sweet taste receptor, and variation within this gene is responsible for the phenotype of the Sac locus.
- mice from the high sweetener preference C57BL/6ByJ; B6) and the low sweetener preference (129P3/J; formerly 129/J, abbreviated here as 129) were used as parental strains to produce an F2 generation.
- the F2 mice were phenotyped for sweetener preference using 96-hour two-bottle taste tests and genotyped with markers polymorphic between the B6 and 129 strains (Fig. 1 A).
- the results of this analysis indicated peak linkage near marker DI 8346 with the B6 allele having a dominant mode of inheritance.
- 129.B6-S ⁇ c partially congenic mice were created, using genotypic (B6 allele at DI 8346; Fig. IB) and phenotypic (high saccharin intake; Fig. 1 C) characteristics as selection criteria for each > generation.
- Genotyping of partially congenic mice with polymorphic markers defined the Sac nonrecombinant interval.
- Radiation hybrid mapping was conducted with additional markers (R74924, D 18402, D 18346, Agrin, V2r2 and D4Ertd296e). These markers were amplified using DNA and mouse and hamster control DNA in the T31 mouse radiation hybrid panel, scored for the presence or absence of an appropriately sized band, and the data analyzed by the Jackson Laboratory.
- BAC libraries were screened with markers within the nonrecombinant interval, and a contig was developed (Fig. ID).
- a BAC clone was selected for sequencing (RPCI-23-118E21, 246 kb).
- a gene with a 30% homology to T1R1 was discovered (Fig. 2A), along with other ESTs and known genes (Table 1).
- the human ortholog to this gene was identified from a BAC available in the public htgs database, and the predicted protein sequence was aligned with SACl and T1R1.
- SACl is 858 amino acids in length and contains six exons; the intron and exon boundaries were determined by sequencing of the mouse tongue cDNA (Fig. 2B). The secondary structure of this protein with regards to transmembrane domains was predicted (Fig. 2C).
- B6 mice have higher maximal gustatory neural firing in response to sweeteners compared with 129 mice, as do the 129.B6-S ⁇ c partially congenic strains (Bachmanov A.A. et al. Sucrose consumption in mice: major influence of two genetic loci affecting peripheral sensory responses. Mammalian Genome, 1997;8:545-548). Thus, the SACl gene is likely to be expressed in tongue.
- RNA from mouse and human tongue was extracted, reversed transcribed into cDNA and primers, chosen to span an intron, were used in a PCR reaction. Genomic and cDNA yielded bands of different sizes, which were purified and sequenced (Figure 4AB).
- Gpr70 (formerly TR1 or T1R1) as a putative sweet receptor based mainly on its expression in anterior tongue taste cells. Since it also mapped to distal chromosome 4, it was a logical candidate for SACl. However, we have shown that Gpr70 is at least 4 cM proximal to SACl (Li X. et al.
- the saccharin preference locus (Sac) and the putative sweet taste receptor (Gpr70) gene have distinct locations on mouse chromosome 4. Mammalian Genome, 2001;12:13-16). Nevertheless, Gpr70 could be an additional sweet receptor and there could be others.
- sucrose is perceived to be bad for human health, considerable resources are directed toward the discovery of high potency, low caloric sweeteners.
- Most of the most widely known high potency sweeteners were discovered serendipitously, i.e., the sweetener was synthesized for a different purpose and someone in the laboratory accidentally tasted it and discovered it was sweet (Walters E.D. The rational discovery of sweeteners. In Sweeteners. Discovery, molecular design, and chemoreception, eds. Walters D.E., Orthoefer F.T., and DuBois G.E., American Chemical Society, USA, 1991:1-11). More direct methods, however, have been employed to identify new sweet compounds, and the sweet receptor has been extensively modeled to predict which ligands will be sweet.
- the SACl nonrecombinant region is small, less than 194 kb; this gene lies within this nonrecombinant interval and the peak of LOD score corresponds closely with the location of the gene.
- this gene has sequence homology to other putative taste receptors, and is expressed in the tongue.
- a haplotype with a missense mutation is found in mice with low sweetener preference but not in mice with high sweetener preference.
- Rats perceive ethanol flavor as a combination of components, including sweetness, bitterness, odor and irritation (burning sensation), which depend on ethanol concentration (Green B.G. The sensitivity of the tongue to ethanol. Ann. NY. Acad. Sci., 1987;510:315-7; Bartoshuk L.M., Conner E., Grubin D., Karrer T., Kochenbach K., Palsco M., et al. PROP supertasters and the perception of ethyl alcohol. Chem. Senses, 1993.). Rats detect sweet (sucrose-like) and bitter (quinine-like) sensory components in ethanol (Kiefer S.W., Lawrence G.J.
- Alcohol 1992;9:155-60; Stewart R.B., Russell R.N., Lumeng L., Li T-K., Murphy J.M. Consumptions of sweet, salty, sour, and bitter solutions by selectively bred alcohol-preferring and alcohol- nonpreferring lines of rats.
- Psychopharmacol. 1993;112:503-10; Bachmanov A. A., Reed D.R., Tordoff M.G., Price R.A., Beauchamp G.K.
- Ethanol consumption is a complex trait, depending on multiple mechanisms of its regulation and determined by multiple genes.
- a body of evidence suggests that ethanol consumption may depend on perception of its flavor, and that there is an association between perception and consumption of ethanol and sweet-tasting compounds.
- SACl a gene associated with the detection of a sensing of carbohydrates, other sweet compounds, and alcohols including ethanol.
- the sequence of the mouse SACl cDNA (SEQ ID NO: 1) is:
- the geonomic DNA sequence of the mouse SACl gene (SEQ ID NO: 2) is:
- CTCATGTTCCTG GCCAAGGTGGGCAGTCAAAGCATTGCTGCCTACTGCAACTACACACAG
- GAAGTAGCTCC GAGGGGTTGGGTCCCAGCACTTGGCCACTGTGAGACTGATGGGCCTAC
- the polypeptide sequence of mouse SACl (SEQ ID NO: 3) is: MPALAIMGLSLAAFLELGMGASLCLSQQFKAQGDYILGGLFPLGSTEEAT LNQRTQPNSIPCNRFSPLGLFLAMAMKMAVEEINNGSALLPGLRLGYDLF DTCSEPVVTMKSSLMFLAKVGSQSIAAYCNYTQYQPRVLAVIGPHSSELA LITGKFFSFFLMPQVSYSASMDRLSDRETFPSFFRTVPSDRVQLQAVVTLL QNFSWNWVAALGSDDDYGREGLSIFSSLANARGICIAHEGLVPQHDTSGQ QLGKVLD VLRQVNQSKVQ VVVLFAS ARAV YSLFS YSIHHGLSPKVWVAS ESWLTSDLVMTLPNIARVGTVLGFLQRGALLPEFSHYVETHLALAADPAF CASLNAELDLEEHVMGQRCPRCDDIMLQNLSSGLLQNLSAGQLHHQ
- the cDNA of human SACl (SEQ ID NO: 4) is:
- polypeptide sequence of human SACl substantially from the translated region of the human cDNA is:
- GPCR G-protein coupled receptor
- GPCRs also known as 7-transmembrane receptors
- GPCRs can be subdivided into more than 30 families on the basis of their ligands.
- Sac is most closely allied by sequence homology with the Ca " " -sensing, metabotropic receptors.
- ANF_receptor family contains the metabotropic and calcium-sensing families of GCPs.
- the closest sequence homology of the mouse SAC gene is to the Ca " *-* " sensing receptors, all of which are GCPRs.
- An alignment between a calcium sensing GPCR (BAA09453) is shown in Fig. 5.
- Figure 6 is a plot of the transmembrane domains of SACl .
- the predicted proteins were submitted to a TBLASTN search through the nr and the mouse EST database at NCBI.
- TRl-like is expressed in tongue as detected by RT-PCR.
- Previously named genes are in italics, and ESTs or EST clusters in plain text.
- polynucleotides of the present invention may be produced by replication in a suitable host cell.
- Natural or synthetic polynucleotide fragments coding for a desired fragment will be incorporated into recombinant polynucleotide constructs, usually DNA constructs, capable of introduction into and replication in a prokaryotic or eukaryotic cell.
- the polynucleotide constructs will be suitable for replication in a unicellular host, such as yeast or bacteria, but may also be intended for introduction to (with and without integration within the genome) cultured mammalian or plant or other eukaryotic cell lines.
- nucleic acids produced by the methods of the present invention is described, e.g., in Ausubel et al., Current Protocols in Molecular Biology, Vol. 1-2, John Wiley & Sons, 1992 and Sambrook et al., Molecular Cloning A Laboratory Manual, 2nd Ed., Vols. 1-3, Cold Springs Harbor Press,
- the polynucleotides of the present invention may also be produced by chemical synthesis, e.g., by the phosphoramidite method or the triester method, and may be performed on commercial, automated oligonucleotide synthesizers.
- a double-stranded fragment may be obtained from the single-stranded product of chemical synthesis either by synthesizing the complementary strand and annealing the strands together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
- Polynucleotide constructs prepared for introduction into a prokaryotic or eukaryotic host may comprise a replication system recognized by the host, including the intended polynucleotide fragment encoding the desired polypeptide, and will preferably also include transcription and translational initiation regulatory sequences operably linked to the polypeptide encoding segment.
- Expression vectors may include, for example, an origin of replication or autonomously replicating sequence (ARS) and expression control sequences, a promoter, an enhancer and necessary processing information sites, such as ribosome-binding sites, RNA splice sites, polyadenylation sites, transcriptional terminator sequences, and mRNA stabilizing sequences.
- ARS origin of replication or autonomously replicating sequence
- Secretion signals may also be included where appropriate, whether from a native SACl protein or from other receptors or from secreted polypeptides of the same or related species, which allow the protein to cross and/or lodge in cell membranes, and thus attain its functional topology, or be secreted from the cell.
- Such vectors may be prepared by means of standard recombinant techniques well-known in the art and discussed, for example, in Sambrook et al., 1989 or Ausubel et al., 1992.
- promoter and other necessary vector sequences will be selected so as to be functional in the host, and may include, when appropriate, those naturally associated with SACl genes. Examples of workable combinations of cell lines and expression vectors are described in Sambrook et al., 1989 or Ausubel et al., 1992. Many useful vectors are known in the art and may be obtained from commercial vendors. Promoters such as the trp, lac and phage promoters, TRNA promoters and glycolytic enzyme promoters may be used in prokaryotic hosts.
- Useful yeast promoters include promoter regions for metallothionein, 3-phosphoglycerate kinase or other glycolytic enzymes such as enolase or glyceraldehyde-3 -phosphate dehydrogenase, enzymes responsible for maltose and galactose utilization, and others.
- the construct may be joined to an amplifiable gene so that multiple copies of the gene may be made.
- enhancer and other expression control sequences see also Enhancers and Eukaryotic Gene Expression, New York: Cold Spring Harbor Press, 1983. See also, e.g., US Patent Nos. 5,691,198; 5,735,500; 5,747,469 and 5,436,146.
- Expression and cloning vectors will likely contain a selectable marker, a gene encoding a protein necessary for survival or growth of a host cell transformed with the vector. The presence of this gene ensures growth of only those host cells which express the inserts.
- Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxic substances, e.g., ampicillin, neomycin, methotrcxate, etc.; (b) complement auxotrophic deficiencies; or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
- the choice of the proper selectable marker will depend on the host cell, and appropriate markers for different hosts are well-known in the art.
- the vectors containing the nucleic acids of interest can be transcribed in vitro, and the resulting RNA introduced into the host cell by well-known methods, e.g., by injection, or the vectors can be introduced directly into host cells by methods well-known in the art, which vary depending on the type of cellular host, including electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; infection (where the vector is an infectious agent, such as a retroviral genome); and other methods.
- the introduction of the polynucleotides into the host cell by any method known in the art, including, inter alia, those described above, will be referred to herein as
- nucleic acids and polypeptides of the present invention may be prepared by expressing the SACl nucleic acids or portions thereof in vectors or other expression vehicles in compatible prokaryotic or eukaryotic host cells.
- prokaryotic hosts are strains of Escherichia coli, although other prokaryotes, such as Bacillus subtilis or Pseudomonas may also be used.
- Mammalian or other eukaryotic host cells such as those of yeast, filamentous fungi, plant, insect, or amphibian or avian species, may also be useful for production of the proteins of the present invention.
- Propagation of mammalian cells in culture is per se well-known. Examples of commonly used mammalian host cell lines are VERO and HeLa cells, Chinese hamster ovary (CHO) cells, and W138, BHK, and COS cell lines.
- An example of a commonly used insect cell line is SF9.
- other cell lines may be appropriate, e.g., to provide higher expression, desirable glycosylation patterns, or other features.
- Clones are selected by using markers depending on the mode of the vector construction.
- the marker may be on the same or a different DNA molecule, preferably the same DNA molecule.
- the transformant may be selected, e.g., by resistance to ampicillin, tetracycline or other antibiotics. Production of a particular product based on temperature sensitivity may also serve as an appropriate marker.
- a biological sample may be prepared and analyzed forthe presence or absence of susceptibility alleles of SACl. Results of these tests and interpretive information may be returned to the health care professionals for communication to the tested individual. Such diagnoses may be performed by diagnostic laboratories. In addition, diagnostic kits may be manufactured and available to health care providers or to private individuals for self-diagnosis.
- a basic format for sequence or expression analysis is finding sequences in DNA or RNA extracted from affected family members which create abnormal SACl gene products or abnormal levels of SACl gene product.
- the diagnostic or screening method may involve amplification or molecular cloning of the relevant
- SACl sequences For example, PCR based amplification may be used. Once amplified, the resulting nucleic acid can be sequenced or used as a substrate for DNA probes. Primers and probes specific for the SACl gene sequences may be used to identify SACl alleles.
- the pairs of single-stranded DNA primers can be annealed to sequences within or surrounding the SACl gene in order to prime amplifying DNA synthesis of the SACl gene itself.
- the set of primers may allow synthesis of both intron and exon sequences. Allele-specific primers can also be used. Such primers anneal only to particular SACl mutant alleles, and thus will only amplify a product in the presence of the mutant allele as a template.
- primers may have restriction enzyme site sequences appended to their 5' ends.
- all nucleotides of the primers are derived from SACl sequences or sequences adjacent to SACl, except for the few nucleotides necessary to form a restriction enzyme site.
- restriction enzyme site sequences are well-known in the art.
- the primers themselves can be synthesized using techniques which are well-known in the art. Generally, the primers can be made using oligonucleotide synthesizers which are commercially available.
- the biological sample to be analyzed such as blood, may be treated, if desired, to extract the nucleic acids.
- the sample nucleic acid may be prepared in various ways to facilitate detection of the target sequence; e.g., denaturation, restriction digestion, electrophoresis or dot blotting.
- the region of interest of the target nucleic acid is usually at least partially single-stranded to form hybrids with the probe. If the sequence is double-stranded, the sequence will probably need to be denatured.
- the target nucleic acid may be also be fragmented to reduce or eliminate the formation of secondary structures. The fragmentation may be performed using a number of methods, including enzymatic, chemical, thermal cleavage or degradation.
- fragmentation may be accomplished by heat/Mg2+ treatment, endonuclease (e.g., DNAase 1) treatment, restriction enzyme digestion, shearing (e.g., by ultrasound) or NaOH treatment.
- endonuclease e.g., DNAase 1
- restriction enzyme digestion e.g., by ultrasound
- NaOH treatment e.g., NaOH
- target nucleic acid and probe are incubated under conditions which forms hybridization complex between the probe and the target sequence.
- the region of the probes which is used to bind to the target sequence can be made completely complementary to the targeted region of the SACl locus. Therefore, high stringency conditions may be desirable in order to prevent false positives.
- conditions of high stringency are typically used if the probes are complementary to regions of the chromosome which are unique in the genome.
- the stringency of hybridization is determined by a number of factors during hybridization and during the washing procedure, including temperature, ionic strength, base composition, probe length, and concentration
- Detection, if any, of the resulting hybrid is usually accomplished by the use of labeled probes.
- the probe may be unlabeled, but may be detectable by specific binding with a ligand which is labeled, either directly or indirectly.
- Suitable labels, and methods for labeling probes and ligands are known in the art, and include, for example, radioactive labels which may be incorporated by known methods (e.g., nick translation, random priming or kinase reaction), biotin, fluorescent groups, chemiluminescent groups (e.g., dioxetanes, particularly triggered dioxetanes), enzymes, antibodies and the like. Variations of this basic scheme are known in the art, and include those variations that facilitate separation of the hybrids to be detected from extraneous materials and/or that amplify the signal from the labeled moiety.
- Two-step label amplification methodologies are known in the art. These assays work on the principle that a small ligand (such as digoxigenin, biotin, or the like) is attached to a nucleic acid probe capable of specifically binding SACl.
- a small ligand such as digoxigenin, biotin, or the like
- the small ligand attached to the nucleic acid probe is specifically recognized by an antibody-enzyme conjugate.
- digoxigenin is attached to the nucleic acid probe.
- Hybridization is detected by an antibody-alkaline phosphatase conjugate which turns over a chemiluminescent substrate.
- the small ligand is recognized by a second ligand-enzyme conjugate that is capable of specifically complexing to the first ligand.
- a well-known embodiment of this example is the biotin-avidin type of interactions. It is also contemplated within the scope of this invention that the nucleic acid probe assays of this invention will employ a cocktail of nucleic acid probes capable of detecting SACl.
- more than one probe complementary to SACl is employed.
- Predisposition to diabetes, obesity, or alcoholism can be ascertained by testing any fluid or tissue of a human for sequence variations of the SACl gene.
- a person who has inherited a germline SACl mutation would be prone to develop obesity, diabetes, or alcoholism. This can be determined by testing DNA from any tissue of the person's body. Most simply, blood can be drawn and DNA extracted from the cells of the blood. In addition, prenatal diagnosis can be accomplished by testing fetal cells, placental cells or amniotic cells for mutations of the SACl gene. The most definitive test for mutations in a candidate locus is to directly compare genomic SACl sequences from obese, diabetic, or alcoholic patients, with those from a control population. Alternatively, one could sequence messenger RNA after amplification, e.g., by PCR, thereby eliminating the necessity of determining the exon structure of the candidate gene.
- Sequence variations from diabetic, obese, or alcoholic patients falling outside the coding region of SACl can be detected by examining the non-coding regions, such as introns and regulatory sequences near or within the SACl gene.
- An early indication that mutations in noncoding regions are important may come from Northern blot experiments that reveal messenger RNA molecules of abnormal size or abundance in obese or diabetic patients as compared to control individuals.
- Alteration of SACl mRNA expression can be detected by any techniques known in the art (see above). These include Northern blot analysis, PCR amplification, RNase protection, and gene chip analysis. Diminished mRNA expression indicates an alteration of the wild-type SACl gene.
- the diabetic, obese, or alcoholic condition can also be detected on the basis of the alteration of wild-type SACl polypeptide.
- the presence of a SACl gene variant, which produces a protein having a loss of function, or altered function may directly correlate to an increased risk of obesity or diabetes.
- Such variation can be determined by sequence analysis in accordance with conventional techniques.
- antibodies polyclonal or monoclonal may be used to detect differences in, or the absence of, SACl polypeptides.
- Antibodies may immunoprecipitate SACl proteins from solution as well as react with SACl protein on Western or immunoblots of polyacrylamide gels.
- Antibodies may also detect SACl proteins in paraffin or frozen tissue sections, using immunocytochemical techniques.
- Immunoassay include, for example, enzyme linked immunosorbent assays (ELISA), radioimmunoassays (RIA), immunoradiometric assays (IRMA) and immunoenzymatic assays (IEMA), sandwich assays, etc.
- Functional assays such as protein binding determinations, can be used. Finding a mutant SACl gene product indicates alteration of a wild-type SACl gene.
- This invention is also useful for screening compounds by using the SACl polypeptide or binding fragment thereof in any of a variety of drug, sweetener, and alcohol screening techniques.
- the SACl polypeptide or fragment employed in such a test may either be free in solution, affixed to a solid support, or borne on a cell surface.
- One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant polynucleotides expressing the polypeptide or fragment, preferably in competitive binding assays. Such cells, either in viable or fixed form, can be used for standard binding assays.
- One may measure, for example, for the formation of complexes between a SACl polypeptide or fragment and the agent being tested, or examine the degree to which the formation of a complex between a SACl polypeptide or fragment and a known ligand is interfered with by the agent being tested.
- the present invention provides methods of screening for drugs and sweeteners comprising contacting such an agent with a SACl polypeptide or fragment thereof and assaying (i) for the presence of a complex between the agent and the SACl polypeptide or fragment, or (ii) for the presence of a complex between the SACl polypeptide or fragment and a ligand, by methods well-known in the art.
- the SACl polypeptide or fragment is typically labeled. Free SACl polypeptide or fragment is separated from that present in a proteimprotein complex, and the amount of free (i.e., uncomplexed) label is a measure of the binding of the agent being tested to SACl or its interference with SACl:ligand binding, respectively.
- SACl polypeptides may be synthesized on a solid substrate, such as plastic pins or some other surface.
- the peptide test compounds are reacted with SACl polypeptide and washed. Bound SACl polypeptide is then detected by methods well-known in the art.
- Purified SACl can be coated directly onto plates for use in the aforementioned drug screening techniques.
- non-neutralizing antibodies to the polypeptide can be used to capture antibodies to immobilize the SACl polypeptide on the solid phase.
- This invention also contemplates the use of competitive drug, sweetener, and alcohol screening assays in which neutralizing antibodies capable of specifically binding the SACl polypeptide compete with a test compound for binding to the SACl polypeptide or fragments thereof. In this manner, the antibodies can be used to detect the presence of any peptide which shares one or more antigenic determinants of the SACl polypeptide.
- a further technique for drug, sweetener, and alcohol screening involves the use of host eukaryotic cell lines or cells which have a nonfunctional SACl gene. These host cell lines or cells are defective at the SACl polypeptide level. The host cell lines or cells are grown in the presence of the drug, sweetener, or alcohol compound. The rate of growth of the host cells is measured to determine if the compound is capable of regulating the growth of SACl defective cells.
- a method of screening for a substance which modulates activity of a polypeptide may include contacting one or more test substances with the polypeptide in a suitable reaction medium, testing the activity of the treated polypeptide and comparing that activity with the activity of the polypeptide in comparable reaction medium untreated with the test substance or substances. A difference in activity between the treated and untreated polypeptides is indicative of a modulating effect of the relevant test substance or substances.
- test substances Prior to or as well as being screened for modulation of activity, test substances may be screened for ability to interact with the polypeptide, e.g., in a yeast two-hybrid system. This system may be used as a coarse screen prior to testing a substance for actual ability to modulate activity of the polypeptide. Altematively, the screen could be used to screen test substances for binding to a SACl specific binding partner, or to find mimetics of a SACl polypeptide.
- the goal of rational drug design is to produce structural analogs of biologically active polypeptides of interest or of small molecules with which they interact (e.g., agonists, antagonists, inhibitors) in order to fashion drugs which are, for example, more active or stable forms of the polypeptide, or which, e.g., enhance or interfere with the function of a polypeptide in vivo.
- one first determines the three-dimensional structure of a protein of interest (e.g., SACl polypeptide) or, for example, of the SACl -receptor or ligand complex, by x-ray crystallography, by computer modeling or most typically, by a combination of approaches.
- peptides e.g., SACl polypeptide
- an amino acid residue is replaced by Ala, and its effect on the peptide' s activity is determined.
- Each of the amino acid residues of the peptide is analyzed in this manner to determine the important regions of the peptide. It is also possible to isolate a target-specific antibody, selected by a functional assay, and then to solve its crystal structure. In principle, this approach yields a pharmacore upon which subsequent drug design can be based.
- anti-idiotypic antibodies anti-ids
- the binding site of the anti-ids would be expected to be an analog of the original receptor.
- the anti-id could then be used to identify and isolate peptides from banks of chemically or biologically produced banks of peptides. Selected peptides would then act as the pharmacore.
- drugs which have, e.g., improved SACl polypeptide activity or stability or which act as inhibitors, agonists, antagonists, etc. of SACl polypeptide activity.
- sufficient amounts of the SACl polypeptide may be made available to perform such analytical studies as x-ray crystallography.
- the knowledge of the SACl protein sequence provided herein will guide those employing computer modeling techniques in place of, or in addition to x-ray crystallography. Following identification of a substance which modulates or affects polypeptide activity, the substance may be investigated further.
- the present invention extends in various aspects not only to a substance identified using a nucleic acid molecule as a modulator of polypeptide activity, in accordance with what is disclosed herein, but also a pharmaceutical composition, medicament, drug or other composition comprising such a substance, a method comprising administration of such a composition comprising such a substance, a method comprising administration of such a composition to a patient, e.g., for treatment of diabetes, obesity or alcohol consumption, use of such a substance in the manufacture of a composition for administration, e.g., for treatment of diabetes or alcohol consumption, and a method of making a pharmaceutical composition comprising admixing such a substance with a pharmaceutically acceptable excipient, vehicle or carrier, and optionally other ingredients.
- a substance identified as a modulator of polypeptide function may be peptide or non-peptide in nature.
- Non-peptide "small molecules" are often preferred for many in vivo pharmaceutical uses. Accordingly, a mimetic or mimic of the substance (particularly if a peptide) may be designed for pharmaceutical use.
- the designing of mimetics to a known pharmaceutically active compound is a known approach to the development of pharmaceuticals based on a "lead" compound. This might be desirable where the active compound is difficult or expensive to synthesize or where it is unsuitable for a particular method of administration, e.g., pure peptides are unsuitable active agents for oral compositions as they tend to be quickly degraded by proteases in the alimentary canal.
- Mimetic design, synthesis and testing is generally used to avoid randomly screening large numbers of molecules for a target property.
- the pharmacophore Once the pharmacophore has been found, its structure is modeled according to its physical properties, e.g., stereochemistry, bonding, size and/or charge, using data from a range of sources, e.g., spectroscopic techniques, x-ray diffraction data and NMR. Computational analysis, similarity mapping (which models the charge and/or volume of a pharmacophore, rather than the bonding between atoms) and other techniques can be used in this modeling process.
- a range of sources e.g., spectroscopic techniques, x-ray diffraction data and NMR.
- Computational analysis, similarity mapping which models the charge and/or volume of a pharmacophore, rather than the bonding between atoms
- other techniques can be used in this modeling process.
- the three-dimensional structure of the ligand and its binding partner are modeled. This can be especially used where the ligand and/or binding partner change conformation on binding, allowing the model to take account of this in the design of the mimetic.
- a template molecule is then selected onto which chemical groups which mimic the pharmacophore can be grafted.
- the template molecule and the chemical groups grafted onto it can conveniently be selected so that the mimetic is easy to synthesize, is likely to be pharmacologically acceptable, and does not degrade in vivo, while retaining the biological activity of the lead compound.
- the mimetic is peptide-based
- further stability can be achieved by cyclizing the peptide, increasing its rigidity.
- the mimetic(s) found by this approach can then be screened to see whether they have the target property, or to what extent they exhibit it. Further optimization or modification can then be carried out to arrive at one or more final mimetics for in vivo or clinical testing.
- a method is also provided of supplying wild-type SACl function to a cell which carries mutant SACl alleles.
- the wild- type SACl gene or a part of the gene may be introduced into the cell in a vector such that the gene remains extrachromosomal. In such a situation, the gene will be expressed by the cell from the extra chromosomal location. More preferred is the situation where the wild-type SACl gene or a part thereof is introduced into the mutant cell in such a way that it recombines with the endogenous mutant SACl gene present in the cell. Such recombination requires a double recombination event which results in the correction of the SACl gene mutation.
- Vectors for introduction of genes both for recombination and for extrachromosomal maintenance are known in the art, and any suitable vector may be used.
- Methods for introducing DNA into cells such as electroporation, calcium phosphate coprecipitation and viral transduction are known in the art, and the choice of method is within the competence of skilled practitioners.
- the SACl gene or fragment may be employed in gene therapy methods in order to increase the amount of the expression products of such genes in diabetic or obese cells.
- Such gene therapy is particularly appropriate, in which the level of SACl polypeptide is absent or compared to normal cells. It may also be useful to increase the level of expression of a given SACl gene even in those situations in which the mutant gene is expressed at a "normal" level, but the gene product is not fully functional.
- Gene therapy would be carried out according to generally accepted methods, for example, as described by Therapy for Genetic Diseases, T. Friedman, ed. Oxford University Press, 1991.
- Cells from a patient would be first analyzed by the diagnostic methods described above, to ascertain the production of SACl polypeptide in these cells.
- a virus or plasmid vector containing a copy of the SACl gene linked to expression control elements and capable of replicating inside the sample cells, is prepared. Suitable vectors are known, such as disclosed in PCT publications WO 93/07282 and United States PatentNos. 5,252,479, 5,691,198, 5,747,469, 5,436,146 and 5,753,500. The vector is then injected into the patient.
- Gene transfer systems known in the art may be useful in the practice of the gene therapy methods of the present invention. These include viral and nonviral transfer methods.
- viruses have been used as gene transfer vectors, including papovaviruses, e.g., SV40, adenovirus, vaccinia virus, adeno-associated virus, herpes viruses including HSV and EBV; lentiviruses, Sindbis and Semliki Forest virus, and retroviruses of avian, murine, and human origin.
- papovaviruses e.g., SV40, adenovirus, vaccinia virus, adeno-associated virus, herpes viruses including HSV and EBV; lentiviruses, Sindbis and Semliki Forest virus, and retroviruses of avian, murine, and human origin.
- Most human gene therapy protocols have been based on disabled murine retroviruses.
- Nonviral gene transfer methods known in the art include chemical techniques such as calcium phosphate coprecipitation; mechanical techniques, for example microinjection; membrane fusion-mediated transfer via liposomes; and direct DNA uptake and receptor-mediated DNA transfer.
- Viral-mediated gene transfer can be combined with direct in vivo gene transfer using liposome delivery, allowing one to direct the viral vectors to the affected cells and not into the surrounding nondividing cells.
- the retroviral vector producer cell line can be injected into affected cells. Injection of producer cells would then provide a continuous source of vector particles.
- plasmid DNA of any size is combined with a polylysine-conjugated antibody specific to the adenovirus hexon protein, and the resulting complex is bound to an adenovirus vector.
- the trimolecular complex is then used to infect cells.
- the adenovirus vector permits efficient binding, internalization, and degradation of the endosome before the coupled DNA is damaged.
- Liposome/DNA complexes have been shown to be capable of mediating direct in vivo gene transfer. While in standard liposome preparations the gene transfer process is nonspecific, localized in vivo uptake and expression may be accomplished folio v/ing direct in situ administration.
- Expression vectors in the context of gene therapy are meant to include those constructs containing sequences sufficient to express a polynucleotide that has been cloned therein.
- the construct contains viral sequences sufficient to support packaging of the construct. If the polynucleotide encodes SACl, expression will produce SACl. If the polynucleotide encodes an antisense polynucleotide or a ribozyme, expression will produce the antisense polynucleotide or ribozyme. Thus in this context, expression does not require that a protein product be synthesized.
- the vector also contains a promoter functional in eukaryotic cells.
- the cloned polynucleotide sequence is under control of this promoter. Suitable eukaryotic promoters include those described above.
- the expression vector may also include sequences, such as selectable markers and other sequences described herein.
- Receptor-mediated gene transfer may be accomplished by the conjugation of DNA (usually in the form of covalently closed supercoiled plasmid) to a protein ligand via polylysine.
- Ligands are chosen on the basis of the presence of the corresponding ligand receptors on the cell surface of the target cell/tissue type.
- One appropriate receptor/ligand pair may include the estrogen receptor and its ligand, estrogen (and estrogen analogues). These ligand-DNA conjugates can be injected directly into the blood if desired and are directed to the target tissue where receptor binding and internalization of the DNA-protein complex occurs.
- coinfection with adenovirus can be included to disrupt endosome function.
- Peptides which have SACl activity can be supplied to cells which carry mutant or missing SACl alleles.
- Protein can be produced by expression of the cDNA sequence in bacteria, for example, using known expression vectors.
- SACl polypeptide can be extracted from SACl -producing mammalian cells.
- the techniques of synthetic chemistry can be employed to synthesize SACl protein. Any of such techniques can provide the preparation of the present invention which comprises the SACl protein. Preparation is substantially free of other human proteins. This is most readily accomplished by synthesis in a microorganism or in vitro.
- Active SACl molecules can be introduced into cells by microinjection or by use of liposomes, for example. Alternatively, some active molecules may be taken up by cells, actively or by diffusion. Extra-cellular application of the SACl gene product may be sufficient. Molecules with SACl activity (for example, peptides, drugs or organic compounds) may also be used to effect such a reversal. Modified polypeptides having substantially similar function are also used for peptide therapy.
- cells and animals which carry a mutant SACl allele can be used as model systems to study and test for substances which have potential as therapeutic agents. These may be isolated from individuals with SACl mutations, either somatic or germline. Alternatively, the cell line can be engineered to carry the mutation in the SACl allele.
- Animals for testing therapeutic agents can be selected after mutagenesis of whole animals or after treatment of germline cells or zygotes. Such treatments include insertion of mutant SACl alleles, usually from a second animal species, as well as insertion of disrupted homologous genes. Alternatively, the endogenous SACl gene of the animals may be disrupted by insertion or deletion mutation or other genetic alterations using conventional techniques to produce knockout or transplacement animals. A transplacement is similar to a knockout because the endogenous gene is replaced, but in the case of a transplacement the replacement is by another version of the same gene. After test substances have been administered to the animals, the phenotype must be assessed. If the test substance prevents or suppresses the disease, then the test substance is a candidate therapeutic agent for the treatment of disease. These animal models provide an extremely important testing vehicle for potential therapeutic products.
- transgenic animals are produced which contain a functional transgene encoding a functional SACl polypeptide or variants thereof.
- Transgenic animals expressing SACl transgenes, recombinant cell lines derived from such animals and transgenic embryos may be useful in methods for screening for and identifying agents that induce or repress function of SACl.
- Transgenic animals of the present invention also can be used as models for studying indications such as diabetes.
- a SACl transgene is introduced into a non-human host to produce a transgenic animal expressing a human or murine SACl gene.
- the transgenic animal is produced by the integration of the transgene into the genome in a manner that permits the expression of the transgene. Methods for producing transgenic animals are generally described in US Patent
- transgenic animals may be produced from the fertilized eggs from a number of animals including, but not limited to reptiles, amphibians, birds, mammals, and fish. Within a particularly preferred embodiment, transgenic mice are generated which express a mutant form of the polypeptide.
- transgenic animals and cell lines derived from such animals may find use in certain testing experiments.
- transgenic animals and cell lines capable of expressing wild-type or mutant SACl may be exposed to test substances. These test substances can be screened for the ability to reduce overexpression of wild-type SACl or impair the expression or function of mutant SACl.
- test substances can be screened for the ability to reduce overexpression of wild-type SACl or impair the expression or function of mutant SACl.
- SACl polypeptides, antibodies, peptides and nucleic acids of the present invention can be formulated in pharmaceutical compositions, which are prepared according to conventional pharmaceutical compounding techniques. See, for example, Remington 's Pharmaceutic. Sciences, 18th Ed. (Easton, PA: Mack
- compositions may contain the active agent or pharmaceutically acceptable salts of the active agent.
- These compositions may comprise, in addition to one of the active substances, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well-known in the art. Such materials should be nontoxic and should not interfere with the efficacy of the active ingredient.
- the carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., intravenous, oral, intrathecal, epineural or parenteral.
- the compounds can be formulated into solid or liquid preparations such as capsules, pills, tablets, lozenges, melts, powders, suspensions or emulsions.
- any of the usual pharmaceutical media may be employed, such as, for example, water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents, suspending agents, and the like in the case of oral liquid preparations (such as, for example, suspensions, elixirs and solutions); or carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like in the case of oral solid preparations (such as, for example, powders, capsules and tablets).
- tablets and capsules represent the most advantageous oral dosage unit form, in which case solid pharmaceutical carriers are obviously employed. If desired, tablets may be sugar-coated or enteric-coated by standard techniques.
- the active agent can be encapsulated to make it stable to passage through the gastrointestinal tract while at the same time allowing for passage across the blood brain barrier. See for example, WO 96/11698.
- the compound may be dissolved in a pharmaceutical carrier and administered as either a solution or a suspension.
- suitable carriers are water, saline, dextrose solutions, fructose solutions, ethanol, or oils of animal, vegetative or synthetic origin.
- the carrier may also contain other ingredients, for example, preservatives, suspending agents, solubilizing agents, buffers and the like.
- the compounds When the compounds are being administered intrathecally, they may also be dissolved in cerebrospinal fluid.
- the active agent is preferably administered in a therapeutically effective amount.
- the actual amount administered, and the rate and time-course of administration, will depend on the nature and severity of the condition being treated. Prescription of treatment, e.g., decisions on dosage, timing, etc., is within the responsibility of general practitioners or specialists, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of techniques and protocols can be found in Remington 's Pharmaceutical Sciences.
- targeting therapies may be used to deliver the active agent more specifically to certain types of cell, by the use of targeting systems such as antibodies or cell specific ligands.
- Targeting may be desirable for a variety of reasons, e.g., if the agent is unacceptably toxic, or if it would otherwise require too high a dosage, or if it would not otherwise be able to enter the target cells. Instead of administering these agents directly, they could be produced in the target cell, e.g., in a viral vector such as described above or in a cell based delivery system such as described in United States Patent No.
- mice Animal care and maintenance. All animal protocols used in these studies were approved by the Monell Institutional Animal Care and Use Committee. Mice were housed in individual cages in a temperature- controlled room at 23°C on a 12-hour light: 12-hour dark cycle. The animals had free access to deionized water and Teklad Rodent Diet 8604 (Harlan Teklad, Madison, Wl).
- the F2 mice were genotyped with several markers on the distal part of chromosome 4, and a few F2 mice with recombinations in this region were used as founders of strains partially congenic with the 129 strain. These F2 founders were backcrossed to the 129 strain to produce the N2 generation. Mice from this and subsequent backcross generations were phenotyped using 96-hour two-bottle tests with saccharin solutions, and genotyped using markers on distal chromosome 4 and on other autosomes.
- mice with high saccharin intake (with a fragment of distal chromosome 4 from the B6 strain and homozygous for 129 alleles of markers on other chromosomes) were selected for subsequent backcrossing. This marker-assisted selection resulted in a segregating 129.B6-S ⁇ c partially congenic strain. Three strains were created, with different overlapping fragments containing the SACl gene.
- Genomic DNA was purified from mouse tails by NaOH/Tris (Beier, personal communication; Truett G.E. et al., Preparation of PCR-quality mouse genomic DNA with hot sodium hydroxide and tris (HotSHOT) [In Process Citation]. Biotechniques, 2000;29:52, 54), or the phenol/chloroform method. All F2 mice were genotyped with all available polymorphic microsatellite markers (Research Genetics,
- MAPMAKER An interactive complex package for constructing primary linkage maps of experimental and natural populations. Genomics, 1987;1:174-181), indicated that Sac mapped distal to D4Mit256, and therefore all available STS and EST were tested by SSCP (Orita M., Iwahana H., Kanazawa H., Hayashi K., and Sekiya T. Detection of polymorphisms of human DNA by gel electrophoresis as single-strand conformation polymo hins. Proceedings of the National Academy of Sciences of the USA, 1989:86) or direct sequencing, for polymorphisms between the B6 and 129 strains. Polymorphisms between strains were found for the following markers: D18346, AA410003 (K00231), V2r2, and D4Erdt296E, and the linkage analysis conducted again using these polymorphic makers. EXAMPLE 5
- Genotyping of partially congenic mice Three partially congenic strains of mice were genotyped with all available markers, and those markers with two 129 alleles were excluded from the SACl nonrecombinant interval.
- BAC contig and marker development To construct a physical map of the SACl region, the RPCI-23 BAC library was screened with markers within and near the SACl nonrecombinant interval: each marker was tested by whole cell PCR to confirm its presence. Only those markers positive by both hybridization and PCR are shown. Primers for the BAC ends were constructed from sequence obtained through TIGR (www.tigr.org) or by direct sequencing, when necessary. Each positive clone was tested for the presence of each BAC end (if the BAC end contained unique sequence), and the contig oriented using SEGMAP, Version 3.48 (Green E.D. and Green P. Sequence- tagged site (STS) content mapping of human chromosomes: theoretical considerations and early experiences.
- BAC end sequences was amplified in B6 and 129 strains, and analyzed by SSCP or direct sequencing. Those BAC ends polymorphic between 129 and B6 were tested in the recombinant F2 and partially congenic mice, to further narrow the SACl nonrecombinant interval.
- PCR products were sequenced using genomic DNA from B6 and 129 mouse strains, as well as other strains with either higher (SWR/J, C57L/J, IS, ST/bJ, SEA GnJ) or lower (DBA/2J, AKR J, BALB/cByJ) saccharin preference (Lush I.E., The genetics of tasting in mice. VI. Saccharin, acesulfame, dulcin and sucrose. Genet Res., 1989;53:95-99; Lush I. The genetics of bitterness, sweetness, and saltiness in strains of mice, in Genetics of perception and communication, Vol. 3, eds. Wysocki C.
- Tissue Expression of SACl Oligonucleotide primers specific for different parts of the SACl gene were used to assay different tissues for SACl expression as shown in Table 2.
- Tissue specific cDNA pools were purchased from OriGene Technologies Ltd.
- Primer pair 3 A amplifies parts of exons 2 and 3, with a small intron to differentiate between PCR product representing genomic DNA versus cDNA.
- Primer pair 6 A amplifies parts of exons 4 and 5. This part of the protein encodes the 7TM domain, and may cross react with other GPCRs expressed in different tissues. Table 2. Expression pattern of SACl Tissue 3A 6A
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Diabetes (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Biomedical Technology (AREA)
- Psychiatry (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Addiction (AREA)
- Hospice & Palliative Care (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Child & Adolescent Psychology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Emergency Medicine (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US20079400P | 2000-04-28 | 2000-04-28 | |
| US200794P | 2000-04-28 | ||
| US22141900P | 2000-07-28 | 2000-07-28 | |
| US221419P | 2000-07-28 | ||
| US24744300P | 2000-11-10 | 2000-11-10 | |
| US247443P | 2000-11-10 | ||
| PCT/US2001/013387 WO2001083749A2 (en) | 2000-04-28 | 2001-04-25 | Gene and sequence variation associated with sensing carbohydrate compounds and other sweeteners |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1280899A2 true EP1280899A2 (en) | 2003-02-05 |
Family
ID=27394202
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP01928871A Withdrawn EP1280899A2 (en) | 2000-04-28 | 2001-04-25 | Gene and sequence variation associated with sensing carbohydrate compounds and other sweeteners |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP1280899A2 (en) |
| JP (1) | JP2003531614A (en) |
| AU (1) | AU2001255681A1 (en) |
| CA (1) | CA2406999A1 (en) |
| WO (1) | WO2001083749A2 (en) |
Families Citing this family (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7402400B2 (en) | 2001-07-03 | 2008-07-22 | Regents Of The University Of California | Mammalian sweet taste receptors |
| TW201006846A (en) | 2000-03-07 | 2010-02-16 | Senomyx Inc | T1R taste receptor and genes encidung same |
| CA2408140A1 (en) * | 2000-05-22 | 2001-11-29 | Incyte Genomics, Inc. | G-protein coupled receptors |
| US20040039170A1 (en) * | 2000-09-25 | 2004-02-26 | Sophia Kossida | Regulation of human g protein-coupled receptor |
| TW201022287A (en) | 2001-01-03 | 2010-06-16 | Senomyx Inc | T1R taste receptors and genes encoding same |
| US6955887B2 (en) | 2001-03-30 | 2005-10-18 | Senomyx, Inc. | Use of T1R hetero-oligomeric taste receptor to screen for compounds that modulate taste signaling |
| US7763431B1 (en) | 2001-03-07 | 2010-07-27 | Senomyx, Inc. | Binding assays that use the T1R2/T1R3 (sweet) taste receptor to identify compounds that elicit or modulate sweet taste |
| US7368285B2 (en) | 2001-03-07 | 2008-05-06 | Senomyx, Inc. | Heteromeric umami T1R1/T1R3 taste receptors and isolated cells that express same |
| US20080244761A1 (en) | 2001-03-07 | 2008-10-02 | Senomyx, Inc. | T1r hetero-oligomeric taste receptors and cell lines that express said receptors and use thereof for identification of taste compounds |
| US7309577B2 (en) | 2001-03-07 | 2007-12-18 | Senomyx, Inc. | Binding assays that use the T1R1/T1R3 (umami) taste receptor to identify compounds that elicit or modulate umami taste |
| US7301009B2 (en) | 2001-06-26 | 2007-11-27 | Senomyx, Inc. | Isolated (T1R1/T1R3) umami taste receptors that respond to umami taste stimuli |
| US7803982B2 (en) | 2001-04-20 | 2010-09-28 | The Mount Sinai School Of Medicine Of New York University | T1R3 transgenic animals, cells and related methods |
| EP1572871A4 (en) * | 2001-04-20 | 2007-11-14 | Sinai School Medicine | T1r3 a novel taste receptor |
| DK2327985T3 (en) | 2001-06-26 | 2016-09-05 | Senomyx Inc | H1 Oligomeric T1R Taste Receptors and Cell Lines Expressing the Receptors, and Their Use to Identify Taste Compounds |
| WO2003004992A2 (en) * | 2001-07-03 | 2003-01-16 | The Regents Of The University Of California | Mammalian sweet and amino acid heterodimeric taste receptors |
| US20050106571A1 (en) | 2003-10-02 | 2005-05-19 | The Regents Of The University Of California | Mammalian T1R3 sweet taste receptors |
| US8796441B2 (en) | 2005-04-13 | 2014-08-05 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Human sweet and umami taste receptor variants |
| US9804157B1 (en) | 2013-03-15 | 2017-10-31 | Senomyx, Inc. | Screening assays to identify compounds which modulate T1R associated taste modalities which eliminate false positives |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001064882A2 (en) * | 2000-02-29 | 2001-09-07 | Millennium Pharmaceuticals, Inc. | 1983, 52881, 2398, 45449, 50289, and 52872, g protein-coupled receptors and uses therefor |
| TW201006846A (en) * | 2000-03-07 | 2010-02-16 | Senomyx Inc | T1R taste receptor and genes encidung same |
| CA2408140A1 (en) * | 2000-05-22 | 2001-11-29 | Incyte Genomics, Inc. | G-protein coupled receptors |
-
2001
- 2001-04-25 CA CA002406999A patent/CA2406999A1/en not_active Abandoned
- 2001-04-25 WO PCT/US2001/013387 patent/WO2001083749A2/en not_active Ceased
- 2001-04-25 JP JP2001580356A patent/JP2003531614A/en active Pending
- 2001-04-25 AU AU2001255681A patent/AU2001255681A1/en not_active Abandoned
- 2001-04-25 EP EP01928871A patent/EP1280899A2/en not_active Withdrawn
Non-Patent Citations (1)
| Title |
|---|
| See references of WO0183749A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2003531614A (en) | 2003-10-28 |
| AU2001255681A1 (en) | 2001-11-12 |
| WO2001083749A3 (en) | 2002-07-18 |
| WO2001083749A2 (en) | 2001-11-08 |
| CA2406999A1 (en) | 2001-11-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1280899A2 (en) | Gene and sequence variation associated with sensing carbohydrate compounds and other sweeteners | |
| PL185549B1 (en) | Genetic se | |
| US7214483B2 (en) | KCNQ2 and KCNQ3—potassium channel genes which are mutated in benign familial neonatal convulsions (BFNC) and other epilepsies | |
| US6207383B1 (en) | Mutations in and genomic structure of HERG—a long QT syndrome gene | |
| US7247436B2 (en) | Mutations in the KCNE1 gene encoding human minK which cause arrhythmia susceptibility thereby establishing KCNE1 as an LQT gene | |
| US7208273B2 (en) | Common polymorphism in scn5a implicated in drug-induced cardiac arrhythmia | |
| JP3449419B2 (en) | Long QT syndrome gene encoding KVLQT1 and its association with minK | |
| JP2006296424A (en) | Method for detecting changes in DNA mismatch repair pathway | |
| US20050227279A1 (en) | Methods of using torsin proteins, to prevent protein misfolding and treat protein aggregation-associated disorders | |
| US20080261231A1 (en) | Diabetes gene | |
| AU778566B2 (en) | MinK-related genes, formation of potassium channels and association with cardiac arrhythmia | |
| US6972176B2 (en) | KVLQT1—a long QT syndrome gene | |
| US20040081964A1 (en) | Gene and sequence variation associated with sensing carbohydrate compounds and other sweeteners | |
| JP2006506988A (en) | Human type II diabetes gene located on chromosome 5q35-SLIT-3 | |
| US6864364B1 (en) | MinK-related genes, formation of potassium channels and association with cardiac arrhythmia | |
| US7446239B2 (en) | SCA2 knockout animal and methods of use | |
| US5776762A (en) | Obesity associated genes | |
| US5770432A (en) | Obesity associated genes | |
| GB2383044A (en) | ALMS1 gene | |
| KR20050016634A (en) | Nucleotide sequences that code for torsin genes, torsin proteins, and methods of using the same to treat protein-aggregation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| AK | Designated contracting states |
Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
| 17P | Request for examination filed |
Effective date: 20030120 |
|
| 17Q | First examination report despatched |
Effective date: 20030527 |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: THE MONELL CHEMICAL SENSES CENTER Owner name: WARNER-LAMBERT COMPANY LLC |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: THE MONELL CHEMICAL SENSES CENTER Owner name: WARNER-LAMBERT COMPANY LLC |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20061101 |