EP1230368A2 - Mammalian receptor proteins; related reagents and methods - Google Patents

Mammalian receptor proteins; related reagents and methods

Info

Publication number
EP1230368A2
EP1230368A2 EP00982122A EP00982122A EP1230368A2 EP 1230368 A2 EP1230368 A2 EP 1230368A2 EP 00982122 A EP00982122 A EP 00982122A EP 00982122 A EP00982122 A EP 00982122A EP 1230368 A2 EP1230368 A2 EP 1230368A2
Authority
EP
European Patent Office
Prior art keywords
dcrs3
polypeptide
dcrs4
sequence
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP00982122A
Other languages
German (de)
French (fr)
Inventor
Daniel M. Gorman
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merck Sharp and Dohme LLC
Original Assignee
Schering Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Schering Corp filed Critical Schering Corp
Publication of EP1230368A2 publication Critical patent/EP1230368A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention relates to compositions and methods for affecting mammalian physiology, including immune system function. In particular, it provides methods to regulate development and/or the immune system. Diagnostic and therapeutic uses of these materials are also disclosed.
  • Recombinant DNA technology refers generally to techniques of integrating genetic information from a donor source into vectors for subsequent processing, such as through introduction into a host, whereby the transferred genetic information is copied and/or expressed in the new environment.
  • the genetic information exists in the form of complementary DNA (cDNA) derived from messenger RNA (mRNA) coding for a desired protein product.
  • cDNA complementary DNA
  • mRNA messenger RNA
  • the carrier is frequently a plasmid having the capacity to incorporate cDNA for later replication in a host and, in some cases, actually to control expression of the cDNA and thereby direct synthesis of the encoded product in the host. See, e.g., Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual , (2d ed.) vols .
  • Lymphokines apparently mediate cellular activities in a variety of ways. See, e.g., Paul (ed. 1996) Fundamental
  • B-cells which can produce and secrete immunoglobulins (proteins with the capability of recognizing and binding to foreign matter to effect its removal)
  • T-cells of various subsets that secrete lymphokines and induce or suppress the B-cells and various other cells (including other T-cells) making up the immune network.
  • the present invention provides new receptors for ligands exhibiting similarity to cytokine like compositions and related compounds, and methods for their use.
  • the present invention is directed to novel receptors related to cytokine receptors, e.g., primate, cytokine receptor like molecular structures, designated DNAX Cytokine Receptor Subunits (DCRS) , and their biological activities.
  • DCRS3 referring to two embodiments designated DCRS3.1 and DCRS3.2
  • DCRS4 referring to three embodiments designated DCRS4.1, DCRS4.2, and DCRS4.3
  • It includes nucleic acids coding for the polypeptides themselves and methods for their production and use.
  • the nucleic acids of the invention are characterized, in part, by their homology to cloned complementary DNA (cDNA) sequences enclosed herein.
  • the present invention provides a composition of matter selected from: a substantially pure or recombinant: DCRS3 polypeptide comprising: at least three distinct nonoverlapping segments of at least four amino acids identical to segments of SEQ ID NO: 2 or 25; a substantially pure or recombinant DCRS3 polypeptide comprising at least two distinct nonoverlapping segments of at least five amino acids identical to segments of SEQ ID NO: 2 or 25; a natural sequence DCRS3 comprising mature SEQ ID NO: 2 or 25; a fusion polypeptide comprising DCRS3 sequence; or DCRS4 polypeptide comprising: at least three distinct nonoverlapping segments of at least four amino acids identical to segments of SEQ ID NO: 5, 28, or 31; a substantially pure or recombinant DCRS4 polypeptide comprising at least two distinct nonoverlapping segments of at least five amino acids identical to segments of SEQ ID NO: 5, 28, or 31; a natural sequence DCRS4 comprising mature SEQ ID NO: 5, 28, or 31; or a fusion polypeptide comprising DCRS4 sequence.
  • the invention embraces such a substantially pure or isolated antigenic DCRS3 or DRS4 polypeptide, wherein the distinct nonoverlapping segments of identity: include one of at least eight amino acids; include one of at least four amino acids and a second of at least five amino acids; include at least three segments of at least four, five, and six amino acids, or include one of at least twelve amino acids.
  • DCRS3 polypeptide comprises a mature sequence of Table 1; is an unglycosylated form of DCRS3 ; is from a primate, such as a human; comprises at least seventeen amino acids of SEQ ID NO: 2 or 25; exhibits at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 2 or 25; comprises a sequence of at least 3 amino acids on each side across an exon boundary; is a natural allelic variant of DCRS3; has a length at least about 30 amino acids; exhibits at least two non-overlapping epitopes which are specific for a primate DCRS3 ; is glycosylated; has a molecular weight of at least 30 kD with natural glycosylation; is a synthetic polypeptide; is attached to a solid substrate; is conjugated to another chemical moiety; is a 5-fold or less substitution from natural sequence; or is a deletion or insertion variant from a natural sequence; or DCRS4 polypeptide: comprises a mature sequence of Table 3
  • Still other embodiments include a composition comprising: a substantially pure DCRS3 and another cytokine receptor family member; a sterile DCRS3 polypeptide; the DCRS3 polypeptide and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration; a substantially pure DCRS4 and another cytokine receptor family member; a sterile DCRS4 polypeptide; the DCRS4 polypeptide and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
  • Fusion polypeptide embodiments include those comprising: mature protein sequence of Table 1 or 3 ; a detection or purification tag, including a FLAG, His6, or Ig sequence; or sequence of another interferon receptor protein.
  • Kit embodiments include those comprising such a polypeptide, and: a compartment comprising the protein or polypeptide; or instructions for use or disposal of reagents in the kit.
  • Binding compound embodiments include, e.g., a binding compound comprising an antigen binding site from an antibody, which specifically binds to a natural: DCRS3 polypeptide, wherein: the binding compound is in a container; the DCRS3 polypeptide is from a human; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised against a peptide sequence of a mature polypeptide of Table 1; is raised against a mature DCRS3 ; is raised to a purified human DCRS3; is immunoselected; is a polyclonal antibody; binds to a denatured DCRS3; exhibits a Kd to antigen of at least 30 ⁇ M; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label; or DCRS4 polypeptide, wherein: the binding compound is in a container
  • Methods are provided, e.g., of producing an antigen: antibody complex, comprising contacting under appropriate conditions: a primate DCRS3 polypeptide with a described antibody, thereby allowing the complex to form; or a primate DCRS4 polypeptide with a described antibody, thereby allowing the complex to form.
  • a primate DCRS3 polypeptide with a described antibody thereby allowing the complex to form
  • a primate DCRS4 polypeptide with a described antibody thereby allowing the complex to form.
  • compositions comprising: a sterile binding compound, as described, or the described binding compound and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
  • Nucleic acid embodiments include, e.g., an isolated or recombinant nucleic acid encoding the DCRS3 polypeptide, wherein the: DCRS3 is from a human; or the nucleic acid: encodes an antigenic peptide sequence of Table 1; encodes a plurality of antigenic peptide sequences of Table 1; exhibits identity over at least thirteen nucleotides to a natural cDNA encoding the segment; is an expression vector; further comprises an origin of replication; is from a natural source; comprises a detectable label; comprises synthetic nucleotide sequence; is less than 6 kb, preferably less than 3 kb; is from a primate; comprises a natural full length coding sequence; is a hybridization probe for a gene encoding the DCRS3 ; or is a PCR primer, PCR product, or mutagenesis primer; or an isolated or recombinant nucleic acid encoding the DCRS4 polypeptide, wherein the: DCRS4 is from
  • the cell is: a prokaryotic cell; a eukaryotic cell; a bacterial cell; a yeast cell; an insect cell; a mammalian cell; a mouse cell; a primate cell; or a human cell.
  • Kit embodiments include those comprising a described nucleic acid, and: a compartment comprising the nucleic acid; a compartment further comprising a primate DCRS3 or DCRS4 polypeptide; or instructions for use or disposal of reagents in the kit.
  • nucleic acid embodiments include a nucleic acid which: hybridizes under wash conditions of 30 minutes at 30° C and less than 2M salt to the coding portion of: SEQ ID NO: 1, 24, 4, 27, or 30; or exhibits identity over a stretch of at least about 30 nucleotides to a primate DCRS3 or DCRS4.
  • Preferred embodiments include those wherein: the wash conditions are at 45° C and/or 500 M salt; the wash conditions are at 55° C and/or 150 mM salt; the stretch is at least 55 nucleotides; or the stretch is at least 75 nucleotides.
  • Other methods include those of modulating physiology or development of a cell or tissue culture cells comprising contacting the cell with an agonist or antagonist of a mammalian DCRS3 or DCRS4.
  • the cell is transformed with a nucleic acid encoding a DCRS3 or DCRS4 and another cytokine receptor subunit.
  • the present invention provides the amino acid sequences and DNA sequences of mammalian, herein primate, cytokine receptorlike subunit molecules, these designated DNAX Cytokine Receptor Subunit 3 (DCRS3 ; 50R) and DNAX Cytokine Receptor Subunit 4 (DCRS4; cytor) having particular defined properties, both structural and biological .
  • DCRS3 DNAX Cytokine Receptor Subunit 3
  • DCRS4 DNAX Cytokine Receptor Subunit 4
  • Various cDNAs encoding these molecules were obtained from primate, e.g., human, cDNA sequence libraries. Other primate or other mammalian counterparts would also be desired.
  • Nucleotide (SEQ ID NO: 1) and corresponding amino acid sequence (SEQ ID NO: 2) of a human DCRS3 coding segment are shown in Table 1; likewise for the DCRS3.2 as SEQ ID NO: 24 and 25; comparison of DCRS3.1 and DCRS3.2 polypeptide sequences is shown also in Table 1. Reverse translations based upon the universal genetic code are provided in Table 2; comparison of the encoding nucleic acid sequences is also presented in Table
  • the sequences are derived from genomic sequence at chromosome location clones CIT987SK-582J2 HUAC004525 and CIT987- SKA-670B5 HUAC002303, at 16pl2, and other cDNA sequences.
  • the predicted signal sequence is indicated, but may depend on cell type, or may be a few residues in either direction.
  • the transmembrane segment (SEQ ID NO: 2) is predicted to run from about Ieu248-ser264 (glu242 -his268) .
  • Predicted fibronectin domain runs from about asnl28-tyr220 ; cytokine receptor WS box from about trp224-ser228 ; conserved disulfide motif between cys6-cys26; second conserved disulfide linkage at cys65-cys89 ,- five N glycosylation sites at Asn residues 61, 97, 121, 128, and 145; seven cAMP PK sites at lys4 ; lys68; lysl84; argl91; arg201; lys202; and lys292; fourteen Ca phosphorylation sites at thr71, serl30, serl87, ser205, ser237, serl82, serl95, ser310, ser317, thr323, ser374, ser385, ser403, and thr499; five myristoly sites at glyl74, gly303, gly439, gly449, and
  • Exon boundaries are predicted to be about between nucleotides g49-c50, g230-g231, g284-g285, a484-g485, g597-a598, g775-a776, g875-g876, and g957-a958. Because the sequences have been derived from genomic sequence, in which the introns have not been spliced out, particularly important compositions will be those which encode segments across the boundaries, e.g., both nucleic acid sequence and amino acid sequence.
  • the segments will comprise, e.g., segments across the boundary which may comprise 8, 9, 11, 13, 15, 17 20, 25, 30, 35, 50, or more nucleotides on either or both sides adjacent to an exon boundary, or 4 , 5, 6, 7, or 8 amino acids on either or both sides adjacent a boundary.
  • the lengths on either side need not be the same for purposes of novelty, e.g., three amino acids on one side and 5 on the other side.
  • compositions are provided comprising, e.g, 15 contiguous nucleotides across a boundary, of which at least 6 are from each side.
  • compositions are provided, e.g., comprising at least 3 amino acids from each side of the exon boundary, with a matching of at least 8 amino acids across the boundary. Also provided are compositions comprising a plurality of such segments across multiple exon boundaries, which different segments need not have the same length limitations.
  • the invention provides a nucleic acid comprising, e.g., at least 5 nucleotides in each side across the exon 1/2 boundary, and at least 4 nucleotides on either side of the the exon 3/4, 4/5, 5/6, and/or 6/7 boundaries. Natural sequence compositions would be preferred.
  • Nucleotide (SEQ ID NO: 4) and corresponding amino acid sequence (SEQ ID NO: 5) of a human DCRS4 coding segment are shown in Table 3; likewise for the DCRS4.2 as SEQ ID NO: 27 and 28 and the DCRS4.3 as SEQ ID NO: 30 and 31; comparison of DCRS4 polypeptide sequences is shown also in Table 3. Reverse translations based upon the universal genetic code are provided in Table 4; comparison of the encoding nucleic acid sequences is also presented in Table 4.
  • the sequence of DCRS4.1 is derived from genomic sequence at chromosome location 6q24.1-25.2, within some 50 kb of IFN ⁇ Rl chain.
  • the predicted DCRS4.1 signal sequence is indicated, but may depend on cell type, or may be a few residues in either direction.
  • This embodiment of the receptor lacks a transmembrane segment, which is unusual, but there is precedent for soluble forms of cytokine receptor subunits. See, e.g, IL-12R ⁇ (p40 subunit) and the EBI3 receptor subunit homolog.
  • the predicted cytokine receptor domain from prol0-arg49 conserved disulfide motif between cys57-cys65; five N glycosylation sites at Asn residues 35, 131, 136, 157, and 174; four cAMP PK sites at arg30, lys98, lysl06, and lysl56; eight Ca phosphorylation sites at thr4 , thr60, ser64, thr68, thr71, serl59, serl76, and ser220; three myristoly sites at gly89, glyl03, and glyl86; three PKC phosphorylation sites at ser7, ser97, and ser217; one amidation site at tyr79; one cAMP phosphorylation site at lys98; and two CK2 phosphorylation sites at ser3 and serl59.
  • Exon boundaries are predicted to be about between nucleotides c59-a60; tl97- al98, g206-a207, g430-c431, and g601-a602. Alignment with the other DCRS4 embodiments is provided. As described above, compositions with sequence across the exon boundaries are provided. Table 1: Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiments (DCRS3.1; 50R) . Primate, e.g., human embodiment (see SEQ ID NO : 1 and 2) . Predicted signal sequence indicated, but may vary by a few positions and depending upon cell type. atg ccg cgt ggc tgg gcc gccccc ttg etc ctg ctg ctg etc cag gga 48
  • DCRS3.1 537 FTSPGDEGPPRSYLRQ WIPPPLSSPGPQAS 568 *********************************************************************************************************
  • N may be A, C, G, or T.
  • N may be A, C, G, or T .
  • DCRS3.2 1 ATGCCGCGTGGCTGGGCCGCCCCCTTGCTCCTGCTGCTGCTCCAGGGAGC 50
  • DCRS3.1 1 ATGCCGCGTGGCTGGGCCGCCCCCTTGCTCCTGCTGCTGCTCCAGGGA-- 49
  • DCRS3.2 51 CCTCGAGGGGATGGAGAGGAAGCTCTGCAGTCCCAAGCCACCCCACCA 100 DCRS3.1 49 DCRS3.2 101 AGGCCTCTCTCCCCACTGACCCTCCAGGCTGGGGCTGCCCCGACCTCGTC 150 DCRS3.1 50 GCTGGGGCTGCCCCGACCTCGTC 72
  • DCRS3.2 809 TTCTCCTCCTGCTTGTCATAGTCTTCATTCCTGCCTTCTGGAGCCTGAAG 858
  • DCRS3.2 1159 AACTCGGGGGGCTCAGCTTACAGTGAGGAGAGGGATCGGCCATACGGCCT 1208 DCRS3.1 1069 AACTCGGGGGGCTCAGCTTACAGTGAGGAGAGGGATCGGCCATACGGCCT 1118
  • DCRS3.2 1309 GGCCTGGAGCCCAGCCCAGGCCTAGAGGACCCACTCTTGGATGCAGGGAC 1358
  • DCRS3.1 1219 GGCCTGGAGCCCAGCCCAGGCCTAGAGGACCCACTCTTGGATGCAGGGAC 1268********************************* DCRS3.2 1359 CACAGTCCTGTCCTGTGGCTGTGTCTCAGCTGGCAGCCCTGGGCTAGGAG 1408
  • DCRS3.2 1509 CTCAGAGAGTGAGGCGGGCTCACCCCTGGCCGGCCTGGATATGGACACGT 1558
  • DCRS3.1 1419 CTCAGAGAGTGAGGCGGGCTCACCCCTGGCCGGCCTGGATATGGACACGT 1468
  • DCRS3.1 1469 TTGACAGTGGCTTTGTGGGCTCTGACTGCAGCAGCCCTGTGGAGTGTGAC 1518
  • DCRS3.2 1609 TTCACCAGCCCCGGGGACGAAGGACCCCCCCGGAGCTACCTCCGCCAGTG 1658 DCRS3.1 1519 TTCACCAGCCCCGGGGACGAAGGACCCCCCCGGAGCTACCTCCGCCAGTG 1568
  • Table 3 Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiment 4 (DCRS4.1; cytor) .
  • Primate e.g., human embodiment (see SEQ ID NO: 4 and 5) .
  • aac aat tea eta gaa aag gag caa aag gtt tat gaa ggg get cac aga 576 Asn Asn Ser Leu Glu Lys Glu Gin Lys Val Tyr Glu Gly Ala His Arg 160 165 170 gcg gtt gaa att gaa get eta aca cca cac tec age tac tgt gta gtg 624
  • DCRS4.1 150 VMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLE 199
  • N may be A, C, G, or T.
  • N may be A, C, G, or T.
  • DCRS4.2 ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTCTTCCTTAC 50
  • DCRS4.3 1 ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTTTTCCTTAC 50
  • DCRS4.1 201 TGGACAGAGACAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAAC 250
  • DCRS4.2 201 TGGACAGAGACAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAAC 250
  • DCRS4.3 201 TGGACAGAGACAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAAC 250
  • DCRS4.1 351 AAGTAAACGGAAATCAAAGGGGAACCAGAAGACCAACACAGTGACTGCCC 400
  • DCRS4.1 401 CAGCTGCCCTGAAGGCATTTGCTGGATGTGCAAAAATAGATCCTCCAGTC 450
  • DCRS4.1 649 CTAACACCACACTCCAGCTACTGTGTAGTGGCTGAAATATATCAGCCCAT 698
  • DCRS4.2 595 CTAACACCACACTCCAGCTACTGTGTAGTGGCTGAAATATATCAGCCCAT 644
  • IL-2R is SEQ ID NO: 7
  • IL-9R is SEQ ID NO: 8
  • GM/IL-3/5 receptor b subunit common is SEQ ID NO: 9
  • TPOR is SEQ ID NO: 10
  • IL-7R is SEQ ID NO: 11 (see GenBank) .
  • IL-lORb is the beta subunit of IL-10R, human is SEQ ID NO: 12, mouse is SEQ ID NO: 13; INaRl is the beta subunit of IFNa with human SEQ ID NO: 14 and mouse SEQ ID NO: 15; INgR is interferon gamma receptor subunit alpha with human SEQ ID NO: 16 and mouse SEQ ID NO: 17; IL-lORa is the alpha receptor subunit with mouse SEQ ID NO: 18 and human SEQ ID NO: 19; INgS (SEQ ID NO: 20) is the beta receptor subunit for INFg; Zcytor7 (SEQ ID NO: 21) and CYTOR11 (SEQ ID NO: 22) are from patent filings from Zymogenetics, and INaR2 (SEQ ID NO: 23) is the beta subunit of the receptor for IFNa.
  • Table 5 shows comparison of sequences of cytokine receptor subunits with the primate, e.g., human, DCRS3.1 (50R) , and DCRS4.1 (cytor) . Both of the new genes are likely alpha type receptor subunits, and thus should bind to ligand without the need for a beta subunit. Based upon structural features, the ligand for the DCRS3 subunits are likely to be a member of the family of cytokines which includes IL-2, IL-4, IL-7, IL-9, and the additional cytokines which signal through IL-2 ⁇ common receptor-like subunits IL-13, IL-15, and the TSLP ligand.
  • the ligand for the DCRS4 receptor subunits are probably a ligand in the IL-10 or IFN families, which may be a multi-subunit cytokine, analogous to IL-6 and IL-12.
  • DCRS3 shall be used to describe a protein comprising an amino acid sequence shown in Table 1; likewise with DCRS4 and Table 3. In many cases, a substantial fragment thereof will be functionally or structurally equivalent, including, e.g., an extracellular or intracellular domain.
  • the invention also includes a protein variation of a DCRS3 allele whose sequence is provided, e.g., a mutein or soluble extracellular construct.
  • such agonists or antagonists will exhibit less than about 10% sequence differences, and thus will often have between 1- and 11 -fold substitutions, e.g., 2-, 3-, 5-, 7-fold, and others. It also encompasses allelic and other variants, e.g., natural polymorphic, of the protein described. Typically, it will bind to its corresponding biological ligand, perhaps in a dimerized state with an alpha receptor subunit, with high affinity, e.g., at least about 100 nM, usually better than about 30 nM, preferably better than about 10 nM, and more preferably at better than about 3 nM.
  • the term shall also be used herein to refer to related naturally occurring forms, e.g., alleles, polymorphic variants, and metabolic variants of the mammalian protein.
  • Preferred forms of the receptor complexes will bind the appropriate ligand with an affinity and selectivity appropriate for a ligand-receptor interaction.
  • This invention also encompasses combinations of proteins or peptides having substantial amino acid sequence identity with the amino acid sequences in Tables 1 or 3. It will include sequence variants with relatively few substitutions, e.g., preferably less than about 3-5.
  • a substantial polypeptide "fragment”, or “segment” is a stretch of amino acid residues of at least about 8 amino acids, generally at least 10 amino acids, more generally at least 12 amino acids, often at least 14 amino acids, more often at least 16 amino acids, typically at least 18 amino acids, more typically at least 20 amino acids, usually at least 22 amino acids, more usually at least 24 amino acids, preferably at least 26 amino acids, more preferably at least 28 amino acids, and, in particularly preferred embodiments, at least about 30 or more amino acids. Sequences of segments of different proteins can be compared to one another over appropriate length stretches .
  • fragments may exhibit functional properties of the intact subunits, e.g., the extracellular domain of the transmembrane receptor may retain the ligand binding features, and may be used to prepare a soluble receptor-like complex.
  • Amino acid sequence homology, or sequence identity is determined by optimizing residue matches. In some comparisons, gaps may be introduces, as required. See, e.g., Needleham, et al., (1970) J. Mol. Biol. 48:443-453; Sankoff, et al .
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • Homologous amino acid sequences are intended to include natural allelic and interspecies variations in the cytokine sequence. Typical homologous proteins or peptides will have from 50-100% homology (if gaps can be introduced), to 60-100% homology (if conservative substitutions are included) with an amino acid sequence segment of Table 1 or 3. Homology measures will be at least about 70%, generally at least 76%, more generally at least 81%, often at least 85%, more often at least 88%, typically at least 90%, more typically at least 92%, usually at least 94%, more usually at least 95%, preferably at least 96%, and more preferably at least 97%, and in particularly preferred embodiments, at least 98% or more. The degree of homology will vary with the length of the compared segments.
  • Homologous proteins or peptides will share most biological activities with the embodiments described in Table 1 or 3.
  • biological activity is used to describe, without limitation, effects on inflammatory responses, innate immunity, and/or morphogenic development by cytokine- like ligands.
  • these receptors should mediate phosphatase or phosphorylase activities, which activities are easily measured by standard procedures. See, e.g., Hardie, et al . (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, CA; Hanks, et al . (1991) Meth. Enzvmol .
  • the receptors, or portions thereof, may be useful as phosphate labeling enzymes to label general or specific substrates.
  • the subunits may also be functional immunogens to elicit recognizing antibodies, or antigens capable of binding antibodies.
  • ligand, agonist, antagonist, and analog of, e.g., a DCRS3 include molecules that modulate the characteristic cellular responses to cytokine ligand proteins, as well as molecules possessing the more standard structural binding competition features of ligand-receptor interactions, e.g., where the receptor is a natural receptor or an antibody.
  • the cellular responses likely are typically mediated through receptor tyrosine kinase pathways .
  • a ligand is a molecule which serves either as a natural ligand to which said receptor, or an analog thereof, binds, or a molecule which is a functional analog of the natural ligand.
  • the functional analog may be a ligand with structural modifications, or may be a wholly unrelated molecule which has a molecular shape which interacts with the appropriate ligand binding determinants.
  • the ligands may serve as agonists or antagonists, see, e.g., Goodman, et al . (eds. 1990) Goodman & Gilman's: The Pharmacological Bases of Therapeutics, Pergamon Press, New York.
  • Rational drug design may also be based upon structural studies of the molecular shapes of a receptor or antibody and other effectors or ligands. See, e.g., Herz, et al . (1997) J. Recept . Signal Transduct . Res. 17:671-776; and Chaiken, et al . (1996) Trends Biotechnol . 14:369-375. Effectors may be other proteins which mediate other functions in response to ligand binding, or other proteins which normally interact with the receptor.
  • One means for determining which sites interact with specific other proteins is a physical structure determination, e.g., x-ray crystallography or 2 dimensional NMR techniques. These will provide guidance as to which amino acid residues form molecular contact regions. For a detailed description of protein structural determination, see, e.g., Blundell and
  • the cytokine receptor-like proteins will have a number of different biological activities, e.g., modulating cell proliferation, or in phosphate metabolism, being added to or removed from specific substrates, typically proteins. Such will generally result in modulation of an inflammatory function, other innate immunity response, or a morphological effect, as typical of cytokine or interleukin signaling.
  • the subunit may have a specific low affinity binding to the ligand.
  • the receptors may signal through the JAK pathway. See, e.g., Ihle, et al . (1997) Stem Cells 15(suppl. 1) .105-111; Silvennoinen, et al . (1997) APMIS 105:497-509; Levy (1997)
  • the biological activities of the cytokine receptor subunits will be related to addition or removal of phosphate moieties to substrates, typically in a specific manner, but occasionally in a non specific manner. Substrates may be identified, or conditions for enzymatic activity may be assayed by standard methods, e.g., as described in Hardie, et al . (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, CA; Hanks, et al . (1991) Meth. Enzvmol. 200:38-62;
  • the receptor subunits may combine with other subunits, e.g., beta subunits, to form functional complexes, e.g., which may be useful for binding ligand or preparing antibodies. These will have substantial diagnostic uses, including detection or quantitation.
  • This invention contemplates use of isolated nucleic acid or fragments, e.g., which encode these or closely related proteins, or fragments thereof, e.g., to encode a corresponding polypeptide, preferably one which is biologically active.
  • this invention covers isolated or recombinant DNAs which encode combinations of such proteins or polypeptides having characteristic sequences, e.g., of DCRS3s or DCRS4s.
  • the nucleic acid is capable of hybridizing, under appropriate conditions, with a nucleic acid sequence segment shown in Tables 1 or 3 , but preferably not with a corresponding segment of other receptors, e.g., described in Table 5.
  • Said biologically active protein or polypeptide can be a full length protein, or fragment, and will typically have a segment of amino acid sequence highly homologous, e.g., exhibiting significant stretches of identity, to ones shown in Tables 1 or 3. Further, this invention covers the use of isolated or recombinant nucleic acid, or fragments thereof, which encode proteins having fragments which are equivalent to DCRS3 or DCRS4 proteins .
  • the isolated nucleic acids can have the respective regulatory sequences in the 5' and 3' flanks, e.g., promoters, enhancers, poly-A addition signals, and others from the natural gene. Combinations, as described, are also provided.
  • an “isolated” nucleic acid is a nucleic acid, e.g., an RNA, DNA, or a mixed polymer, which is substantially pure, e.g., separated from other components which naturally accompany a native sequence, such as ribosomes, polymerases, and flanking genomic sequences from the originating species.
  • the term embraces a nucleic acid sequence which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates, which are thereby distinguishable from naturally occurring compositions, and chemically synthesized analogs or analogs biologically synthesized by heterologous systems.
  • a substantially pure molecule includes isolated forms of the molecule, either completely or substantially pure.
  • An isolated nucleic acid will generally be a homogeneous composition of molecules, but will, in some embodiments, contain heterogeneity, preferably minor. This heterogeneity is typically found at the polymer ends or portions not critical to a desired biological function or activity.
  • a "recombinant" nucleic acid is typically defined either by its method of production or its structure.
  • the process is use of recombinant nucleic acid techniques, e.g., involving human intervention in the nucleotide sequence.
  • this intervention involves in vitro manipulation, although under certain circumstances it may involve more classical animal breeding techniques.
  • it can be a nucleic acid made by generating a sequence comprising fusion of two fragments which are not naturally contiguous to each other, but is meant to exclude products of nature, e.g., naturally occurring mutants as found in their natural state.
  • nucleic acids comprising sequence derived using any synthetic oligonucleotide process.
  • Such a process is often done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a restriction enzyme sequence recognition site.
  • the process is performed to join together nucleic acid segments of desired functions to generate a single genetic entity comprising a desired combination of functions not found in the commonly available natural forms, e.g., encoding a fusion protein.
  • Restriction enzyme recognition sites are often the target of such artificial manipulations, but other site specific targets, e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design.
  • site specific targets e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design.
  • a similar concept is intended for a recombinant, e.g., fusion, polypeptide. This will include a dimeric repeat.
  • synthetic nucleic acids which, by genetic code redundancy, encode equivalent polypeptides to fragments of DCRS3 or DCRS4 and fusions of sequences from various different related molecules, e.g., other cytokine receptor family members.
  • a "fragment" in a nucleic acid context is a contiguous segment of at least about 17 nucleotides, generally at least 21 nucleotides, more generally at least 25 nucleotides, ordinarily at least 30 nucleotides, more ordinarily at least 35 nucleotides, often at least 39 nucleotides, more often at least 45 nucleotides, typically at least 50 nucleotides, more typically at least 55 nucleotides, usually at least 60 nucleotides, more usually at least 66 nucleotides, preferably at least 72 nucleotides, more preferably at least 79 nucleotides, and in particularly preferred embodiments will be at least 85 or more nucleotides.
  • fragments of different genetic sequences can be compared to one another over appropriate length stretches, particularly defined segments such as the domains described below.
  • a nucleic acid which codes for a DCRS3 or DCRS4 will be particularly useful to identify genes, mRNA, and cDNA species which code for itself or closely related proteins, as well as DNAs which code for polymorphic, allelic, or other genetic variants, e.g., from different individuals or related species.
  • Preferred probes for such screens are those regions of the interleukin which are conserved between different polymorphic variants or which contain nucleotides which lack specificity, and will preferably be full length or nearly so. In other situations, polymorphic variant specific sequences will be more useful .
  • This invention further covers recombinant nucleic acid molecules and fragments having a nucleic acid sequence identical to or highly homologous to the isolated DNA set forth herein.
  • the sequences will often be operably linked to DNA segments which control transcription, translation, and DNA replication. These additional segments typically assist in expression of the desired nucleic acid segment .
  • Homologous, or highly identical, nucleic acid sequences when compared to one another, e.g., DCRS3 sequences, exhibit significant similarity.
  • the standards for homology in nucleic acids are either measures for homology generally used in the art by sequence comparison or based upon hybridization conditions. Comparative hybridization conditions are described in greater detail below.
  • Substantial identity in the nucleic acid sequence comparison context means either that the segments, or their complementary strands, when compared, are identical when optimally aligned, with appropriate nucleotide insertions or deletions, in at least about 60% of the nucleotides, generally at least 66%, ordinarily at least 71%, often at least 76%, more often at least 80%, usually at least 84%, more usually at least 88%, typically at least 91%, more typically at least about 93%, preferably at least about 95%, more preferably at least about 96 to 98% or more, and in particular embodiments, as high at about 99% or more of the nucleotides, including, e.g., segments encoding structural domains such as the segments described below.
  • segment will hybridize under selective hybridization conditions, to a strand or its complement, typically using a sequence derived from Tables 1 or 3.
  • selective hybridization will occur when there is at least about 55% homology over a stretch of at least about 14 nucleotides, more typically at least about 65%, preferably at least about 75%, and more preferably at least about 90%. See, Kanehisa (1984) Nucl . Acids Res . 12:203-213, which is incorporated herein by reference.
  • the length of homology comparison may be over longer stretches, and in certain embodiments will be over a stretch of at least about 17 nucleotides, generally at least about 20 nucleotides, ordinarily at least about 24 nucleotides, usually at least about 28 nucleotides, typically at least about 32 nucleotides, more typically at least about 40 nucleotides, preferably at least about 50 nucleotides, and more preferably at least about 75 to 100 or more nucleotides. This includes, e.g., 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 544, and other lengths.
  • Stringent conditions in referring to homology in the hybridization context, will be stringent combined conditions of salt, temperature, organic solvents, and other parameters typically controlled in hybridization reactions.
  • Stringent temperature conditions will usually include temperatures in excess of about 30 C, more usually in excess of about 37 C, typically in excess of about 45 C, more typically in excess of about 55 C, preferably in excess of about 65 C, and more preferably in excess of about 70 C.
  • Stringent salt conditions will ordinarily be less than about 500 mM, usually less than about 400 mM, more usually less than about 300 mM, typically less than about 200 mM, preferably less than about 100 mM, and more preferably less than about 80 M, even down to less than about 20 mM.
  • the combination of parameters is much more important than the measure of any single parameter. See, e.g., Wetmur and Davidson (1968) J. Mol . Biol. 31:349-370, which is hereby incorporated herein by reference.
  • the isolated DNA can be readily modified by nucleotide substitutions, nucleotide deletions, nucleotide insertions, and inversions of nucleotide stretches. These modifications result in novel DNA sequences which encode this protein or its derivatives. These modified sequences can be used to produce mutant proteins (muteins) or to enhance the expression of variant species. Enhanced expression may involve gene amplification, increased transcription, increased translation, and other mechanisms. Such mutant DCRS-like derivatives include predetermined or site-specific mutations of the protein or its fragments, including silent mutations using genetic code degeneracy.
  • “Mutant DCRS3” as used herein encompasses a polypeptide otherwise falling within the homology definition of the DCRS3 as set forth above, but having an amino acid sequence which differs from that of other cytokine receptor-like proteins as found in nature, whether by way of deletion, substitution, or insertion.
  • site specific mutant DCRS3 encompasses a protein having substantial sequence identity with a protein of Table 1, and typically shares most of the biological activities or effects of the forms disclosed herein. Likewise in reference to DCRS4.
  • Mammalian DCRS3 mutagenesis can be achieved by making amino acid insertions or deletions in the gene, coupled with expression. Substitutions, deletions, insertions, or many combinations may be generated to arrive at a final construct. Insertions include amino- or carboxy- terminal fusions. Random mutagenesis can be conducted at a target codon and the expressed mammalian DCRS3 mutants can then be screened for the desired activity, providing some aspect of a structure- activity relationship. Methods for making substitution mutations at predetermined sites in DNA having a known sequence are well known in the art, e.g., by M13 primer mutagenesis. See also Sambrook, et al . (1989) and Ausubel, et al . (1987 and periodic Supplements) .
  • the mutations in the DNA normally should not place coding sequences out of reading frames and preferably will not create complementary regions that could hybridize to produce secondary mRNA structure such as loops or hairpins .
  • the phosphoramidite method described by Beaucage and Carruthers (1981) Tetra. Letts. 22:1859-1862, will produce suitable synthetic DNA fragments. A double stranded fragment will often be obtained either by synthesizing the complementary strand and annealing the strand together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
  • Polymerase chain reaction (PCR) techniques can often be applied in mutagenesis.
  • mutagenesis primers are commonly used methods for generating defined mutations at predetermined sites.
  • Certain embodiments of the invention are directed to combination compositions comprising the receptor or ligand sequences described.
  • functional portions of the sequences may be joined to encode fusion proteins.
  • variants of the described sequences may be substituted.
  • the present invention encompasses primate DCRS3, e.g., whose sequences are disclosed in Table 1, and described above. Allelic and other variants are also contemplated, including, e.g., fusion proteins combining portions of such sequences with others, including, e.g., epitope tags and functional domains.
  • the present invention also provides recombinant proteins, e.g., heterologous fusion proteins using segments from these primate or rodent proteins.
  • a heterologous fusion protein is a fusion of proteins or segments which are naturally not normally fused in the same manner.
  • the fusion product of a DCRS3 with another cytokine receptor is a continuous protein molecule having sequences fused in a typical peptide linkage, typically made as a single translation product and exhibiting properties, e.g., sequence or antigenicity, derived from each source peptide.
  • properties e.g., sequence or antigenicity
  • new constructs may be made from combining similar functional or structural domains from other related proteins, e.g., cytokine receptors or Toll-like receptors, including species variants.
  • ligand-binding or other segments may be "swapped" between different new fusion polypeptides or fragments. See, e.g., Cunningham, et al . (1989) Science 243:1330-1336; and O'Dowd, et al . (1988) J. Biol. Chem. 263:15985-15992, each of which is incorporated herein by reference.
  • new chimeric polypeptides exhibiting new combinations of specificities will result from the functional linkage of receptor-binding specificities.
  • a fusion protein may include a targeting domain which may serve to provide sequestering of the fusion protein to a particular subcellular organelle.
  • Candidate fusion partners and sequences can be selected from various sequence data bases, e.g., GenBank, c/o
  • the present invention particularly provides muteins which bind cytokine-like ligands, and/or which are affected in signal transduction.
  • Structural alignment of human DCRS3 or DCRS4 with other members of the cytokine receptor family show conserved features/residues. See Table 5. Alignment of human DCRS3 or DCRS4 sequence with other members of the cytokine receptor family indicates various structural and functionally shared features. See also, Bazan, et al . (1996) Nature 379:591; Lodi , et al . (1994) Science 263:1762-1766; Sayle and Milner-White
  • substitutions with either mouse sequences or human sequences are particularly preferred. Conversely, conservative substitutions away from the ligand binding interaction regions will probably preserve most signaling activities; and conservative substitutions away from the intracellular domains will probably preserve most ligand binding properties.
  • “Derivatives” of primate DCRS3 include amino acid sequence mutants, glycosylation variants, metabolic derivatives and covalent or aggregative conjugates with other chemical moieties.
  • Covalent derivatives can be prepared by linkage of functionalities to groups which are found in DCRS3 amino acid side chains or at the N- or C- termini, e.g., by means which are well known in the art. These derivatives can include, without limitation, aliphatic esters or amides of the carboxyl terminus, or of residues containing carboxyl side chains, O-acyl derivatives of hydroxyl group-containing residues, and N-acyl derivatives of the amino terminal amino acid or amino-group containing residues, e.g., lysine or arginine.
  • Acyl groups are selected from the group of alkyl -moieties, including C3 to C18 normal alkyl, thereby forming alkanoyl aroyl species.
  • glycosylation alterations are included, e.g., made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing, or in further processing steps. Particularly preferred means for accomplishing this are by exposing the polypeptide to glycosylating enzymes derived from cells which normally provide such processing, e.g., mammalian glycosylation enzymes. Deglycosylation enzymes are also contemplated. Also embraced are versions of the same primary amino acid sequence which have other minor modifications, including phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine , or phosphothreonine .
  • a major group of derivatives are covalent conjugates of the receptors or fragments thereof with other proteins of polypeptides. These derivatives can be synthesized in recombinant culture such as N- or C-terminal fusions or by the use of agents known in the art for their usefulness in cross-linking proteins through reactive side groups. Preferred derivatization sites with cross-linking agents are at free amino groups, carbohydrate moieties, and cysteine residues. Fusion polypeptides between the receptors and other homologous or heterologous proteins are also provided.
  • Homologous polypeptides may be fusions between different receptors, resulting in, for instance, a hybrid protein exhibiting binding specificity for multiple different cytokine ligands, or a receptor which may have broadened or weakened specificity of substrate effect.
  • heterologous fusions may be constructed which would exhibit a combination of properties or activities of the derivative proteins.
  • Typical examples are fusions of a reporter polypeptide, e.g., luciferase, with a segment or domain of a receptor, e.g., a ligand-binding segment, so that the presence or location of a desired ligand may be easily determined. See, e.g., Dull, et al . , U.S. Patent No.
  • GST glutathione-S-transferase
  • bacterial ⁇ -galactosidase bacterial ⁇ -galactosidase
  • trpE bacterial ⁇ -galactosidase
  • Protein A ⁇ -lactamase
  • alpha amylase alpha amylase
  • alcohol dehydrogenase and yeast alpha mating factor.
  • polypeptides may also have amino acid residues which have been chemically modified by phosphorylation, sulfonation, biotinylation, or the addition or removal of other moieties, particularly those which have molecular shapes similar to phosphate groups.
  • the modifications will be useful labeling reagents, or serve as purification targets, e.g., affinity ligands.
  • Fusion proteins will typically be made by either recombinant nucleic acid methods or by synthetic polypeptide methods. Techniques for nucleic acid manipulation and expression are described generally, for example, in Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual (2d ed.), Vols. 1-3, Cold Spring Harbor Laboratory, and Ausubel, et al . (eds. 1987 and periodic supplements) Current Protocols in Molecular Biology, Greene/Wiley, New York, which are each incorporated herein by reference. Techniques for synthesis of polypeptides are described, for example, in Merrifield (1963) J. Amer. Chem. Soc . 85:2149-2156; Merrifield (1986) Science 232: 341-347; and Atherton, et al . (1989) Solid Phase Peptide
  • Such covalent or aggregative derivatives are useful as immunogens, as reagents in immunoassays, or in purification methods such as for affinity purification of a receptor or other binding molecule, e.g., an antibody.
  • a cytokine ligand can be immobilized by covalent bonding to a solid support such as cyanogen bromide-activated Sepharose, by methods which are well known in the art, or adsorbed onto polyolefin surfaces, with or without glutaraldehyde cross-linking, for use in the assay or purification of a cytokine receptor, antibodies, or other similar molecules.
  • the ligand can also be labeled with a detectable group, for example radioiodinated by the chloramine T procedure, covalently bound to rare earth chelates, or conjugated to another fluorescent moiety for use in diagnostic assays.
  • a combination, e.g., including a DCRS3 or DCRS4 , of this invention can be used as an immunogen for the production of antisera or antibodies specific, e.g., capable of distinguishing between other cytokine receptor family members, for the combinations described.
  • the complexes can be used to screen monoclonal antibodies or antigen-binding fragments prepared by immunization with various forms of impure preparations containing the protein.
  • the term "antibodies” also encompasses antigen binding fragments of natural antibodies, e.g., Fab, Fab2 , Fv, etc.
  • a purified DCRS3 can also be used as a reagent to detect antibodies generated in response to the presence of elevated levels of expression, or immunological disorders which lead to antibody production to the endogenous receptor.
  • DCRS3 fragments may also serve as immunogens to produce the antibodies of the present invention, as described immediately below.
  • this invention contemplates antibodies having binding affinity to or being raised against the amino acid sequences shown in Table 1, fragments thereof, or various homologous peptides.
  • this invention contemplates antibodies having binding affinity to, or having been raised against, specific fragments which are predicted to be, or actually are, exposed at the exterior protein surface of a native DCRS3. Complexes of combinations of proteins will also be useful, and antibody preparations thereto can be made.
  • the blocking of physiological response to the receptor ligands may result from the inhibition of binding of the ligand to the receptor, likely through competitive inhibition.
  • in vitro assays of the present invention will often use antibodies or antigen binding segments of these antibodies, or fragments attached to solid phase substrates. These assays will also allow for the diagnostic determination of the effects of either ligand binding region mutations and modifications, or other mutations and modifications, e.g., which affect signaling or enzymatic function.
  • This invention also contemplates the use of competitive drug screening assays, e.g., where neutralizing antibodies to the receptor complexes or fragments compete with a test compound for binding to a ligand or other antibody.
  • the neutralizing antibodies or fragments can be used to detect the presence of a polypeptide which shares one or more binding sites to a receptor and can also be used to occupy binding sites on a receptor that might otherwise bind a ligand.
  • DNA which encodes the protein or fragments thereof can be obtained by chemical synthesis, screening cDNA libraries, or by screening genomic libraries prepared from a wide variety of cell lines or tissue samples. Natural sequences can be isolated using standard methods and the sequences provided herein, e.g., in Tables 1 or 3. Other species counterparts can be identified by hybridization techniques, or by various PCR techniques, combined with or by searching in sequence databases, e.g., GenBank.
  • This DNA can be expressed in a wide variety of host cells for the synthesis of a full-length receptor or fragments which can in turn, for example, be used to generate polyclonal or monoclonal antibodies; for binding studies; for construction and expression of modified ligand binding or kinase/phosphatase domains; and for structure/function studies.
  • Variants or fragments can be expressed in host cells that are transformed or transfected with appropriate expression vectors. These molecules can be substantially free of protein or cellular contaminants, other than those derived from the recombinant host, and therefore are particularly useful in pharmaceutical compositions when combined with a pharmaceutically acceptable carrier and/or diluent.
  • the protein, or portions thereof may be expressed as fusions with other proteins. Combinations of the described proteins, or nucleic acids encoding them, are particularly interesting.
  • Expression vectors are typically self-replicating DNA or RNA constructs containing the desired receptor gene or its fragments, usually operably linked to suitable genetic control elements that are recognized in a suitable host cell. These control elements are capable of effecting expression within a suitable host.
  • the multiple genes may be coordinately expressed, and may be on a polycistronic message. The specific type of control elements necessary to effect expression will depend upon the eventual host cell used.
  • the genetic control elements can include a prokaryotic promoter system or a eukaryotic promoter expression control system, and typically include a transcriptional promoter, an optional operator to control the onset of transcription, transcription enhancers to elevate the level of mRNA expression, a sequence that encodes a suitable ribosome binding site, and sequences that terminate transcription and translation.
  • Expression vectors also usually contain an origin of replication that allows the vector to replicate independently of the host cell .
  • the vectors of this invention include those which contain DNA which encodes a combination of proteins, as described, or a biologically active equivalent polypeptide.
  • the DNA can be under the control of a viral promoter and can encode a selection marker.
  • This invention further contemplates use of such expression vectors which are capable of expressing eukaryotic cDNAs coding for such proteins in a prokaryotic or eukaryotic host, where the vector is compatible with the host and where the eukaryotic cDNAs are inserted into the vector such that growth of the host containing the vector expresses the cDNAs in question.
  • expression vectors are designed for stable replication in their host cells or for amplification to greatly increase the total number of copies of the desirable gene per cell.
  • Vectors comprise plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles which enable the integration of DNA fragments into the genome of the host.
  • Expression vectors are specialized vectors which contain genetic control elements that effect expression of operably linked genes. Plasmids are the most commonly used form of vector but all other forms of vectors which serve an equivalent function and which are, or become, known in the art are suitable for use herein. See, e.g., Pouwels, et al . (1985 and Supplements) Cloning Vectors : A Laboratory Manual , Elsevier, N.Y., and Rodriguez, et al . (eds. 1988) Vectors: A Survey of Molecular Cloning Vectors and Their Uses. Buttersworth, Boston, which are incorporated herein by reference.
  • Transformed cells are cells, preferably mammalian, that have been transformed or transfected with vectors constructed using recombinant DNA techniques.
  • Transformed host cells usually express the desired proteins, but for purposes of cloning, amplifying, and manipulating its DNA, do not need to express the subject proteins.
  • This invention further contemplates culturing transformed cells in a nutrient medium, thus permitting the proteins to accumulate.
  • the proteins can be recovered, either from the culture or, in certain instances, from the culture medium.
  • nucleic sequences are operably linked when they are functionally related to each other.
  • DNA for a presequence or secretory leader is operably linked to a polypeptide if it is expressed as a preprotein or participates in directing the polypeptide to the cell membrane or in secretion of the polypeptide.
  • a promoter is operably linked to a coding sequence if it controls the transcription of the polypeptide;
  • a ribosome binding site is operably linked to a coding sequence if it is positioned to permit translation.
  • operably linked means contiguous and in reading frame, however, certain genetic elements such as repressor genes are not contiguously linked but still bind to operator sequences that in turn control expression.
  • Suitable host cells include prokaryotes, lower eukaryotes, and higher eukaryotes.
  • Prokaryotes include both gram negative and gram positive organisms, e.g., E. coli and B. subtilis.
  • Lower eukaryotes include yeasts, e.g., S. cerevisiae and Pichia , and species of the genus Dictyostelium.
  • Higher eukaryotes include established tissue culture cell lines from animal cells, both of non-mammalian origin, e.g., insect cells, and birds, and of mammalian origin, e.g., human, primates, and rodents.
  • Prokaryotic host -vector systems include a wide variety of vectors for many different species. As used herein, E. coli and its vectors will be used generically to include equivalent vectors used in other prokaryotes.
  • a representative vector for amplifying DNA is pBR322 or many of its derivatives. Vectors that can be used to express the receptor or its fragments include, but are not limited to, such vectors as those containing the lac promoter (pUC-series) ; trp promoter
  • pBR322-trp Ipp promoter (the pIN-series) ; lambda-pP or pR promoters (pOTS) ; or hybrid promoters such as ptac (pDR540) .
  • Ipp promoter the pIN-series
  • pOTS lambda-pP or pR promoters
  • hybrid promoters such as ptac (pDR540) .
  • Lower eukaryotes e.g., yeasts and Dictyostelium, may be transformed with DCRS3 or DCRS4 sequence containing vectors.
  • the most common lower eukaryotic host is the baker's yeast, Saccharomyces cerevisiae. It will be used to generically represent lower eukaryotes although a number of other strains and species are also available.
  • Yeast vectors typically consist of a replication origin (unless of the integrating type), a selection gene, a promoter, DNA encoding the receptor or its fragments, and sequences for translation termination, polyadenylation, and transcription termination.
  • Suitable expression vectors for yeast include such constitutive promoters as 3-phosphoglycerate kinase and various other glycolytic enzyme gene promoters or such inducible promoters as the alcohol dehydrogenase 2 promoter or metallothionine promoter.
  • Suitable vectors include derivatives of the following types: self-replicating low copy number (such as the YRp-series) , self-replicating high copy number (such as the YEp-series) ; integrating types (such as the YIp-series) , or mini-chromosomes (such as the YCp-series) .
  • Higher eukaryotic tissue culture cells are normally the preferred host cells for expression of the functionally active interleukin or receptor proteins.
  • tissue culture cell lines are workable, e.g., insect baculovirus expression systems, whether from an invertebrate or vertebrate source.
  • mammalian cells are preferred. Transformation or transfection and propagation of such cells has become a routine procedure.
  • useful cell lines include HeLa cells, Chinese hamster ovary (CHO) cell lines, baby rat kidney (BRK) cell lines, insect cell lines, bird cell lines, and monkey (COS) cell lines.
  • Expression vectors for such cell lines usually include an origin of replication, a promoter, a translation initiation site, RNA splice sites (if genomic DNA is used), a polyadenylation site, and a transcription termination site.
  • Suitable expression vectors may be plasmids, viruses, or retroviruses carrying promoters derived, e.g., from such sources as from adenovirus, SV40, parvoviruses, vaccinia virus, or cytomegalovirus .
  • suitable expression vectors include pCDNAl ; pCD, see Okayama, et al. (1985) Mol. Cell Biol. 5:1136-1142; pMClneo PolyA, see Thomas, et al . (1987) Cell 51:503-512; and a baculovirus vector such as pAC 373 or pAC 610.
  • an open reading frame usually encodes a polypeptide that consists of a mature or secreted product covalently linked at its N-terminus to a signal peptide.
  • the signal peptide is cleaved prior to secretion of the mature, or active, polypeptide.
  • the cleavage site can be predicted with a high degree of accuracy from empirical rules, e.g., von-Heijne (1986) Nucleic Acids Research 14:4683-4690 and Nielsen, et al . (1997) Protein Eng . 10:1-12, and the precise amino acid composition of the signal peptide often does not appear to be critical to its function, e.g., Randall, et al .
  • the mature proteins of the invention can be readily determined using standard methods. It will often be desired to express these polypeptides in a system which provides a specific or defined glycosylation pattern. In this case, the usual pattern will be that provided naturally by the expression system. However, the pattern will be modifiable by exposing the polypeptide, e.g., an unglycosylated form, to appropriate glycosylating proteins introduced into a heterologous expression system. For example, the receptor gene may be co-transformed with one or more genes encoding mammalian or other glycosylating enzymes. Using this approach, certain mammalian glycosylation patterns will be achievable in prokaryote or other cells. Expression in prokaryote cells will typically lead to unglycosylated forms of protein.
  • the source of DCRS3 or DCRS4 can be a eukaryotic or prokaryotic host expressing recombinant DCRS, such as is described above.
  • the source can also be a cell line, but other mammalian cell lines are also contemplated by this invention, with the preferred cell line being from the human species.
  • a primate DCRS3 or DCRS4 , fragments, or derivatives thereof can be prepared by conventional processes for synthesizing peptides. These include processes such as are described in Stewart and Young (1984) Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL; Bodanszky and Bodanszky (1984) The Practice of Peptide Synthesis , Springer-Verlag, New York; and Bodanszky (1984) The Principles of Peptide Synthesis, Springer-Verlag, New York; all of each which are incorporated herein by reference.
  • an azide process for example, an acid chloride process, an acid anhydride process, a mixed anhydride process, an active ester process (for example, p-nitrophenyl ester, N-hydroxysuccinimide ester, or cyanomethyl ester), a carbodiimidazole process, an oxidative-reductive process, or a dicyclohexylcarbodiimide (DCCD) /additive process
  • Solid phase and solution phase syntheses are both applicable to the foregoing processes. Similar techniques can be used with partial DCRS3 or DCRS4 sequences .
  • DCRS3 or DCRS4 proteins, fragments, or derivatives are suitably prepared in accordance with the above processes as typically employed in peptide synthesis, generally either by a so-called stepwise process which comprises condensing an amino acid to the terminal amino acid, one by one in sequence, or by coupling peptide fragments to the terminal amino acid.
  • Amino groups that are not being used in the coupling reaction typically must be protected to prevent coupling at an incorrect location.
  • the C-terminal amino acid is bound to an insoluble carrier or support through its carboxyl group.
  • the insoluble carrier is not particularly limited as long as it has a binding capability to a reactive carboxyl group. Examples of such insoluble carriers include halomethyl resins, such as chloromethyl resin or bromomethyl resin, hydroxymethyl resins, phenol resins, tert-alkyloxycarbonylhydrazidated resins, and the like.
  • An amino group-protected amino acid is bound in sequence through condensation of its activated carboxyl group and the reactive amino group of the previously formed peptide or chain, to synthesize the peptide step by step. After synthesizing the complete sequence, the peptide is split off from the insoluble carrier to produce the peptide.
  • This solid-phase approach is generally described by Merrifield, et al . (1963) in J . Am. Chem. Soc . 85:2149-2156, which is incorporated herein by reference.
  • the prepared protein and fragments thereof can be isolated and purified from the reaction mixture by means of peptide separation, for example, by extraction, precipitation, electrophoresis, various forms of chromatography, and the like.
  • the receptors of this invention can be obtained in varying degrees of purity depending upon desired uses. Purification can be accomplished by use of the protein purification techniques disclosed herein, see below, or by the use of the antibodies herein described in methods of immunoabsorbant affinity chromatography.
  • This immunoabsorbant affinity chromatography is carried out by first linking the antibodies to a solid support and then contacting the linked antibodies with solubilized lysates of appropriate cells, lysates of other cells expressing the receptor, or lysates or supematants of cells producing the protein as a result of DNA techniques, see below.
  • the purified protein will be at least about 40% pure, ordinarily at least about 50% pure, usually at least about 60% pure, typically at least about 70% pure, more typically at least about 80% pure, preferable at least about 90% pure and more preferably at least about 95% pure, and in particular embodiments, 97%-99% or more.
  • Purity will usually be on a weight basis, but can also be on a molar basis. Different assays will be applied as appropriate. Individual proteins may be purified and thereafter combined.
  • Antibodies can be raised to various mammalian, e.g., primate DCRS3 or DCRS4 proteins and fragments thereof, both in naturally occurring native forms and in their recombinant forms, the difference being that antibodies to the active receptor are more likely to recognize epitopes which are only present in the native conformations. Denatured antigen detection can also be useful in, e.g., Western analysis. Anti-idiotypic antibodies are also contemplated, which would be useful as agonists or antagonists of a natural receptor or an antibody.
  • Antibodies including binding fragments and single chain versions, against predetermined fragments of the protein can be raised by immunization of animals with conjugates of the fragments with immunogenic proteins.
  • Monoclonal antibodies are prepared from cells secreting the desired antibody. These antibodies can be screened for binding to normal or defective protein, or screened for agonistic or antagonistic activity.
  • These monoclonal antibodies will usually bind with at least a K- Q of about 1 mM, more usually at least about 300 ⁇ M, typically at least about lOO ⁇ M, more typically at least about 30 ⁇ M, preferably at least about 10 ⁇ M, and more preferably at least about 3 ⁇ M or better.
  • the antibodies, including antigen binding fragments, of this invention can have significant diagnostic or therapeutic value. They can be potent antagonists that bind to the receptor and inhibit binding to ligand or inhibit the ability of the receptor to elicit a biological response, e.g., act on its substrate. They also can be useful as non-neutralizing antibodies and can be coupled to toxins or radionuclides to bind producing cells, or cells localized to the source of the interleukin. Further, these antibodies can be conjugated to drugs or other therapeutic agents, either directly or indirectly by means of a linker. The antibodies of this invention can also be useful in diagnostic applications. As capture or non-neutralizing antibodies, they might bind to the receptor without inhibiting ligand or substrate binding.
  • nucleic acids and proteins may be immobilized to solid substrates for affinity purification or detection methods.
  • the substrates may be, e.g., solid resin beads or sheets of plastic. Protein fragments may be joined to other materials, particularly polypeptides, as fused or covalently joined polypeptides to be used as immunogens.
  • Mammalian cytokine receptors and fragments may be fused or covalently linked to a variety of immunogens, such as keyhole limpet hemocyanin, bovine serum albumin, tetanus toxoid, etc. See Microbiology, Hoeber Medical Division, Harper and Row, 1969; Landsteiner (1962) Specificity of Serological Reactions, Dover Publications, New York; and Williams, et al . (1967) Methods in Immunology and Immunochemistry. Vol. 1, Academic Press, New York; each of which are incorporated herein by reference, for descriptions of methods of preparing polyclonal antisera.
  • a typical method involves hyperimmunization of an animal with an antigen. The blood of the animal is then collected shortly after the repeated immunizations and the gamma globulin is isolated.
  • monoclonal antibodies from various mammalian hosts, such as mice, rodents, primates, humans, etc.
  • Description of techniques for preparing such monoclonal antibodies may be found in, e.g., Stites, et al . (eds.) Basic and Clinical Immunology (4th ed.), Lange Medical Publications, Los Altos, CA, and references cited therein; Harlow and Lane (1988) Antibodies: A Laboratory Manual, CSH Press; Goding (1986) Monoclonal Antibodies: Principles and Practice (2d ed.) Academic Press, New York; and particularly in Kohler and Milstein (1975) in Nature 256: 495-497, which discusses one method of generating monoclonal antibodies. Each of these references is incorporated herein by reference.
  • this method involves injecting an animal with an immunogen.
  • the animal is then sacrificed and cells taken from its spleen, which are then fused with myeloma cells.
  • the result is a hybrid cell or "hybridoma" that is capable of reproducing in vitro .
  • the population of hybridomas is then screened to isolate individual clones, each of which secrete a single antibody species to the immunogen.
  • the individual antibody species obtained are the products of immortalized and cloned single B cells from the immune animal generated in response to a specific site recognized on the immunogenic substance.
  • polypeptides and antibodies of the present invention may be used with or without modification, including chimeric or humanized antibodies. Frequently, the polypeptides and antibodies will be labeled by joining, either covalently or non-covalently, a substance which provides for a detectable signal. A wide variety of labels and conjugation techniques are known and are reported extensively in both the scientific and patent literature.
  • Suitable labels include radionuclides, enzymes, substrates, cofactors, inhibitors, fluorescent moieties, chemiluminescent moieties, magnetic particles, and the like. Patents, teaching the use of such labels include U.S. Patent Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241. Also, recombinant or chimeric immunoglobulins may be produced, see Cabilly, U.S.
  • Patent No. 4,816,567 or made in transgenic mice, see Mendez, et al . (1997) Nature Genetics 15:146-156. These references are incorporated herein by reference.
  • the antibodies of this invention can also be used for affinity chromatography in isolating DCRS3 proteins or peptides.
  • Columns can be prepared where the antibodies are linked to a solid support, e.g., particles, such as agarose, Sephadex, or the like, where a cell lysate may be passed through the column, the column washed, followed by increasing concentrations of a mild denaturant, whereby the purified protein will be released.
  • the protein may be used to purify antibody. Appropriate cross absorptions or depletions may be applied.
  • the antibodies may also be used to screen expression libraries for particular expression products. Usually the antibodies used in such a procedure will be labeled with a moiety allowing easy detection of presence of antigen by antibody binding.
  • Antibodies raised against a cytokine receptor will also be used to raise anti-idiotypic antibodies. These will be useful in detecting or diagnosing various immunological conditions related to expression of the protein or cells which express the protein. They also will be useful as agonists or antagonists of the ligand, which may be competitive inhibitors or substitutes for naturally occurring ligands.
  • the immunoassay typically uses a polyclonal antiserum which was raised, e.g., to a protein of SEQ ID NO: 2, 25, 5, 28, or 31.
  • This antiserum is selected to have low crossreactivity against other cytokine receptor family members, e.g., IL-11 receptor subunit alpha, IL- 6 receptor subunit alpha, or p40, preferably from the same species, and any such crossreactivity is removed by immunoabsorption prior to use in the immunoassay.
  • the protein e.g., of SEQ ID NO: 2, 25, 5, 28, or 31, is isolated as described herein.
  • recombinant protein may be produced in a mammalian cell line.
  • An appropriate host e.g., an inbred strain of mice such as Balb/c
  • is immunized with the selected protein typically using a standard adjuvant, such as Freund's adjuvant, and a standard mouse immunization protocol (see Harlow and Lane, supra) .
  • a synthetic peptide derived from the sequences disclosed herein and conjugated to a carrier protein can be used an immunogen.
  • Polyclonal sera are collected and titered against the immunogen protein in an immunoassay, e.g., a solid phase immunoassay with the immunogen immobilized on a solid support.
  • Polyclonal antisera with a titer of 10 4 or greater are selected and tested for their cross reactivity against other cytokine receptor family members, e.g., IL-2, IL-7, IL-9, or EPO receptor subunit, using a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573.
  • cytokine receptor family members e.g., IL-2, IL-7, IL-9, or EPO receptor subunit
  • a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573.
  • cytokine receptor family members Preferably at least two cytokine receptor family members are used in this determination.
  • These cytokine receptor family members can be produced as recombinant proteins and isolated using standard molecular biology and protein chemistry techniques as described herein.
  • Immunoassays in the competitive binding format can be used for the crossreactivity determinations.
  • the protein of SEQ ID NO: 2, 25, 5, 28, or 31 can be immobilized to a solid support. Proteins added to the assay compete with the binding of the antisera to the immobilized antigen. The ability of the above proteins to compete with the binding of the antisera to the immobilized protein is compared to the proteins, e.g., of IL-2, IL-7, IL-9, or EPO receptor subunit. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the proteins listed above are selected and pooled.
  • the cross-reacting antibodies are then removed from the pooled antisera by immunoabsorption with the above-listed proteins.
  • the immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein to the immunogen protein (e.g., DCRS3 like protein of SEQ ID NO: 2) .
  • the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required is less than twice the amount of the protein of the selected protein or proteins that is required, then the second protein is said to specifically bind to an antibody generated to the immunogen .
  • these cytokine receptor proteins are members of a family of homologous proteins that comprise at least 6 so far identified genes.
  • a gene product such as a DCRS3 or DCRS4
  • the term refers not only to the amino acid sequences disclosed herein, but also to other proteins that are allelic, non-allelic, or species variants.
  • the terms include nonnatural mutations introduced by deliberate mutation using conventional recombinant technology such as single site mutation, or by excising short sections of DNA encoding the respective proteins, or by substituting new amino acids, or adding new amino acids. Such minor alterations typically will substantially maintain the immunoidentity of the original molecule and/or its biological activity.
  • these alterations include proteins that are specifically immunoreactive with a designated naturally occurring DCRS3 or DCRS4 protein.
  • the biological properties of the altered proteins can be determined by expressing the protein in an appropriate cell line and measuring the appropriate effect, e.g., upon transfected lymphocytes. Particular protein modifications considered minor would include conservative substitution of amino acids with similar chemical properties, as described above for the cytokine receptor family as a whole.
  • kits and assay methods Both naturally occurring and recombinant forms of the cytokine receptor like molecules of this invention are particularly useful in kits and assay methods. For example, these methods would also be applied to screening for binding activity, e.g., ligands for these proteins.
  • Several methods of automating assays have been developed in recent years so as to permit screening of tens of thousands of compounds per year. See, e.g., a BIOMEK automated workstation, Beckman Instruments, Palo Alto, California, and Fodor, et al . (1991) Science 251:767- 773, which is incorporated herein by reference. The latter describes means for testing binding by a plurality of defined polymers synthesized on a solid substrate.
  • DCRS3 or DCRS4 can be coated directly onto plates for use in the aforementioned ligand screening techniques.
  • non-neutralizing antibodies to these proteins can be used as capture antibodies to immobilize the respective receptor on the solid phase, useful, e.g., in diagnostic uses.
  • This invention also contemplates use of DCRS3 or DCRS4 , fragments thereof, peptides, and their fusion products in a variety of diagnostic kits and methods for detecting the presence of the protein or its ligand.
  • kits and methods may be incorporated into the kits and methods.
  • the kit will have a compartment containing either a DCRS3 or DCRS4 peptide or gene segment or a reagent which recognizes one or the other.
  • recognition reagents in the case of peptide, would be a receptor or antibody, or in the case of a gene segment, would usually be a hybridization probe.
  • a preferred kit for determining the concentration of, e.g., DCRS3 in a sample would typically comprise a labeled compound, e.g., ligand or antibody, having known binding affinity for DCRS3, a source of DCRS3 (naturally occurring or recombinant) as a positive control, and a means for separating the bound from free labeled compound, for example a solid phase for immobilizing DCRS3 in the test sample.
  • a labeled compound e.g., ligand or antibody
  • a source of DCRS3 naturally occurring or recombinant
  • a means for separating the bound from free labeled compound for example a solid phase for immobilizing DCRS3 in the test sample.
  • Compartments containing reagents, and instructions will normally be provided.
  • Appropriate nucleic acid or protein containing kits are also provided.
  • Antibodies including antigen binding fragments, specific for mammalian DCRS3 or a peptide fragment, or receptor fragments are useful in diagnostic applications to detect the presence of elevated levels of ligand and/or its fragments. Diagnostic assays may be homogeneous (without a separation step between free reagent and antibody-antigen complex) or heterogeneous (with a separation step).
  • Various commercial assays exist, such as radioimmunoassay (RIA) , enzyme-linked immunosorbent assay (ELISA) , enzyme immunoassay (EIA) , enzyme-multiplied immunoassay technique (EMIT) , substrate-labeled fluorescent immunoassay (SLFIA) and the like.
  • unlabeled antibodies can be employed by using a second antibody which is labeled and which recognizes the antibody to a cytokine receptor or to a particular fragment thereof.
  • a second antibody which is labeled and which recognizes the antibody to a cytokine receptor or to a particular fragment thereof.
  • Anti-idiotypic antibodies may have similar use to serve as agonists or antagonists of cytokine receptors. These should be useful as therapeutic reagents under appropriate circumstances.
  • the reagents for diagnostic assays are supplied in kits, so as to optimize the sensitivity of the assay.
  • the protocol, and the label either labeled or unlabeled antibody, or labeled ligand is provided. This is usually in conjunction with other additives, such as buffers, stabilizers, materials necessary for signal production such as substrates for enzymes, and the like.
  • the kit will also contain instructions for proper use and disposal of the contents after use.
  • the kit has compartments for each useful reagent, and will contain instructions for proper use and disposal of reagents.
  • the reagents are provided as a dry lyophilized powder, where the reagents may be reconstituted in an aqueous medium having appropriate concentrations for performing the assay.
  • labeling may be achieved by covalently or non-covalently joining a moiety which directly or indirectly provides a detectable signal.
  • a test compound, cytokine receptor, or antibodies thereto can be labeled either directly or indirectly.
  • Possibilities for direct labeling include label groups: radiolabels such as 1 25j / enzymes (U.S. Pat. No. 3,645,090) such as peroxidase and alkaline phosphatase, and fluorescent labels (U.S. Pat. No. 3,940,475) capable of monitoring the change in fluorescence intensity, wavelength shift, or fluorescence polarization. Both of the patents are incorporated herein by reference.
  • Possibilities for indirect labeling include biotinylation of one constituent followed by binding to avidin coupled to one of the above label groups .
  • the cytokine receptor can be immobilized on various matrixes followed by washing. Suitable matrices include plastic such as an ELISA plate, filters, and beads. Methods of immobilizing the receptor to a matrix include, without limitation, direct adhesion to plastic, use of a capture antibody, chemical coupling, and biotin-avidin. The last step in this approach involves the precipitation of antibody/antigen complex by any of several methods including those utilizing, e.g., an organic solvent such as polyethylene glycol or a salt such as ammonium sulfate.
  • Another diagnostic aspect of this invention involves use of oligonucleotide or polynucleotide sequences taken from the sequence of an cytokine receptor. These sequences can be used as probes for detecting levels of the respective cytokine receptor in patients suspected of having an immunological disorder.
  • the preparation of both RNA and DNA nucleotide sequences, the labeling of the sequences, and the preferred size of the sequences has received ample description and discussion in the literature.
  • an oligonucleotide probe should have at least about 14 nucleotides, usually at least about 18 nucleotides, and the polynucleotide probes may be up to several kilobases.
  • Various labels may be employed, most commonly radionuclides, particularly 32p_ However, other techniques may also be employed, such as using biotin modified nucleotides for introduction into a polynucleotide. The biotin then serves as the site for binding to avidin or antibodies, which may be labeled with a wide variety of labels, such as radionuclides, fluorescers, enzymes, or the like. Alternatively, antibodies may be employed which can recognize specific duplexes, including DNA duplexes, RNA duplexes, DNA-RNA hybrid duplexes, or DNA-protein duplexes.
  • the antibodies in turn may be labeled and the assay carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected.
  • probes to the novel anti- sense RNA may be carried out in conventional techniques such as nucleic acid hybridization, plus and minus screening, recombinational probing, hybrid released translation (HRT) , and hybrid arrested translation (HART) . This also includes amplification techniques such as polymerase chain reaction (PCR) .
  • kits which also test for the qualitative or quantitative presence of other markers are also contemplated. Diagnosis or prognosis may depend on the combination of multiple indications used as markers. Thus, kits may test for combinations of markers. See, e.g., Viallet, et al . (1989) Progress in Growth Factor Res. 1:89-97.
  • This invention provides reagents with significant therapeutic value. See, e.g., Levitzki (1996) Curr. Opin. Cell Biol . 8:239-244.
  • the cytokine receptors naturally occurring or recombinant
  • fragments thereof, mutein receptors, and antibodies should be useful in the treatment of conditions exhibiting abnormal expression of the receptors of their ligands. Such abnormality will typically be manifested by immunological disorders.
  • this invention should provide therapeutic value in various diseases or disorders associated with abnormal expression or abnormal triggering of response to the ligand.
  • the IL-1 ligands have been suggested to be involved in morphologic development, e.g., dorso-ventral polarity determination, and immune responses, particularly the primitive innate responses. See, e.g., Sun, et al . (1991) Eur. J. Biochem. 196:247-254; and Hultmark (1994) Nature 367:116-117.
  • Recombinant cytokine receptors, muteins, agonist or antagonist antibodies thereto, or antibodies can be purified and then administered to a patient.
  • These reagents can be combined for therapeutic use with additional active ingredients, e.g., in conventional pharmaceutically acceptable carriers or diluents, along with physiologically innocuous stabilizers and excipients.
  • additional active ingredients e.g., in conventional pharmaceutically acceptable carriers or diluents, along with physiologically innocuous stabilizers and excipients.
  • These combinations can be sterile, e.g., filtered, and placed into dosage forms as by lyophilization in dosage vials or storage in stabilized aqueous preparations.
  • This invention also contemplates use of antibodies or binding fragments thereof which are not complement binding. Ligand screening using cytokine receptor or fragments thereof can be performed to identify molecules having binding affinity to the receptors.
  • a putative ligand can provide competitive binding, which can block intrinsic stimulating activity.
  • Receptor fragments can be used as a blocker or antagonist in that it blocks the activity of ligand.
  • a compound having intrinsic stimulating activity can activate the receptor and is thus an agonist in that it simulates the activity of ligand, e.g., inducing signaling.
  • This invention further contemplates the therapeutic use of antibodies to cytokine receptors as antagonists.
  • reagents necessary for effective therapy will depend upon many different factors, including means of administration, target site, reagent physiological life, pharmacological life, physiological state of the patient, and other medicants administered.
  • treatment dosages should be titrated to optimize safety and efficacy.
  • dosages used in vitro may provide useful guidance in the amounts useful for in situ administration of these reagents.
  • Animal testing of effective doses for treatment of particular disorders will provide further predictive indication of human dosage.
  • Various considerations are described, e.g., in Gilman, et al . (eds. 1990) Goodman and Gilman' s: The Pharmacological Bases of Therapeutics , 8th Ed., Pergamon Press; and Remington ' s Pharmaceutical Sciences.
  • compositions for administration are discussed therein and below, e.g., for oral, intravenous, intraperitoneal , or intramuscular administration, transdermal diffusion, and others.
  • Pharmaceutically acceptable carriers will include water, saline, buffers, and other compounds described, e.g., in the Merck Index, Merck & Co., Rahway, New Jersey. Because of the likely high affinity binding, or turnover numbers, between a putative ligand and its receptors, low dosages of these reagents would be initially expected to be effective. And the signaling pathway suggests extremely low amounts of ligand may have effect.
  • dosage ranges would ordinarily be expected to be in amounts lower than 1 mM concentrations, typically less than about 10 ⁇ M concentrations, usually less than about 100 nM, preferably less than about 10 pM (picomolar) , and most preferably less than about 1 fM (femtomolar) , with an appropriate carrier.
  • Slow release formulations, or slow release apparatus will often be utilized for continuous administration.
  • Cytokine receptors, fragments thereof, and antibodies or its fragments, antagonists, and agonists may be administered directly to the host to be treated or, depending on the size of the compounds, it may be desirable to conjugate them to carrier proteins such as ovalbumin or serum albumin prior to their administration.
  • Therapeutic formulations may be administered in many conventional dosage formulations. While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical formulation.
  • Formulations comprise at least one active ingredient, as defined above, together with one or more acceptable carriers thereof . Each carrier must be both pharmaceutically and physiologically acceptable in the sense of being compatible with the other ingredients and not injurious to the patient.
  • Formulations include those suitable for oral, rectal, nasal, or parenteral (including subcutaneous, intramuscular, intravenous and intradermal) administration.
  • the formulations may conveniently be presented in unit dosage form and may be prepared by methods well known in the art of pharmacy. See, e.g., Gilman, et al .
  • DCRS3 or DCRS4 or fragments thereof can be performed to identify compounds having binding affinity to the receptor subunit, including isolation of associated components. Subsequent biological assays can then be utilized to determine if the compound has intrinsic stimulating activity and is therefore a blocker or antagonist in that it blocks the activity of the ligand. Likewise, a compound having intrinsic stimulating activity can activate the receptor and is thus an agonist in that it simulates the activity of a cytokine ligand. This invention further contemplates the therapeutic use of antibodies to the receptor as cytokine agonists or antagonists.
  • complexes comprising multiple proteins may be used to screen for ligands or reagents capable of recognizing the complex.
  • Most cytokine receptors comprise at least two subunits, which may be the same, or distinct.
  • the transmembrane receptor may bind to a complex comprising a cytokine-like ligand associated with another soluble protein serving, e.g., as a second receptor subunit.
  • One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant DNA molecules expressing, e.g., a DCRS3 in combination with another cytokine receptor subunit. Cells may be isolated which express a receptor in isolation from other functional receptors.
  • Such cells can be used for standard antibody/antigen or ligand/receptor binding assays. See also, Parce, et al . (1989) Science 246:243-247; and Owicki, et al . (1990) Proc. Nat ' 1 Acad. Sci. USA 87:4007-4011, which describe sensitive methods to detect cellular responses.
  • Competitive assays are particularly useful, where the cells (source of putative ligand) are contacted and incubated with a labeled receptor or antibody having known binding affinity to the ligand, such as 125 _ antibody, and a test sample whose binding affinity to the binding composition is being measured.
  • the bound and free labeled binding compositions are then separated to assess the degree of ligand binding.
  • the amount of test compound bound is inversely proportional to the amount of labeled receptor binding to the known source.
  • Many techniques can be used to separate bound from free ligand to assess the degree of ligand binding. This separation step could typically involve a procedure such as adhesion to filters followed by washing, adhesion to plastic followed by washing, or centrifugation of the cell membranes.
  • Viable cells could also be used to screen for the effects of drugs on cytokine mediated functions, e.g., second messenger levels, i.e., Ca ++ ; cell proliferation; inositol phosphate pool changes; and others.
  • Some detection methods allow for elimination of a separation step, e.g., a proximity sensitive detection system. Calcium sensitive dyes will be useful for detecting Ca ++ levels, with a fluorimeter or a fluorescence cell sorting apparatus.
  • DCRS3 or DCRS4 provide means to identify ligands, as described above. Such ligand should bind specifically to the respective receptor with reasonably high affinity.
  • Various constructs are made available which allow either labeling of the receptor to detect its ligand. For example, directly labeling cytokine receptor, fusing onto it markers for secondary labeling, e.g., FLAG or other epitope tags, etc., will allow detection of receptor. This can be histological , as an affinity method for biochemical purification, or labeling or selection in an expression cloning approach.
  • a two-hybrid selection system may also be applied making appropriate constructs with the available cytokine receptor sequences. See, e.g., Fields and Song (1989) Nature 340:245-246.
  • Methods for protein purification include such methods as ammonium sulfate precipitation, column chromatography, electrophoresis, centrifugation, crystallization, and others. See, e.g., Ausubel, et al . (1987 and periodic supplements); Coligan, et al . (ed. 1996) and periodic supplements, Current Protocols In Protein Science Greene/Wiley, New York; Deutscher (1990) "Guide to Protein Purification” in Methods in Enzymology, vol. 182, and other volumes in this series; and manufacturer's literature on use of protein purification products, e.g., Pharmacia, Piscataway,
  • Human sequences related to cytokine receptors were identified from genomic sequence database using, e.g., the BLAST server (Altschul, et al . (1994) Nature Genet . 6:119-129).
  • Standard analysis programs may be used to evaluate structure, e.g., PHD (Rost and Sander (1994) Proteins 19:55-72) and DSC (King and Sternberg (1996) Protein Sci. 5:2298-2310).
  • Standard comparison software includes, e.g., Altschul, et al . (1990) J ⁇ Mol . Biol. 215:403-10; Waterman (1995) Introduction to
  • chromosome spreads are prepared. In situ hybridization is performed on chromosome preparations obtained from phytohemagglutinin- stimulated human lymphocytes cultured for 72 h. 5- bromodeoxyuridine was added for the final seven hours of culture (60 ⁇ g/ml of medium) , to ensure a posthybridization chromosomal banding of good quality. A PCR fragment, amplified with the help of primers, is cloned into an appropriate vector. The vector is labeled by nick-translation with 3 H. The radiolabeled probe is hybridized to metaphase spreads at final concentration of 200 ng/ml of hybridization solution as described in Mattei, et al . (1985) Hum. Genet. 69:327-331.
  • chromosome spreads are first stained with buffered Giemsa solution and metaphase photographed. R-banding is then performed by the fluorochrome- photolysis-Giemsa (FPG) method and metaphases rephotographed before analysis. Similar appropriate methods are used for other species.
  • FPG fluorochrome- photolysis-Giemsa
  • High stringency washes are conducted, e.g., at 65° C with two initial washes in 2 x SSC, 0.1% SDS for 40 min followed by a subsequent wash in 0.1 x SSC, 0.1% SDS for 20 min. Membranes are then exposed at -70° C to X-Ray film (Kodak) in the presence of intensifying screens. More detailed studies by cDNA library Southerns are performed with selected appropriate human DCRS3 clones to examine their expression in hemopoietic or other cell subsets .
  • RT-PCR is used on an appropriate mRNA sample selected for the presence of message to produce a cDNA, e.g., a sample which expresses the gene.
  • Full length clones may be isolated by hybridization of cDNA libraries from appropriate tissues pre-selected by PCR signal. Northern blots can be performed. Message for genes encoding DCRS3 or DCRS4 will be assayed by appropriate technology, e.g., PCR, immunoassay, hybridization, or otherwise. Tissue and organ cDNA preparations are available, e.g., from Clontech, Mountain View, CA. Identification of sources of natural expression are useful, as described. And the identification of functional receptor subunit pairings will allow for prediction of what cells express the combination of receptor subunits which will result in a physiological responsiveness to each of the cytokine ligands.
  • DNA 5 ⁇ g
  • DNA 5 ⁇ g
  • a primary amplified cDNA library was digested with appropriate restriction enzymes to release the inserts, run on a 1% agarose gel and transferred to a nylon membrane (Schleicher and Schuell, Keene, NH) .
  • Samples for mouse mRNA isolation may include: resting mouse fibroblastic L cell line (C200) ; Braf:ER (Braf fusion to estrogen receptor) transfected cells, control (C201) ; T cells, THl polarized (Mell4 bright, CD4+ cells from spleen, polarized for 7 days with IFN- ⁇ and anti IL-4; T200); T cells, TH2 polarized (Mell4 bright, CD4+ cells from spleen, polarized for 7 days with IL-4 and anti-IFN- ⁇ ; T201) ; T cells, highly THl polarized (see Openshaw, et al . (1995) J . Exp . Med .
  • T cells highly TH2 polarized (see Openshaw, et al . (1995) J . Exp . Med. 182:1357-1367; activated with anti-CD3 for 2, 6, 16 h pooled; T203) ; CD44- CD25+ pre T cells, sorted from thymus (T204) ; THl T cell clone Dl.l, resting for 3 weeks after last stimulation with antigen (T205); THl T cell clone Dl.l, 10 ⁇ g/ml ConA stimulated 15 h (T206) ; TH2 T cell clone CDC35, resting for 3 weeks after last stimulation with antigen (T207) ; TH2 T cell clone CDC35, 10 ⁇ g/ml ConA stimulated 15 h (T208) ; Mell44- naive T cells from sple
  • Samples for human mRNA isolation may include: peripheral blood mononuclear cells (monocytes, T cells, NK cells, granulocytes, B cells), resting (T100); peripheral blood mononuclear cells, activated with anti-CD3 for 2, 6, 12 h pooled (T101) ; T cell, TH0 clone Mot 72, resting (T102); T cell, TH0 clone Mot 72, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T103); T cell, TH0 clone Mot 72, anergic treated with specific peptide for 2, 7, 12 h pooled (T104); T cell, THl clone HY06, resting (T107) ; T cell, THl clone HY06, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T108); T cell, THl clone HY06, anergic treated with specific
  • DCRS3 or DCRS4 Various strategies are used to obtain species counterparts of DCRS3 or DCRS4, preferably from other primates or rodents.
  • One method is by cross hybridization using closely related species DNA probes. It may be useful to go into evolutionarily similar species as intermediate steps.
  • Another method is by using specific PCR primers based on the identification of blocks of similarity or difference between genes, e.g., areas of highly conserved or nonconserved polypeptide or nucleotide sequence.
  • Antibody based screening methods are also available, e.g., in expression cloning.
  • An appropriate, e.g., GST, fusion construct is engineered for expression, e.g., in E . coli.
  • a mouse IGIF pGex plasmid is constructed and transformed into E. coli.
  • Freshly transformed cells are grown, e.g., in LB medium containing 50 ⁇ g/ml ampicillin and induced with IPTG (Sigma, St. Louis, MO) .
  • the bacteria are harvested and the pellets containing, e.g., DCRS3 , protein are isolated.
  • the pellets are homogenized, e.g., in TE buffer (50 mM Tris-base pH 8.0 , 10 mM EDTA and 2 mM pefabloc) in 2 liters.
  • This material is passed through a microfluidizer (Microfluidics , Newton, MA) three times.
  • the fluidized supernatant is spun down on a Sorvall GS-3 rotor for 1 h at 13,000 rpm.
  • the resulting supernatant containing the cytokine receptor protein is filtered and passed over a glutathione-SEPHAROSE column equilibrated in 50 mM Tris-base pH 8.0.
  • the fractions containing the DCRS3-GST fusion protein are pooled and cleaved, e.g., with thrombin (Enzyme Research Laboratories, Inc., South Bend, IN) .
  • the cleaved pool is then passed over a Q-SEPHAROSE column equilibrated in 50 mM Tris-base.
  • Fractions containing DCRS3 are pooled and diluted in cold distilled H2O, to lower the conductivity, and passed back over a fresh Q-Sepharose column, alone or in succession with an immunoaffinity antibody column.
  • Fractions containing DCRS3 protein are pooled, aliquoted, and stored in the -70° C freezer.
  • Balb/c mice are immunized with cells transformed with the gene or fragments thereof, either endogenous or exogenous cells, or with isolated membranes enriched for expression of the antigen. Serum is collected at the appropriate time, typically after numerous further administrations. Various gene therapy techniques may be useful, e.g., in producing protein in situ, for generating an immune response. Serum or antibody preparations may be cross-absorbed or immunoselected to prepare substantially purified antibodies of defined specificity and high affinity. Monoclonal antibodies may be made. For example, splenocytes are fused with an appropriate fusion partner and hybridomas are selected in growth medium by standard procedures. Hybridoma supe atants are screened for the presence of antibodies which bind to DCRS3 , e.g., by ELISA or other assay. Antibodies which specifically recognize specific DCRS3 embodiments may also be selected or prepared.
  • synthetic peptides or purified protein are presented to an immune system to generate monoclonal or polyclonal antibodies. See, e.g., Coligan (ed. 1991) Current
  • the binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods.
  • Nucleic acids may also be introduced into cells in an animal to produce the antigen, which serves to elicit an immune response. See, e.g., Wang, et al .
  • DCRS DC-reliable and low-latency fusion constructs
  • a portion of the appropriate gene is fused to an epitope tag, e.g., a FLAG tag, or to a two hybrid system construct. See, e.g., Fields and Song (1989) Nature 340:245-246.
  • the epitope tag may be used in an expression cloning procedure with detection with anti-FLAG antibodies to detect a binding partner, e.g., ligand for the respective cytokine receptor.
  • the two hybrid system may also be used to isolate proteins which specifically bind to DCRS.
  • Standard mutagenesis analysis is performed, e.g., by generating many different variants at determined positions, e.g., at the positions identified above, and evaluating biological activities of the variants. This may be performed to the extent of determining positions which modify activity, or to focus on specific positions to determine the residues which can be substituted to either retain, block, or modulate biological activity.
  • analysis of natural variants can indicate what positions tolerate natural mutations. This may result from populational analysis of variation among individuals, or across strains or species. Samples from selected individuals are analyzed, e.g., by PCR analysis and sequencing. This allows evaluation of population polymorphisms.
  • a cytokine receptor can be used as a specific binding reagent to identify its binding partner, by taking advantage of its specificity of binding, much like an antibody would be used.
  • the binding receptor may be a heterodimer of receptor subunits; or may involve, e.g., a complex of the DCRS with another subunit.
  • a binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods.
  • the binding composition is used to screen an expression library made from a cell line which expresses a binding partner, i.e., ligand, preferably membrane associated. Standard staining techniques are used to detect or sort surface expressed ligand, or surface expressing transformed cells are screened by panning.
  • a binding partner i.e., ligand, preferably membrane associated.
  • Standard staining techniques are used to detect or sort surface expressed ligand, or surface expressing transformed cells are screened by panning.
  • 66 ⁇ g/ml DEAE-dextran, 66 ⁇ M chloroquine, and 4 ⁇ g DNA in serum free DME For each set, a positive control is prepared, e.g., of DCRS-FLAG cDNA at 1 and 1/200 dilution, and a negative mock. Rinse cells with serum free DME. Add the DNA solution and incubate 5 hr at 37°C. Remove the medium and add 0.5 ml 10% DMSO in DME for 2.5 min. Remove and wash once with DME. Add 1.5 ml growth medium and incubate overnight .
  • wash cells twice with HBSS/saponin If appropriate, add first antibody for 30 min. Add second antibody, e.g., Vector anti- mouse antibody, at 1/200 dilution, and incubate for 30 min. Prepare ELISA solution, e.g., Vector Elite ABC horseradish peroxidase solution, and preincubate for 30 min. Use, e.g., 1 drop of solution A (avidin) and 1 drop solution B (biotin) per 2.5 ml HBSS/saponin. Wash cells twice with HBSS/saponin. Add ABC HRP solution and incubate for 30 min. Wash cells twice with HBSS, second wash for 2 min, which closes cells.
  • DAB Vector diaminobenzoic acid
  • receptor reagents are used to affinity purify or sort out cells expressing a putative ligand. See, e.g., Sambrook, et al . or Ausubel, et al .
  • Another strategy is to screen for a membrane bound receptor by panning.
  • the receptor cDNA is constructed as described O

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

Nucleic acids encoding mammalian, e.g., primate, receptors, purified receptor proteins and fragments thereof. Antibodies, both polyclonal and monoclonal, are also provided. Methods of using the compositions for both diagnostic and therapeutic utilities are described.

Description

MAMMALIAN RECEPTOR PROTEINS; RELATED REAGENTS AND METHODS
This filing claims priority to U.S. Patent Application 09/443,060, filed November 18, 1999, and U.S. Application 60/170,320, filed December 13, 1999, each of which is incorporated herein by reference.
FIELD OF THE INVENTION The present invention relates to compositions and methods for affecting mammalian physiology, including immune system function. In particular, it provides methods to regulate development and/or the immune system. Diagnostic and therapeutic uses of these materials are also disclosed.
BACKGROUND OF THE INVENTION
Recombinant DNA technology refers generally to techniques of integrating genetic information from a donor source into vectors for subsequent processing, such as through introduction into a host, whereby the transferred genetic information is copied and/or expressed in the new environment. Commonly, the genetic information exists in the form of complementary DNA (cDNA) derived from messenger RNA (mRNA) coding for a desired protein product. The carrier is frequently a plasmid having the capacity to incorporate cDNA for later replication in a host and, in some cases, actually to control expression of the cDNA and thereby direct synthesis of the encoded product in the host. See, e.g., Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual , (2d ed.) vols .' 1-3, CSH Press, NY. For some time, it has been known that the mammalian immune response is based on a series of complex cellular interactions, called the "immune network". Recent research has provided new insights into the inner workings of this network. While it remains clear that much of the immune response does, in fact, revolve around the network-like interactions of lymphocytes, macrophages, granulocytes, and other cells, immunologists now generally hold the opinion that soluble proteins, known as lymphokines, cytokines, or monokines, play critical roles in controlling these cellular interactions. Thus, there is considerable interest in the isolation, characterization, and mechanisms of action of cell modulatory factors, an understanding of which will lead to significant advancements in the diagnosis and therapy of numerous medical abnormalities, e.g., immune system disorders.
Lymphokines apparently mediate cellular activities in a variety of ways. See, e.g., Paul (ed. 1996) Fundamental
Immunology 3d ed. , Raven Press, New York; and Thomson (ed. 1994) The Cytokine Handbook 2d ed. , Academic Press, San Diego. They have been shown to support the proliferation, growth, and/or differentiation of pluripotential hematopoietic stem cells into vast numbers of progenitors comprising diverse cellular lineages which make up a complex immune system. Proper and balanced interactions between the cellular components are necessary for a healthy immune response. The different cellular lineages often respond in a different manner when lymphokines are administered in conjunction with other agents.
Cell lineages especially important to the immune response include two classes of lymphocytes: B-cells, which can produce and secrete immunoglobulins (proteins with the capability of recognizing and binding to foreign matter to effect its removal) , and T-cells of various subsets that secrete lymphokines and induce or suppress the B-cells and various other cells (including other T-cells) making up the immune network. These lymphocytes interact with many other cell types.
Research to better understand and treat various immune disorders has been hampered by the general inability to maintain cells of the immune system in vitro. Immunologists have discovered that culturing many of these cells can be accomplished through the use of T-cell and other cell supematants, which contain various growth factors, including many of the lymphokines.
Various growth and regulatory factors exist which modulate morphogenetic development . Many receptors for cytokines are known. Often, there are at least two critical subunits in the functional receptor. See, e.g., Gonda and D'Andrea (1997) Blood 89:355-369; Presky, et al . (1996) Proc. Nat ' 1 Acad. Sci. USA 93:14002-14007; Drachman and Kaushansky (1995) Curr. Opin. Hematol . 2:22-28; Theze (1994) Eur. Cvtokine Netw. 5:353-368; and Lemmon and Schlessinger (1994) Trends Biochem. Sci. 19:459- 463.
From the foregoing, it is evident that the discovery and development of new receptors, including ones similar to known receptors for lymphokines, should contribute to new therapies . In particular, the discovery and understanding of novel receptors for lymphokine-like molecules which enhance or potentiate the beneficial activities of other lymphokines would be highly advantageous. The present invention provides new receptors for ligands exhibiting similarity to cytokine like compositions and related compounds, and methods for their use.
SUMMARY OF THE INVENTION The present invention is directed to novel receptors related to cytokine receptors, e.g., primate, cytokine receptor like molecular structures, designated DNAX Cytokine Receptor Subunits (DCRS) , and their biological activities. In particular, it provides descriptions of subunits designated DCRS3 (referring to two embodiments designated DCRS3.1 and DCRS3.2) and DCRS4 (referring to three embodiments designated DCRS4.1, DCRS4.2, and DCRS4.3). It includes nucleic acids coding for the polypeptides themselves and methods for their production and use. The nucleic acids of the invention are characterized, in part, by their homology to cloned complementary DNA (cDNA) sequences enclosed herein.
The present invention provides a composition of matter selected from: a substantially pure or recombinant: DCRS3 polypeptide comprising: at least three distinct nonoverlapping segments of at least four amino acids identical to segments of SEQ ID NO: 2 or 25; a substantially pure or recombinant DCRS3 polypeptide comprising at least two distinct nonoverlapping segments of at least five amino acids identical to segments of SEQ ID NO: 2 or 25; a natural sequence DCRS3 comprising mature SEQ ID NO: 2 or 25; a fusion polypeptide comprising DCRS3 sequence; or DCRS4 polypeptide comprising: at least three distinct nonoverlapping segments of at least four amino acids identical to segments of SEQ ID NO: 5, 28, or 31; a substantially pure or recombinant DCRS4 polypeptide comprising at least two distinct nonoverlapping segments of at least five amino acids identical to segments of SEQ ID NO: 5, 28, or 31; a natural sequence DCRS4 comprising mature SEQ ID NO: 5, 28, or 31; or a fusion polypeptide comprising DCRS4 sequence. In certain embodiments, the invention embraces such a substantially pure or isolated antigenic DCRS3 or DRS4 polypeptide, wherein the distinct nonoverlapping segments of identity: include one of at least eight amino acids; include one of at least four amino acids and a second of at least five amino acids; include at least three segments of at least four, five, and six amino acids, or include one of at least twelve amino acids. Other embodiments include wherein the: DCRS3 polypeptide: comprises a mature sequence of Table 1; is an unglycosylated form of DCRS3 ; is from a primate, such as a human; comprises at least seventeen amino acids of SEQ ID NO: 2 or 25; exhibits at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 2 or 25; comprises a sequence of at least 3 amino acids on each side across an exon boundary; is a natural allelic variant of DCRS3; has a length at least about 30 amino acids; exhibits at least two non-overlapping epitopes which are specific for a primate DCRS3 ; is glycosylated; has a molecular weight of at least 30 kD with natural glycosylation; is a synthetic polypeptide; is attached to a solid substrate; is conjugated to another chemical moiety; is a 5-fold or less substitution from natural sequence; or is a deletion or insertion variant from a natural sequence; or DCRS4 polypeptide: comprises a mature sequence of Table 3; is an unglycosylated form of DCRS4 ; is from a primate, such as a human; comprises at least seventeen amino acids of SEQ ID NO: 5; exhibits at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 5, 28, or 31; comprises a sequence of at least 3 amino acids on each side across an exon boundary; is a natural allelic variant of DCRS5; has a length at least about 30 amino acids; exhibits at least two non-overlapping epitopes which are specific for a primate DCRS5; is glycosylated; has a molecular weight of at least 30 kD with natural glycosylation; is a synthetic polypeptide; is attached to a solid substrate; is conjugated to another chemical moiety; is a 5-fold or less substitution from natural sequence; or is a deletion or insertion variant from a natural sequence. Still other embodiments include a composition comprising: a substantially pure DCRS3 and another cytokine receptor family member; a sterile DCRS3 polypeptide; the DCRS3 polypeptide and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration; a substantially pure DCRS4 and another cytokine receptor family member; a sterile DCRS4 polypeptide; the DCRS4 polypeptide and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration. Fusion polypeptide embodiments include those comprising: mature protein sequence of Table 1 or 3 ; a detection or purification tag, including a FLAG, His6, or Ig sequence; or sequence of another interferon receptor protein. Kit embodiments include those comprising such a polypeptide, and: a compartment comprising the protein or polypeptide; or instructions for use or disposal of reagents in the kit.
Binding compound embodiments include, e.g., a binding compound comprising an antigen binding site from an antibody, which specifically binds to a natural: DCRS3 polypeptide, wherein: the binding compound is in a container; the DCRS3 polypeptide is from a human; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised against a peptide sequence of a mature polypeptide of Table 1; is raised against a mature DCRS3 ; is raised to a purified human DCRS3; is immunoselected; is a polyclonal antibody; binds to a denatured DCRS3; exhibits a Kd to antigen of at least 30 μM; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label; or DCRS4 polypeptide, wherein: the binding compound is in a container; the DCRS4 polypeptide is from a human; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised against a peptide sequence of a mature polypeptide of Table 3; is raised against a mature DCRS4; is raised to a purified human DCRS4 ; is immunoselected; is a polyclonal antibody; binds to a denatured DCRS4 ; exhibits a Kd to antigen of at least 30 μM; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label . Kits include those comprising the binding compound, and: a compartment comprising the binding compound; or instructions for use or disposal of reagents in the kit.
Methods are provided, e.g., of producing an antigen: antibody complex, comprising contacting under appropriate conditions: a primate DCRS3 polypeptide with a described antibody, thereby allowing the complex to form; or a primate DCRS4 polypeptide with a described antibody, thereby allowing the complex to form. This includes wherein: the complex is purified from other cytokine receptors; the complex is purified from other antibody; the contacting is with a sample comprising another cytokine; the contacting allows quantitative detection of the antigen; the contacting is with a sample comprising the antibody; or the contacting allows quantitative detection of the antibody.
Various related compositions are provided, e.g., a composition comprising: a sterile binding compound, as described, or the described binding compound and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration. Nucleic acid embodiments include, e.g., an isolated or recombinant nucleic acid encoding the DCRS3 polypeptide, wherein the: DCRS3 is from a human; or the nucleic acid: encodes an antigenic peptide sequence of Table 1; encodes a plurality of antigenic peptide sequences of Table 1; exhibits identity over at least thirteen nucleotides to a natural cDNA encoding the segment; is an expression vector; further comprises an origin of replication; is from a natural source; comprises a detectable label; comprises synthetic nucleotide sequence; is less than 6 kb, preferably less than 3 kb; is from a primate; comprises a natural full length coding sequence; is a hybridization probe for a gene encoding the DCRS3 ; or is a PCR primer, PCR product, or mutagenesis primer; or an isolated or recombinant nucleic acid encoding the DCRS4 polypeptide, wherein the: DCRS4 is from a human; or the nucleic acid: encodes an antigenic peptide sequence of Table 3; encodes a plurality of antigenic peptide sequences of Table 3; exhibits identity over at least thirteen nucleotides to a natural cDNA encoding the segment; is an expression vector; further comprises an origin of replication; is from a natural source; comprises a detectable label; comprises synthetic nucleotide sequence; is less than 6 kb, preferably less than 3 kb; is from a primate; comprises a natural full length coding sequence; is a hybridization probe for a gene encoding the DCRS4 ; or is a PCR primer, PCR product, or mutagenesis primer. Other embodiments of the invention include a cell or tissue comprising the described recombinant nucleic acid. Preferably, the cell is: a prokaryotic cell; a eukaryotic cell; a bacterial cell; a yeast cell; an insect cell; a mammalian cell; a mouse cell; a primate cell; or a human cell.
Kit embodiments include those comprising a described nucleic acid, and: a compartment comprising the nucleic acid; a compartment further comprising a primate DCRS3 or DCRS4 polypeptide; or instructions for use or disposal of reagents in the kit.
Alternative nucleic acid embodiments include a nucleic acid which: hybridizes under wash conditions of 30 minutes at 30° C and less than 2M salt to the coding portion of: SEQ ID NO: 1, 24, 4, 27, or 30; or exhibits identity over a stretch of at least about 30 nucleotides to a primate DCRS3 or DCRS4. Preferred embodiments include those wherein: the wash conditions are at 45° C and/or 500 M salt; the wash conditions are at 55° C and/or 150 mM salt; the stretch is at least 55 nucleotides; or the stretch is at least 75 nucleotides.
Other methods include those of modulating physiology or development of a cell or tissue culture cells comprising contacting the cell with an agonist or antagonist of a mammalian DCRS3 or DCRS4. Preferably, the cell is transformed with a nucleic acid encoding a DCRS3 or DCRS4 and another cytokine receptor subunit.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
OUTLINE
I . General II. Activities
III. Nucleic acids
A. encoding fragments, sequence, probes
B. mutations, chimeras, fusions
C. making nucleic acids D. vectors, cells comprising
IV. Proteins, Peptides
A. fragments, sequence, immunogens, antigens
B. muteins
C. agonists/antagonists, functional equivalents D. making proteins
V. Making nucleic acids, proteins
A. synthetic
B. recombinant
C. natural sources VI. Antibodies
A. polyclonals
B. monoclonal
C. fragments; Kd
D. anti-idiotypic antibodies E. hybridoma cell lines
VII. Kits and Methods to quantify DCRS
A. ELISA
B. assay mRNA encoding
C. qualitative/quantitative D. kits
VIII. Therapeutic compositions, methods
A. combination compositions
B. unit dose
C. administration IX. Screening X. Ligands
1. General
The present invention provides the amino acid sequences and DNA sequences of mammalian, herein primate, cytokine receptorlike subunit molecules, these designated DNAX Cytokine Receptor Subunit 3 (DCRS3 ; 50R) and DNAX Cytokine Receptor Subunit 4 (DCRS4; cytor) having particular defined properties, both structural and biological . Various cDNAs encoding these molecules were obtained from primate, e.g., human, cDNA sequence libraries. Other primate or other mammalian counterparts would also be desired.
Some of the standard methods applicable are described or referenced, e.g., in Maniatis, et al . (1982) Molecular Cloning, A Laboratory Manual , Cold Spring Harbor Laboratory, Cold Spring Harbor Press; Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual , (2d ed.), vols. 1-3, CSH Press, NY; Ausubel, et al . , Biology, Greene Publishing Associates, Brooklyn, NY; or Ausubel, et al . (1987 and periodic supplements) Current Protocols in Molecular Biology, Greene/Wiley, New York; each of which is incorporated herein by reference.
Nucleotide (SEQ ID NO: 1) and corresponding amino acid sequence (SEQ ID NO: 2) of a human DCRS3 coding segment are shown in Table 1; likewise for the DCRS3.2 as SEQ ID NO: 24 and 25; comparison of DCRS3.1 and DCRS3.2 polypeptide sequences is shown also in Table 1. Reverse translations based upon the universal genetic code are provided in Table 2; comparison of the encoding nucleic acid sequences is also presented in Table
2. The sequences are derived from genomic sequence at chromosome location clones CIT987SK-582J2 HUAC004525 and CIT987- SKA-670B5 HUAC002303, at 16pl2, and other cDNA sequences. The predicted signal sequence is indicated, but may depend on cell type, or may be a few residues in either direction. The transmembrane segment (SEQ ID NO: 2) is predicted to run from about Ieu248-ser264 (glu242 -his268) . Predicted fibronectin domain runs from about asnl28-tyr220 ; cytokine receptor WS box from about trp224-ser228 ; conserved disulfide motif between cys6-cys26; second conserved disulfide linkage at cys65-cys89 ,- five N glycosylation sites at Asn residues 61, 97, 121, 128, and 145; seven cAMP PK sites at lys4 ; lys68; lysl84; argl91; arg201; lys202; and lys292; fourteen Ca phosphorylation sites at thr71, serl30, serl87, ser205, ser237, serl82, serl95, ser310, ser317, thr323, ser374, ser385, ser403, and thr499; five myristoly sites at glyl74, gly303, gly439, gly449, and gly466; four PKC phosphorylation sites at ser7, serl47, serlδO, and ser264; and one tyrosine kinase site at lysl63. Exon boundaries are predicted to be about between nucleotides g49-c50, g230-g231, g284-g285, a484-g485, g597-a598, g775-a776, g875-g876, and g957-a958. Because the sequences have been derived from genomic sequence, in which the introns have not been spliced out, particularly important compositions will be those which encode segments across the boundaries, e.g., both nucleic acid sequence and amino acid sequence. The segments will comprise, e.g., segments across the boundary which may comprise 8, 9, 11, 13, 15, 17 20, 25, 30, 35, 50, or more nucleotides on either or both sides adjacent to an exon boundary, or 4 , 5, 6, 7, or 8 amino acids on either or both sides adjacent a boundary. The lengths on either side need not be the same for purposes of novelty, e.g., three amino acids on one side and 5 on the other side. Thus, e.g., compositions are provided comprising, e.g, 15 contiguous nucleotides across a boundary, of which at least 6 are from each side. Similarly, compositions are provided, e.g., comprising at least 3 amino acids from each side of the exon boundary, with a matching of at least 8 amino acids across the boundary. Also provided are compositions comprising a plurality of such segments across multiple exon boundaries, which different segments need not have the same length limitations. Thus, the invention provides a nucleic acid comprising, e.g., at least 5 nucleotides in each side across the exon 1/2 boundary, and at least 4 nucleotides on either side of the the exon 3/4, 4/5, 5/6, and/or 6/7 boundaries. Natural sequence compositions would be preferred. Nucleotide (SEQ ID NO: 4) and corresponding amino acid sequence (SEQ ID NO: 5) of a human DCRS4 coding segment are shown in Table 3; likewise for the DCRS4.2 as SEQ ID NO: 27 and 28 and the DCRS4.3 as SEQ ID NO: 30 and 31; comparison of DCRS4 polypeptide sequences is shown also in Table 3. Reverse translations based upon the universal genetic code are provided in Table 4; comparison of the encoding nucleic acid sequences is also presented in Table 4. The sequence of DCRS4.1 is derived from genomic sequence at chromosome location 6q24.1-25.2, within some 50 kb of IFNγRl chain. The predicted DCRS4.1 signal sequence is indicated, but may depend on cell type, or may be a few residues in either direction. This embodiment of the receptor lacks a transmembrane segment, which is unusual, but there is precedent for soluble forms of cytokine receptor subunits. See, e.g, IL-12Rα (p40 subunit) and the EBI3 receptor subunit homolog. For the DCRS4.1, the predicted cytokine receptor domain from prol0-arg49 ; conserved disulfide motif between cys57-cys65; five N glycosylation sites at Asn residues 35, 131, 136, 157, and 174; four cAMP PK sites at arg30, lys98, lysl06, and lysl56; eight Ca phosphorylation sites at thr4 , thr60, ser64, thr68, thr71, serl59, serl76, and ser220; three myristoly sites at gly89, glyl03, and glyl86; three PKC phosphorylation sites at ser7, ser97, and ser217; one amidation site at tyr79; one cAMP phosphorylation site at lys98; and two CK2 phosphorylation sites at ser3 and serl59. Exon boundaries are predicted to be about between nucleotides c59-a60; tl97- al98, g206-a207, g430-c431, and g601-a602. Alignment with the other DCRS4 embodiments is provided. As described above, compositions with sequence across the exon boundaries are provided. Table 1: Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiments (DCRS3.1; 50R) . Primate, e.g., human embodiment (see SEQ ID NO : 1 and 2) . Predicted signal sequence indicated, but may vary by a few positions and depending upon cell type. atg ccg cgt ggc tgg gcc gcc ccc ttg etc ctg ctg ctg etc cag gga 48
Met Pro Arg Gly Trp Ala Ala Pro Leu Leu Leu Leu Leu Leu Gin Gly -20 -15 -10 -5 gcc etc gag ggg atg gag agg aag etc tgc agt ccc aag cca ccc ccc 96 Ala Leu Glu Gly Met Glu Arg Lys Leu Cys Ser Pro Lys Pro Pro Pro
-1 1 5 10 ace aag gcc tct etc ccc act gac cct cca ggc tgg ggc tgc ccc gac 144 Thr Lys Ala Ser Leu Pro Thr Asp Pro Pro Gly Trp Gly Cys Pro Asp 15 20 25 etc gtc tgc tac ace gat tac etc cag acg gtc ate tgc ate ctg gaa 192 Leu Val Cys Tyr Thr Asp Tyr Leu Gin Thr Val lie Cys lie Leu Glu 30 35 40 atg tgg aac etc cac ccc age acg etc ace ctt ace tgg ata ctt tct 240 Met Trp Asn Leu His Pro Ser Thr Leu Thr Leu Thr Trp lie Leu Ser 45 50 55 60 aat aat act ggg tgc tat ate aag gac aga aca ctg gac etc agg caa 288 Asn Asn Thr Gly Cys Tyr lie Lys Asp Arg Thr Leu Asp Leu Arg Gin 65 70 75 gac cag tat gaa gag ctg aag gac gag gcc ace tec tgc age etc cac 336 Asp Gin Tyr Glu Glu Leu Lys Asp Glu Ala Thr Ser Cys Ser Leu His 80 85 90 agg teg gcc cac aat gcc acg cat gcc ace tac ace tgc cac atg gat 384 Arg Ser Ala His Asn Ala Thr His Ala Thr Tyr Thr Cys His Met Asp 95 100 105 gta ttc cac ttc atg gcc gac gac att ttc agt gtc aac ate aca gac 432 Val Phe His Phe Met Ala Asp Asp He Phe Ser Val Asn He Thr Asp 110 115 120 cag tct ggc aac tac tec cag gag tgt ggc age ttt etc ctg get gag 480 Gin Ser Gly Asn Tyr Ser Gin Glu Cys Gly Ser Phe Leu Leu Ala Glu 125 130 135 140 age aga cag tat aat ate tec tgg cgc tea gat tac gaa gac cct gcc 528
Ser Arg Gin Tyr Asn He Ser Trp Arg Ser Asp Tyr Glu Asp Pro Ala 145 150 155 ttc tac atg ctg aag ggc aag ctt cag tat gag ctg cag tac agg aac 576
Phe Tyr Met Leu Lys Gly Lys Leu Gin Tyr Glu Leu Gin Tyr Arg Asn 160 165 170 egg gga gac ccc tgg get gtg agt ccg agg aga aag ctg ate tea gtg 624 Arg Gly Asp Pro Trp Ala Val Ser Pro Arg Arg Lys Leu He Ser Val 175 180 185 gac tea aga agt gtc tec etc etc ccc ctg gag ttc cgc aaa gac teg 672 Asp Ser Arg Ser Val Ser Leu Leu Pro Leu Glu Phe Arg Lys Asp Ser 190 195 200 age tat gag ctg cag gtg egg gca ggg ccc atg cct ggc tec tec tac 720 Ser Tyr Glu Leu Gin Val Arg Ala Gly Pro Met Pro Gly Ser Ser Tyr 205 210 215 220 cag ggg ace tgg agt gaa tgg agt gac ccg gtc ate ttt cag ace cag 768
Gin Gly Thr Trp Ser Glu Trp Ser Asp Pro Val He Phe Gin Thr Gin
225 230 235 tea gag gag tta aag gaa ggc tgg aac cct cac ctg ctg ctt etc etc 816
Ser Glu Glu Leu Lys Glu Gly Trp Asn Pro His Leu Leu Leu Leu Leu
240 245 250 ctg ctt gtc ata gtc ttc att cct gcc ttc tgg age ctg aag ace cat 864 Leu Leu Val He Val Phe He Pro Ala Phe Trp Ser Leu Lys Thr His 255 260 265 cca ttg tgg agg eta tgg aag aag ata tgg gcc gtc ccc age cct gag 912 Pro Leu Trp Arg Leu Trp Lys Lys He Trp Ala Val Pro Ser Pro Glu 270 275 280 egg ttc ttc atg ccc ctg tac aag ggc tgc age gga gac ttc aag aaa 960 Arg Phe Phe Met Pro Leu Tyr Lys Gly Cys Ser Gly Asp Phe Lys Lys 285 290 295 300 tgg gtg ggt gca ccc ttc act ggc tec age ctg gag ctg gga ccc tgg 1008 Trp Val Gly Ala Pro Phe Thr Gly Ser Ser Leu Glu Leu Gly Pro Trp 305 310 315 age cca gag gtg ccc tec ace ctg gag gtg tac age tgc cac cca cca 1056 Ser Pro Glu Val Pro Ser Thr Leu Glu Val Tyr Ser Cys His Pro Pro 320 325 330 egg age ccg gcc aag agg ctg cag etc acg gag eta caa gaa cca gca 1104 Arg Ser Pro Ala Lys Arg Leu Gin Leu Thr Glu Leu Gin Glu Pro Ala 335 340 345 gag ctg gtg gag tct gac ggt gtg ccc aag ccc age ttc tgg ccg aca 1152 Glu Leu Val Glu Ser Asp Gly Val Pro Lys Pro Ser Phe Trp Pro Thr 350 355 360 gcc cag aac teg ggg ggc tea get tac agt gag gag agg gat egg cca 1200 Ala Gin Asn Ser Gly Gly Ser Ala Tyr Ser Glu Glu Arg Asp Arg Pro 365 370 375 380 tac ggc ctg gtg tec att gac aca gtg act gtg eta gat gca gag ggg 1248 Tyr Gly Leu Val Ser He Asp Thr Val Thr Val Leu Asp Ala Glu Gly 385 390 395 cca tgc ace tgg ccc tgc age tgt gag gat gac ggc tac cca gcc ctg 1296 Pro Cys Thr Trp Pro Cys Ser Cys Glu Asp Asp Gly Tyr Pro Ala Leu 400 405 410 gac ctg gat get ggc ctg gag ccc age cca ggc eta gag gac cca etc 1344 Asp Leu Asp Ala Gly Leu Glu Pro Ser Pro Gly Leu Glu Asp Pro Leu 415 420 425 ttg gat gca ggg ace aca gtc ctg tec tgt ggc tgt gtc tea get ggc 1392 Leu Asp Ala Gly Thr Thr Val Leu Ser Cys Gly Cys Val Ser Ala Gly 430 435 440 age cct ggg eta gga ggg ccc ctg gga age etc ctg gac aga eta aag 1440 Ser Pro Gly Leu Gly Gly Pro Leu Gly Ser Leu Leu Asp Arg Leu Lys 445 450 455 460 cca ccc ctt gca gat ggg gag gac tgg get ggg gga ctg ccc tgg ggt 1488 Pro Pro Leu Ala Asp Gly Glu Asp Trp Ala Gly Gly Leu Pro Trp Gly 465 470 475 ggc egg tea cct gga ggg gtc tea gag agt gag gcg ggc tea ccc ctg 1536 Gly Arg Ser Pro Gly Gly Val Ser Glu Ser Glu Ala Gly Ser Pro Leu 480 485 490 gcc ggc ctg gat atg gac acg ttt gac agt ggc ttt gtg ggc tct gac 1584 Ala Gly Leu Asp Met Asp Thr Phe Asp Ser Gly Phe Val Gly Ser Asp 495 500 505 tgc age age cct gtg gag tgt gac ttc ace age ccc ggg gac gaa gga 1632 Cys Ser Ser Pro Val Glu Cys Asp Phe Thr Ser Pro Gly Asp Glu Gly 510 515 520 ccc ccc egg age tac etc cgc cag tgg gtg gtc att cct ccg cca ctt 1680 Pro Pro Arg Ser Tyr Leu Arg Gin Trp Val Val He Pro Pro Pro Leu 525 530 535 540 teg age cct gga ccc cag gcc age taa 1707
Ser Ser Pro Gly Pro Gin Ala Ser 545
MPRGWAAPLLLLLLQGALEGMERKLCSPKPPPTKASLPTDPPGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLT ILSNNTGCYIKDRTLDLRQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECG SFLLAESRQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVR AGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFM PLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTA QNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVS AGSPGLGGPLGSLLDRLKPPLADGED AGGLP GGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTS PGDEGPPRSYLRQWWIPPPLSSPGPQAS Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiments (DCRS3.2; SEQ ID NO: 24 and 25): atg ccg cgt ggc tgg gcc gcc ccc ttg etc ctg ctg ctg etc cag gga 48 Met Pro Arg Gly Trp Ala Ala Pro Leu Leu Leu Leu Leu Leu Gin Gly -20 -15 -10 -5 ggc tgg ggc tgc ccc gac etc gtc tgc tac ace gat tac etc cag acg 96
Gly Trp Gly Cys Pro Asp Leu Val Cys Tyr Thr Asp Tyr Leu Gin Thr -1 1 5 10 gtc ate tgc ate ctg gaa atg tgg aac etc cac ccc age acg etc ace 144
Val He Cys He Leu Glu Met Trp Asn Leu His Pro Ser Thr Leu Thr
15 20 25 ctt ace tgg caa gac cag tat gaa gag ctg aag gac gag gcc ace tec 192 Leu Thr Trp Gin Asp Gin Tyr Glu Glu Leu Lys Asp Glu Ala Thr Ser 30 35 40 tgc age etc cac agg teg gcc cac aat gcc acg cat gcc ace tac ace 240 Cys Ser Leu His Arg Ser Ala His Asn Ala Thr His Ala Thr Tyr Thr 45 50 55 60 tgc cac atg gat gta ttc cac ttc atg gcc gac gac att ttc agt gtc 288 Cys His Met Asp Val Phe His Phe Met Ala Asp Asp He Phe Ser Val 65 70 75 aac ate aca gac cag tct ggc aac tac tec cag gan tgt ggc age ttt 336 Asn He Thr Asp Gin Ser Gly Asn Tyr Ser Gin Xaa Cys Gly Ser Phe 80 85 90 etc ctg get gag age ate aag ccg get ccc cct ttc aac gtg act gtg 384 Leu Leu Ala Glu Ser He Lys Pro Ala Pro Pro Phe Asn Val Thr Val 95 100 105 ace ttc tea gga cag tat aat atn tec tgg cgc tea gat tac gaa gac 432 Thr Phe Ser Gly Gin Tyr Asn Xaa Ser Trp Arg Ser Asp Tyr Glu Asp 110 115 120 cct gcc ttc tac atg ctg aaa ggc aag ctt caa tat gag ctg cag tac 480 Pro Ala Phe Tyr Met Leu Lys Gly Lys Leu Gin Tyr Glu Leu Gin Tyr 125 130 135 140 agg aac egg gga gac ccc tgg get gtg agt ccg agg aga aag ctg ate 528 Arg Asn Arg Gly Asp Pro Trp Ala Val Ser Pro Arg Arg Lys Leu He 145 150 155 tea gtg gac tea aga agt gtc tec etc etc ccc ctg gag ttc cgc aaa 576 Ser Val Asp Ser Arg Ser Val Ser Leu Leu Pro Leu Glu Phe Arg Lys 160 165 170 gac teg age tat gag ctg can gtg egg gca ggg ccc atg cct ggc tec 624 Asp Ser Ser Tyr Glu Leu Xaa Val Arg Ala Gly Pro Met Pro Gly Ser 175 180 185 tec tac cag ggg ace tgg agt gaa tgg agt gac ccg gtc ate tgt cag 672
Ser Tyr Gin Gly Thr Trp Ser Glu Trp Ser Asp Pro Val He Cys Gin 190 195 200 ace cag tea gag gag tta aag gaa ggc tgg aac cct cac ctg ctg ctt 720 Thr Gin Ser Glu Glu Leu Lys Glu Gly Trp Asn Pro His Leu Leu Leu
205 210 215 220 etc etc ctg ctt gtc ata gtc ttc att cct gcc ttc tgg age ctg aag 768 Leu Leu Leu Leu Val He Val Phe He Pro Ala Phe Trp Ser Leu Lys 225 230 235 ace cat cca ttg tgg agg eta tgg aag aag ata tgg gcc gtc ccc age 816 Thr His Pro Leu Trp Arg Leu Trp Lys Lys He Trp Ala Val Pro Ser 240 245 250 cct gag egg ttc ttc atg ccc ctg tac aag ggc tgc age gga gac ttc 864 Pro Glu Arg Phe Phe Met Pro Leu Tyr Lys Gly Cys Ser Gly Asp Phe 255 260 265 aag aaa tgg gtg ggt gca ccc ttc act ggc tec age ctg gag ctg gga 912 Lys Lys Trp Val Gly Ala Pro Phe Thr Gly Ser Ser Leu Glu Leu Gly 270 275 280 ccc tgg age cca gag gtg ccc tec ace ctg gag gtg tac age tgc cac 960 Pro Trp Ser Pro Glu Val Pro Ser Thr Leu Glu Val Tyr Ser Cys His 285 290 295 300 cca cca egg age ccg gcc aag agg ctg cag etc acg gag eta caa gaa 1008 Pro Pro Arg Ser Pro Ala Lys Arg Leu Gin Leu Thr Glu Leu Gin Glu 305 310 315 cca gca gag ctg gtg gag tct gac ggt gtg ccc aag ccc age ttc tgg 1056 Pro Ala Glu Leu Val Glu Ser Asp Gly Val Pro Lys Pro Ser Phe Trp 320 325 330 ccg aca gcc cag aac teg ggg ggc tea get tac agt gag gag agg gat 1104 Pro Thr Ala Gin Asn Ser Gly Gly Ser Ala Tyr Ser Glu Glu Arg Asp 335 340 345 egg cca tac ggc ctg gtg tec att gac aca gtg act gtg eta gat gca 1152 Arg Pro Tyr Gly Leu Val Ser He Asp Thr Val Thr Val Leu Asp Ala 350 355 360 gag ggg cca tgc ace tgg ccc tgc age tgt gag gat gac ggc tac cca 1200 Glu Gly Pro Cys Thr Trp Pro Cys Ser Cys Glu Asp Asp Gly Tyr Pro 365 370 375 380 gcc ctg gac ctg gat get ggc ctg gag ccc age cca ggc eta gag gac 1248 Ala Leu Asp Leu Asp Ala Gly Leu Glu Pro Ser Pro Gly Leu Glu Asp 385 390 395 cca etc ttg gat gca ggg ace aca gtc ctg tec tgt ggc tgt gtc tea 1296 Pro Leu Leu Asp Ala Gly Thr Thr Val Leu Ser Cys Gly Cys Val Ser 400 405 410 get ggc age cct ggg eta gga ggg ccc ctg gga age etc ctg gac aga 1344 Ala Gly Ser Pro Gly Leu Gly Gly Pro Leu Gly Ser Leu Leu Asp Arg 415 420 425 eta aag cca ccc ctt gca gat ggg gag gac tgg get ggg gga ctg ccc 1392 Leu Lys Pro Pro Leu Ala Asp Gly Glu Asp Trp Ala Gly Gly Leu Pro 430 435 440 tgg ggt ggc egg tea cct gga ggg gtc tea gag agt gag gcg ggc tea 1440 Trp Gly Gly Arg Ser Pro Gly Gly Val Ser Glu Ser Glu Ala Gly Ser 445 450 455 460 ccc ctg gcc ggc ctg gat atg gac acg ttt gac agt ggc ttt gtg ggc 1488 Pro Leu Ala Gly Leu Asp Met Asp Thr Phe Asp Ser Gly Phe Val Gly 465 470 475 tct gac tgc age age cct gtg gag tgt gac ttc ace age ccc ggg gac 1536
Ser Asp Cys Ser Ser Pro Val Glu Cys Asp Phe Thr Ser Pro Gly Asp
480 485 490 gaa gga ccc ccc egg age tac etc cgc cag tgg gtg gtc att cct ccg 1584
Glu Gly Pro Pro Arg Ser Tyr Leu Arg Gin Trp Val Val He Pro Pro 495 500 505 cca ctt teg age cct gga ccc cag gcc age taa 1617
Pro Leu Ser Ser Pro Gly Pro Gin Ala Ser 510 515
MPRG AAPLLLLLLQGG GCPDLVCYTDYLQTVICILEMWNLHPSTLTLT QDQYEELKDEATSCSLHRSAHNATHA TYTCHMDVFHFMADDIFSVNITDQSGNYSQXCGSFLLAESIKPAPPFNVTVTFSGQYNXSWRSDYEDPAFYMLKGKL QYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELXVRAGPMPGSSYQGTWSEWSDPVICQTQSEELK EGWNPHLLLLLLLVIVFIPAFWSLKTHPL RLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGP SP EVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSF PTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAE GPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGG LPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWWIPPPLSSPGPQAS
Polypeptide sequence comparison of DCRS3.2 and DCRS3.1 :
DCRS3.2 1 MPRGWAAPLLLLLLQG GWGCPDLV 24
DCRS3.1 1 MPRGWAAPLLLLLLQGALEGMERKLCSPKPPPTKASLPTDPPGWGCPDLV 50 **************** ******** DCRS3.2 25 CYTDYLQTVICILEM NLHPSTLTLTW QDQYE 56
DCRS3.1 51 CYTDYLQTVICILEMWNLHPSTLTLT ILSNNTGCYIKDRTLDLRQDQYE 100 *************************** *****
DCRS3.2 57 ELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYS 106 DCRS3.1 101 ELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYS 150
**************************************************
DCRS3.2 107 QXCGSFLLAESIKPAPPFNVTVTFSGQYNXSWRSDYEDPAFYMLKGKLQY 156
DCRS3.1 151 QECGSFLLAE SRQYNISWRSDYEDPAFYMLKGKLQY 186 * ******** * *** ********************
DCRS3.2 157 ELQYRNRGDP AVSPRRKLISVDSRSVSLLPLEFRKDSSYELXVRAGPMP 206 DCRS3.1 187 ELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMP 236 ****************************************** *******
DCRS3.2 207 GSSYQGT SEWSDPVICQTQSEELKEG NPHLLLLLLLVIVFIPAF SLK 256
DCRS3.1 237 GSSYQGTWSE SDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAF SLK 286 **************** ********************************* DCRS3.2 257 THPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKK VGAPFTGSSLELGP 306 DCRS3.1 287 THPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKK VGAPFTGSSLELGP 336 **************************************************
DCRS3.2 307 SPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSF PTAQ 356 DCRS3.1 337 SPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQ 386
**************************************************
DCRS3.2 357 NSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCT PCSCEDDGYPALDLDA 406 DCRS3.1 387 NSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDA 436 **************************************************
DCRS3.2 407 GLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADG 456 DCRS3.1 437 GLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADG 486 **************************************************
DCRS3.2 457 EDWAGGLPWGGRSPGGVSEΞEAGSPLAGLDMDTFDSGFVGΞDCSSPVECD 506 DCRS3.1 487 EDWAGGLP GGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECD 536 ************************************************** DCRS3.2 507 FTSPGDEGPPRSYLRQWWIPPPLSSPGPQAS 538 DCRS3.1 537 FTSPGDEGPPRSYLRQ WIPPPLSSPGPQAS 568 ********************************
Table 2: Reverse Translation of primate, e.g., human, DCRS3.1 (SEQ ID NO: 3) . N may be A, C, G, or T.
ATGCCNMGNGGNTGGGCNGCNCCNYTNYTNYTNYTNYTNYTNCARGGNGCNYTNGARGGNATGGARMGNAARYTNTG
YWSNCCNAARCCNCCNCCNACNAARGCNWSNYTNCCNACNGAYCCNCCNGGNTGGGGNTGYCCNGAYYTNGTNTGYT
AYACNGAYTAYYTNCARACNGTNATHTGYATHYTNGARATGTGGAAYYTNCAYCCNWSNACNYTNACNYTNACNTGG ATHYTNWSNAAYAAYACNGGNTGYTAYATHAARGAYMGNACNYTNGAYYTNMGNCARGAYCARTAYGARGARYTNAA RGAYGARGCNACNWSNTGYWSNYTNCAYMGNWSNGCNCAYAAYGCNACNCAYGCNACNTAYACNTGYCAYATGGAYG TNTTYCAYTTYATGGCNGAYGAYATHTTYWSNGTNAAYATHACNGAYCARWSNGGNAAYTAY SNCARGARTGYGGN WSNTTYYTNYTNGCNGARWSNMGNCARTAYAAYATHWSNTGGMGNWSNGAYTAYGARGAYCCNGCNTTYTAYATGYT NAARGGNAARYTNCARTAYGARYTNCARTAYMGNAAYMGNGGNGAYCCNTGGGCNGTN SNCCNMGNMGNAARYTNA THWSNGTNGAYWSNMGNWSNGTNWSNYTNYTNCCNYTNGARTTYMGNAARGAYWSNWSNTAYGARYTNCARGTNMGN GCNGGNCCNATGCCNGGN SNWSNTAYCARGGNACNTGGWSNGARTGG SNGAYCCNGTNATHTTYCARACNCAR S NGARGARYTNAARGARGGNTGGAAYCCNCAYYTNYTNYTNYTNYTNYTNYTNGTNATHGTNTTYATHCCNGCNTTYT GGWSNYTNAARACNCAYCCNYTNTGGMGNYTNTGGAARAARATHTGGGCNGTNCCN SNCCNGARMGNTTYTTYATG CCNYTNTAYAARGGNTGYWSNGGNGAYTTYAARAARTGGGTNGGNGCNCCNTTYACNGGN SNWΞNYTNGARYTNGG NCCNTGGWSNCCNGARGTNCCN SNACNYTNGARGTNTAYWSNTGYCAYCCNCCNMGN SNCCNGCNAARMGNYTNC ARYTNACNGARYTNCARGARCCNGCNGARYTNGTNGARWSNGAYGGNGTNCCNAARCCNWSNTTYTGGCCNACNGCN CARAAY SNGGNGGNWSNGCNTAYWSNGARGARMGNGAYMGNCCNTAYGGNYTNGTNWSNATHGAYACNGTNACNGT NYTNGAYGCNGARGGNCCNTGYACNTGGCCNTGYWSNTGYGARGAYGAYGGNTAYCCNGCNYTNGAYYTNGAYGCNG GNYTNGARCCNWSNCCNGGNYTNGARGAYCCNYTNYTNGAYGCNGGNACNACNGTNYTN SNTGYGGNTGYGTN SN GCNGGN SNCCNGGNYTNGGNGGNCCNYTNGGN SNYTNYTNGAYMGNYTNAARCCNCCNYTNGCNGAYGGNGARGA YTGGGCNGGNGGNYTNCCNTGGGGNGGNMGN SNCCNGGNGGNGTNWSNGARWSNGARGCNGGNWSNCCNYTNGCNG GNYTNGAYATGGAYACNTTYGAYWSNGGNTTYGTNGGN SNGAYTGYWSNWSNCCNGTNGARTGYGAYTTYACNWSN CCNGGNGAYGARGGNCCNCCNMGN SNTAYYTNMGNCARTGGGTNGTNATHCCNCCNCCNYTNWSN SNCCNGGNCC NCARGCN SN
Reverse Translation of primate , e . g . , human , DCRS3 . 2 ( SEQ ID NO : 26 ) . N may be A, C, G, or T . ATGCCNMGNGGNTGGGCNGCNCCNYTNYTNYTNYTNYTNYTNCARGGNGGNTGGGGNTGYCCNGAYYTNGTNTGYTA
YACNGAYTAYYTNCARACNGTNATHTGYATHYTNGARATGTGGAAYYTNCAYCCNWSNACNYTNACNYTNACNTGGC ARGAYCARTAYGARGARYTNAARGAYGARGCNACNWSNTGYWSNYTNCAYMGN SNGCNCAYAAYGCNACNCAYGCN ACNTAYACNTGYCAYATGGAYGTNTTYCAYTTYATGGCNGAYGAYATHTTY SNGTNAAYATHACNGAYCARWSNGG NAAYTAY SNCARNNNTGYGGNWSNTTYYTNYTNGCNGAR SNATHAARCCNGCNCCNCCNTTYAAYGTNACNGTNA CNTTYWSNGGNCARTAYAAYNNNWSNTGGMGN SNGAYTAYGARGAYCCNGCNTTYTAYATGYTNAARGGNAARYTN
CARTAYGARYTNCARTAYMGNAAYMGNGGNGAYCCNTGGGCNGTNWSNCCNMGNMGNAARYTNATH SNGTNGAY S NMGNWSNGTNWSNYTNYTNCCNYTNGARTTYMGNAARGAYWSNWSNTAYGARYTNNNNGTNMGNGCNGGNCCNATGC CNGGN SN SNTAYCARGGNACNTGGWSNGARTGGWSNGAYCCNGTNATHTGYCARACNCAR SNGARGARYTNAAR GARGGNTGGAAYCCNCAYYTNYTNYTNYTNYTNYTNYTNGTNATHGTNTTYATHCCNGCNTTYTGG SNYTNAARAC NCAYCCNYTNTGGMGNYTNTGGAARAARATHTGGGCNGTNCCNWSNCCNGARMGNTTYTTYATGCCNYTNTAYAARG GNTGYWSNGGNGAYTTYAARAARTGGGTNGGNGCNCCNTTYACNGGNWSNWSNYTNGARYTNGGNCCNTGGWSNCCN GARGTNCCNWSNACNYTNGARGTNTAY SNTGYCAYCCNCCNMGN SNCCNGCNAARMGNYTNCARYTNACNGARYT NCARGARCCNGCNGARYTNGTNGARWSNGAYGGNGTNCCNAARCCN SNTTYTGGCCNACNGCNCARAAY SNGGNG GNWSNGCNTAYWSNGARGARMGNGAYMGNCCNTAYGGNYTNGTNWSNATHGAYACNGTNACNGTNYTNGAYGCNGAR GGNCCNTGYACNTGGCCNTGYWSNTGYGARGAYGAYGGNTAYCCNGCNYTNGAYYTNGAYGCNGGNYTNGARCCNWS
NCCNGGNYTNGARGAYCCNYTNYTNGAYGCNGGNACNACNGTNYTNWSNTGYGGNTGYGTNWSNGCNGGN SNCCNG GNYTNGGNGGNCCNYTNGGNWSNYTNYTNGAYMGNYTNAARCCNCCNYTNGCNGAYGGNGARGAYTGGGCNGGNGGN YTNCCNTGGGGNGGNMGNWSNCCNGGNGGNGTN SNGARWSNGARGCNGGN SNCCNYTNGCNGGNYTNGAYATGGA YACNTTYGAY SNGGNTTYGTNGGNWSNGAYTGYWSNWSNCCNGTNGARTGYGAYTTYACN SNCCNGGNGAYGARG GNCCNCCNMGN SNTAYYTNMGNCARTGGGTNGTNATHCCNCCNCCNYTN SNWSNCCNGGNCCNCARGCN SN
Nucleic acid sequence comparison of two DCRS3 embodiments:
DCRS3.2 1 ATGCCGCGTGGCTGGGCCGCCCCCTTGCTCCTGCTGCTGCTCCAGGGAGC 50 DCRS3.1 1 ATGCCGCGTGGCTGGGCCGCCCCCTTGCTCCTGCTGCTGCTCCAGGGA-- 49
************************************************
DCRS3.2 51 CCTCGAGGGGATGGAGAGGAAGCTCTGCAGTCCCAAGCCACCCCCCACCA 100 DCRS3.1 49 49 DCRS3.2 101 AGGCCTCTCTCCCCACTGACCCTCCAGGCTGGGGCTGCCCCGACCTCGTC 150 DCRS3.1 50 GCTGGGGCTGCCCCGACCTCGTC 72
***********************
DCRS3.2 151 TGCTACACCGATTACCTCCAGACGGTCATCTGCATCCTGGAAATGTGGAA 200 DCRS3.1 73 TGCTACACCGATTACCTCCAGACGGTCATCTGCATCCTGGAAATGTGGAA 122 ************************************************** DCRS3 . 2 201 CCTCCACCCCAGCACGCTCACCCTTACCTGGATACTTTCTAATAATACTG 250 DCRS3 . 1 123 CCTCCACCCCAGCACGCTCACCCTTACCTGG 153
*******************************
DCRS3.2 251 GGTGCTATATCAAGGACAGAACACTGGACCTCAGGCAAGACCAGTATGAA 300 DCRS3.1 154 CAAGACCAG ATGAA 168
***************
DCRS3.2 301 GAGCTGAAGGACGAGGCCACCTCCTGCAGCCTCCACAGGTCGGCCCACAA 350 DCRS3.1 169 GAGCTGAAGGACGAGGCCACCTCCTGCAGCCTCCACAGGTCGGCCCACAA 218 **************************************************
DCRS3.2 351 TGCCACGCATGCCACCTACACCTGCCACATGGATGTATTCCACTTCATGG 400 DCRS3.1 219 TGCCACGCATGCCACCTACACCTGCCACATGGATGTATTCCACTTCATGG 268
**************************************************
DCRS3.2 401 CCGACGACATTTTCAGTGTCAACATCACAGACCAGTCTGGCAACTACTCC 450 DCRS3.1 269 CCGACGACATTTTCAGTGTCAACATCACAGACCAGTCTGGCAACTACTCC 318
************************************************** DCRS3.2 451 CAGGAGTGTGGCAGCTTTCTCCTGGCTGAGAGCA 484 DCRS3.1 319 CAGGANTGTGGCAGCTTTCTCCTGGCTGAGAGCATCAAGCCGGCTCCCCC 368 ***** ****************************
DCRS3.2 485 GACAGTATAATATCTCCTGGCGCT 508 DCRS3.1 369 TTTCAACGTGACTGTGACCTTCTCAGGACAGTATAATATNTCCTGGCGCT 418
************* **********
DCRS3.2 509 CAGATTACGAAGACCCTGCCTTCTACATGCTGAAGGGCAAGCTTCAGTAT 558 DCRS3.1 419 CAGATTACGAAGACCCTGCCTTCTACATGCTGAAAGGCAAGCTTCAATAT 468 ********************************** *********** ***
DCRS3 . 2 559 GAGCTGCAGTACAGGAACCGGGGAGACCCCTGGGCTGTGAGTCCGAGGAG 608 DCRS3 . 1 469 GAGCTGCAGTACAGGAACCGGGGAGACCCCTGGGCTGTGAGTCCGAGGAG 518
**************************************************
DCRS3 . 2 609 AAAGCTGATCTCAGTGGACTCAAGAAGTGTCTCCCTCCTCCCCCTGGAGT 658 DCRS3 . 1 519 AAAGCTGATCTCAGTGGACTCAAGAAGTGTCTCCCTCCTCCCCCTGGAGT 568
************************************************** DCRS3.2 659 TCCGCAAAGACTCGAGCTATGAGCTGCAGGTGCGGGCAGGGCCCATGCCT 708 DCRS3.1 569 TCCGCAAAGACTCGAGCTATGAGCTGCANGTGCGGGCAGGGCCCATGCCT 618
**************************** *********************
DCRS3.2 709 GGCTCCTCCTACCAGGGGACCTGGAGTGAATGGAGTGACCCGGTCATCTT 758 DCRS3.1 619 GGCTCCTCCTACCAGGGGACCTGGAGTGAATGGAGTGACCCGGTCATCTG 668 ************************************************* DCRS3.2 759 TCAGACCCAGTCAGAGGAGTTAAAGGAAGGCTGGAACCCTCACCTGCTGC 808
DCRS3.1 669 TCAGACCCAGTCAGAGGAGTTAAAGGAAGGCTGGAACCCTCACCTGCTGC 718 **************************************************
DCRS3.2 809 TTCTCCTCCTGCTTGTCATAGTCTTCATTCCTGCCTTCTGGAGCCTGAAG 858
DCRS3.1 719 TTCTCCTCCTGCTTGTCATAGTCTTCATTCCTGCCTTCTGGAGCCTGAAG 768 **************************************************
DCRS3.2 859 ACCCATCCATTGTGGAGGCTATGGAAGAAGATATGGGCCGTCCCCAGCCC 908 DCRS3.1 769 ACCCATCCATTGTGGAGGCTATGGAAGAAGATATGGGCCGTCCCCAGCCC 818 **************************************************
DCRS3.2 909 TGAGCGGTTCTTCATGCCCCTGTACAAGGGCTGCAGCGGAGACTTCAAGA 958 DCRS3.1 819 TGAGCGGTTCTTCATGCCCCTGTACAAGGGCTGCAGCGGAGACTTCAAGA 868
**************************************************
DCRS3.2 959 AATGGGTGGGTGCACCCTTCACTGGCTCCAGCCTGGAGCTGGGACCCTGG 1008 DCRS3.1 869 AATGGGTGGGTGCACCCTTCACTGGCTCCAGCCTGGAGCTGGGACCCTGG 918 **************************************************
DCRS3.2 1009 AGCCCAGAGGTGCCCTCCACCCTGGAGGTGTACAGCTGCCACCCACCACG 1058 DCRS3.1 919 AGCCCAGAGGTGCCCTCCACCCTGGAGGTGTACAGCTGCCACCCACCACG 968 **************************************************
DCRS3.2 1059 GAGCCCGGCCAAGAGGCTGCAGCTCACGGAGCTACAAGAACCAGCAGAGC 1108 DCRS3.1 969 GAGCCCGGCCAAGAGGCTGCAGCTCACGGAGCTACAAGAACCAGCAGAGC 1018 **************************************************
DCRS3.2 1109 TGGTGGAGTCTGACGGTGTGCCCAAGCCCAGCTTCTGGCCGACAGCCCAG 1158
DCRS3.1 1019 TGGTGGAGTCTGACGGTGTGCCCAAGCCCAGCTTCTGGCCGACAGCCCAG 1068 **************************************************
DCRS3.2 1159 AACTCGGGGGGCTCAGCTTACAGTGAGGAGAGGGATCGGCCATACGGCCT 1208 DCRS3.1 1069 AACTCGGGGGGCTCAGCTTACAGTGAGGAGAGGGATCGGCCATACGGCCT 1118
**************************************************
DCRS3.2 1209 GGTGTCCATTGACACAGTGACTGTGCTAGATGCAGAGGGGCCATGCACCT 1258
DCRS3.1 1119 GGTGTCCATTGACACAGTGACTGTGCTAGATGCAGAGGGGCCATGCACCT 1168 **************************************************
DCRS3.2 1259 GGCCCTGCAGCTGTGAGGATGACGGCTACCCAGCCCTGGACCTGGATGCT 1308
DCRS3.1 1169 GGCCCTGCAGCTGTGAGGATGACGGCTACCCAGCCCTGGACCTGGATGCT 1218 **************************************************
DCRS3.2 1309 GGCCTGGAGCCCAGCCCAGGCCTAGAGGACCCACTCTTGGATGCAGGGAC 1358
DCRS3.1 1219 GGCCTGGAGCCCAGCCCAGGCCTAGAGGACCCACTCTTGGATGCAGGGAC 1268 ************************************************** DCRS3.2 1359 CACAGTCCTGTCCTGTGGCTGTGTCTCAGCTGGCAGCCCTGGGCTAGGAG 1408
DCRS3.1 1269 CACAGTCCTGTCCTGTGGCTGTGTCTCAGCTGGCAGCCCTGGGCTAGGAG 1318 **************************************************
DCRS3.2 1409 GGCCCCTGGGAAGCCTCCTGGACAGACTAAAGCCACCCCTTGCAGATGGG 1458 DCRS3.1 1319 GGCCCCTGGGAAGCCTCCTGGACAGACTAAAGCCACCCCTTGCAGATGGG 1368
************************************************** DCRS3.2 1459 GAGGACTGGGCTGGGGGACTGCCCTGGGGTGGCCGGTCACCTGGAGGGGT 1508 DCRS3.1 1369 GAGGACTGGGCTGGGGGACTGCCCTGGGGTGGCCGGTCACCTGGAGGGGT 1418 **************************************************
DCRS3.2 1509 CTCAGAGAGTGAGGCGGGCTCACCCCTGGCCGGCCTGGATATGGACACGT 1558 DCRS3.1 1419 CTCAGAGAGTGAGGCGGGCTCACCCCTGGCCGGCCTGGATATGGACACGT 1468 ************************************************** DCRS3.2 1559 TTGACAGTGGCTTTGTGGGCTCTGACTGCAGCAGCCCTGTGGAGTGTGAC 1608 DCRS3.1 1469 TTGACAGTGGCTTTGTGGGCTCTGACTGCAGCAGCCCTGTGGAGTGTGAC 1518 **************************************************
DCRS3.2 1609 TTCACCAGCCCCGGGGACGAAGGACCCCCCCGGAGCTACCTCCGCCAGTG 1658 DCRS3.1 1519 TTCACCAGCCCCGGGGACGAAGGACCCCCCCGGAGCTACCTCCGCCAGTG 1568
**************************************************
DCRS3.2 1659 GGTGGTCATTCCTCCGCCACTTTCGAGCCCTGGACCCCAGGCCAGCTAA 1707 DCRS3.1 1569 GGTGGTCATTCCTCCGCCACTTTCGAGCCCTGGACCCCAGGCCAGCTAA 1617 *************************************************
Table 3 : Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiment 4 (DCRS4.1; cytor) . Primate, e.g., human embodiment (see SEQ ID NO: 4 and 5) . Predicted signal sequence indicated, but may vary by a few positions and depending upon cell type. atg atg cct aaa cat tgc ttt eta ggc ttc etc ate agt ttc ttc ctt 48
Met Met Pro Lys His Cys Phe Leu Gly Phe Leu He Ser Phe Phe Leu
-20 -15 -10 act ggt gta gca gga act cag tea acg cat gag tct ctg aag cct cag 96
Thr Gly Val Ala Gly Thr Gin Ser Thr His Glu Ser Leu Lys Pro Gin -5 -1 1 5 10 agg gta caa ttt cag tec cga aat ttt cac aac att ttg caa tgg cag 144
Arg Val Gin Phe Gin Ser Arg Asn Phe His Asn He Leu Gin Trp Gin 15 20 25 cct ggg agg gca ctt act ggc aac age agt gtc tat ttt gtg cag tac 192 Pro Gly Arg Ala Leu Thr Gly Asn Ser Ser Val Tyr Phe Val Gin Tyr
30 35 40 aaa ata tat gga cag aga caa tgg aaa aat aaa gaa gac tgt tgg ggt 240 Lys He Tyr Gly Gin Arg Gin Trp Lys Asn Lys Glu Asp Cys Trp Gly 45 50 55 act caa gaa etc tct tgt gac ctt ace agt gaa ace tea gac ata cag 288
Thr Gin Glu Leu Ser Cys Asp Leu Thr Ser Glu Thr Ser Asp He Gin
60 65 70 75 gaa cct tat tac ggg agg agg ggc aaa aat aaa aat aaa ggg aat cct 336
Glu Pro Tyr Tyr Gly Arg Arg Gly Lys Asn Lys Asn Lys Gly Asn Pro 80 85 90 tgg ggg cca aaa caa agt aaa egg aaa tea aag ggg aac cag aag ace 384 Trp Gly Pro Lys Gin Ser Lys Arg Lys Ser Lys Gly Asn Gin Lys Thr 95 100 105 aac aca gtg act gcc cca get gcc ctg aag gca ttt get gga tgt gca 432 Asn Thr Val Thr Ala Pro Ala Ala Leu Lys Ala Phe Ala Gly Cys Ala 110 115 120 aaa ata gat cct cca gtc atg aat ata ace caa gtc aat ggc tct ttg 480 Lys He Asp Pro Pro Val Met Asn He Thr Gin Val Asn Gly Ser Leu 125 130 135 ttg gta att etc cat get cca aat tta cca tat aga tac caa aag gaa 528 Leu Val He Leu His Ala Pro Asn Leu Pro Tyr Arg Tyr Gin Lys Glu 140 145 150 155 aaa aat gta tct ata gaa gat tac tat gaa eta eta tac cga gtt ttt 576 Lys Asn Val Ser He Glu Asp Tyr Tyr Glu Leu Leu Tyr Arg Val Phe
160 165 170 ata att aac aat tea eta gaa aag gag caa aag gtt tat gaa ggg get 624 He He Asn Asn Ser Leu Glu Lys Glu Gin Lys Val Tyr Glu Gly Ala 175 180 185 cac aga gcg gtt gaa att gaa get eta aca cca cac tec age tac tgt 672 His Arg Ala Val Glu He Glu Ala Leu Thr Pro His Ser Ser Tyr Cys 190 195 200 gta gtg get gaa ata tat cag ccc atg tta gac aga aga agt cag aga 720 Val Val Ala Glu He Tyr Gin Pro Met Leu Asp Arg Arg Ser Gin Arg 205 210 215 agt gaa gag aga tgt gtg gaa att cca tga 750
Ser Glu Glu Arg Cys Val Glu He Pro 220 225
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQ KNKED CWGTQELSCDLTSETSDIQEPYYGRRGKNKNKGNPWGPKQSKRKSKGNQKTNTVTAPAALKAFAGCAKIDPPVMNIT QVNGSLLVILHAPNLPYRYQKΕKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQ PMLDRRSQRSEERCVEIP .
Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiments (DCRS4.2, cytorX700; SEQ ID NO: 27 and 28):
ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTCTTCCTTACTGGTGTAGCAGGAACTCAGTCAACGCA TGAGTCTCTGAAGCCTCAGAGGGTACAATTTCAGTCCCGAAATTTTCACAACATTTTGCAATGGCAGCCCGGGAGGG CACTTACTGGCAACAGCAGTGTCTATTTTGTGCAGTACAAAATATATGGACAGAGACAATGGAAAAATAAAGAAGAC TGTTGGGGTACTCAAGAACTCTCTTGTGACCTTACCAGTGAAACCTCAGACATACAGGAACCTTATTACGGGAGGGT GAGGGCGGCCTCGGCTGGGAGCTACTCAGAATGGAGCATGACGCCGCGGTTCACTCCCTGGTGGGAAACAAAAATAG ATCCTCCAGTCATGAATATAACCCAAGTCAATGGCTCTTTGTTGGTAATTCTCCATGCTCCAAATTTACCATATAGA TACCAAAAGGAAAAAAATGTATCTATAGAAGATTACTATGAACTACTATACCGAGTTTTTATAATTAACAATTCACT AGAAAAGGAGCAAAAGGTTTATGAAGGGGCTCACAGAGCGGTTGAAATTGAAGCTCTAACACCACACTCCAGCTACT GTGTAGTGGCTGAAATATATCAGCCCATGTTAGACAGAAGAAGTCAGAGAAGTGAAGAGAGATGTGTGGAAATTCCA TGA atg atg cct aaa cat tgc ttt eta ggc ttc etc ate agt ttc ttc ctt 48 Met Met Pro Lys His Cys Phe Leu Gly Phe Leu He Ser Phe Phe Leu -20 -15 -10 act ggt gta gca gga act cag tea acg cat gag tct ctg aag cct cag 96 Thr Gly Val Ala Gly Thr Gin Ser Thr His Glu Ser Leu Lys Pro Gin -5 -1 1 5 10 agg gta caa ttt cag tec cga aat ttt cac aac att ttg caa tgg cag 144 Arg Val Gin Phe Gin Ser Arg Asn Phe His Asn He Leu Gin Trp Gin 15 20 25 ccc ggg agg gca ctt act ggc aac age agt gtc tat ttt gtg cag tac 192 Pro Gly Arg Ala Leu Thr Gly Asn Ser Ser Val Tyr Phe Val Gin Tyr 30 35 40 aaa ata tat gga cag aga caa tgg aaa aat aaa gaa gac tgt tgg ggt 240 Lys He Tyr Gly Gin Arg Gin Trp Lys Asn Lys Glu Asp Cys Trp Gly 45 50 55 act caa gaa etc tct tgt gac ctt ace agt gaa ace tea gac ata cag 288 Thr Gin Glu Leu Ser Cys Asp Leu Thr Ser Glu Thr Ser Asp He Gin 60 65 70 75 gaa cct tat tac ggg agg gtg agg gcg gcc teg get ggg age tac tea 336
Glu Pro Tyr Tyr Gly Arg Val Arg Ala Ala Ser Ala Gly Ser Tyr Ser
80 85 90 gaa tgg age atg acg ccg egg ttc act ccc tgg tgg gaa aca aaa ata 384
Glu Trp Ser Met Thr Pro Arg Phe Thr Pro Trp Trp Glu Thr Lys He
95 100 105 gat cct cca gtc atg aat ata ace caa gtc aat ggc tct ttg ttg gta 432
Asp Pro Pro Val Met Asn He Thr Gin Val Asn Gly Ser Leu Leu Val 110 115 120 att etc cat get cca aat tta cca tat aga tac caa aag gaa aaa aat 480 He Leu His Ala Pro Asn Leu Pro Tyr Arg Tyr Gin Lys Glu Lys Asn
125 130 135 gta tct ata gaa gat tac tat gaa eta eta tac cga gtt ttt ata att 528 Val Ser He Glu Asp Tyr Tyr Glu Leu Leu Tyr Arg Val Phe He He 140 145 150 155
aac aat tea eta gaa aag gag caa aag gtt tat gaa ggg get cac aga 576 Asn Asn Ser Leu Glu Lys Glu Gin Lys Val Tyr Glu Gly Ala His Arg 160 165 170 gcg gtt gaa att gaa get eta aca cca cac tec age tac tgt gta gtg 624
Ala Val Glu He Glu Ala Leu Thr Pro His Ser Ser Tyr Cys Val Val
175 180 185 get gaa ata tat cag ccc atg tta gac aga aga agt cag aga agt gaa 672
Ala Glu He Tyr Gin Pro Met Leu Asp Arg Arg Ser Gin Arg Ser Glu
190 195 200 gag aga tgt gtg gaa att cca tga 696
Glu Arg Cys Val Glu He Pro 205 210
>cytorX700 MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQ QPGRALTGNSSVYFVQYKIYGQRQWKNKED CWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYR YQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCWAEIYQPMLDRRSQRSEERCVEIP Nucleotide and polypeptide sequences of DNAX Cytokine Receptor Subunit like embodiments (DCRS4.3 cytorX600; SEQ ID NO: 30 and 31):
ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTTTTCCTTACTGGTGTAGCAGGAACTCAGTCAACGCA TGAGTCTCTGAAGCCTCAGAGGGTACAATTTCAGTCCCGAAATTTTCACAACATTTTGCAATGGCAGCCTGGGAGGG CACTTACTGGCAACAGCAGTGTCTATTTTGTGCAGTACAAAATATATGGACAGAGACAATGGAAAAATAAAGAAGAC TGTTGGGGTACTCAAGAACTCTCTTGTGACCTTACCAGTGAAACCTCAGACATACAGGAATCTTATTACGGGAGGGT GAGGGCGGCCTCGGCTGGGAGCTACTCAGAATGGAGCATGACGCCGCGGTTCACTCCCTGGTGGGAAAGAGCAAAAG GTTTATGAAGGGGCTCACAGAGCGGTTGAAATTGAAGCTCTAACACCACACTCCAGCTACTGTGTAGTGGCTGAAAT ATATCAGCCCACGTTAGACAGAAGAAGTCAGAGAAGTGAAGAGAGATGTGTGGAAATTCCATGA atg atg cct aaa cat tgc ttt eta ggc ttc etc ate agt ttt ttc ctt 48
Met Met Pro Lys His Cys Phe Leu Gly Phe Leu He Ser Phe Phe Leu
-20 -15 -10 act ggt gta gca gga act cag tea acg cat gag tct ctg aag cct cag 96
Thr Gly Val Ala Gly Thr Gin Ser Thr His Glu Ser Leu Lys Pro Gin
-5 -1 1 5 10 agg gta caa ttt cag tec cga aat ttt cac aac att ttg caa tgg cag 144 Arg Val Gin Phe Gin Ser Arg Asn Phe His Asn He Leu Gin Trp Gin 15 20 25 cct ggg agg gca ctt act ggc aac age agt gtc tat ttt gtg cag tac 192 Pro Gly Arg Ala Leu Thr Gly Asn Ser Ser Val Tyr Phe Val Gin Tyr 30 35 40 aaa ata tat gga cag aga caa tgg aaa aat aaa gaa gac tgt tgg ggt 240 Lys He Tyr Gly Gin Arg Gin Trp Lys Asn Lys Glu Asp Cys Trp Gly 45 50 55 act caa gaa etc tct tgt gac ctt ace agt gaa ace tea gac ata cag 288
Thr Gin Glu Leu Ser Cys Asp Leu Thr Ser Glu Thr Ser Asp He Gin
60 65 70 75 gaa tct tat tac ggg agg gtg agg gcg gcc teg get ggg age tac tea 336
Glu Ser Tyr Tyr Gly Arg Val Arg Ala Ala Ser Ala Gly Ser Tyr Ser
80 85 90 gaa tgg age atg acg ccg egg ttc act ccc tgg tgg gaa aga gca aaa 384 Glu Trp Ser Met Thr Pro Arg Phe Thr Pro Trp Trp Glu Arg Ala Lys 95 100 105 ggt tta tgaaggggct cacagagcgg ttgaaattga agctctaaca ccacactcca 440 Gly Leu gctactgtgt agtggctgaa atatatcagc ccacgttaga cagaagaagt cagagaagtg 500 aagagagatg tgtggaaatt ccatga 526
>cytorX600
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQ QPGRALTGNSSVYFVQYKIYGQRQWKNKED C GTQELSCDLTSETSDIQESYYGRVRAASAGSYSEWSMTPRFTPW ERAKGL. Polypeptide sequence comparison of DCRS4.1, DCRS4.2 and DCRS4.3 : DCRS4.1 1 MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPG 50
DCRS4.2 1 MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQ QPG 50
DCRS4.3 1 MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPG 50 **************************************************
DCRS4.1 51 RALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYY 100
DCRS4.2 51 RALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYY 100
DCRS4.3 51 RALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQESYY 100 *********************************************** **
DCRS4.1 101 GR-RGKNKNKGNP GPKQSKRKSKGNQKTNTVTAPAALKAFAGCAKIDPP 149
DCRS4.2 101 GRVRAASAGSYSE S--MTPRFTP WWETKIDPP 131
DCRS4.3 101 GRVRAASAGSYSEWS--MTPRFTP WWE 119 * ** * * . *
DCRS4.1 150 VMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLE 199
DCRS4.2 132 VMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLE 181
DCRS4.3 123 RAKGL 130 .. *..
DCRS4.1 200 KEQKVYEGAHRAVEIEALTPHSSYCWAEIYQPMLDRRSQRSEERCVEIP 249
DCRS4.2 182 KEQKVYEGAHRAVEIEALTPHSSYCWAEIYQPMLDRRSQRSEERCVEIP 231
DCRS4.3 131 130
Table 4: Reverse Translation of primate, e.g., human, DCRS4.1 (SEQ ID NO: 6). N may be A, C, G, or T. ATGATGCCNAARCAYTGYTTYYTNGGNTTYYTNATHWSNTTYTTYYTNACNGGNGTNGCNGGNACNCARWSNACNCA YGARWSNYTNAARCCNCARMGNGTNCARTTYCARWSNMGNAAYTTYCAYAAYATHYTNCARTGGCARCCNGGNMGNG CNYTNACNGGNAAY SN SNGTNTAYTTYGTNCARTAYAARATHTAYGGNCARMGNCARTGGAARAAYAARGARGAY TGYTGGGGNACNCARGARYTNWSNTGYGAYYTNACNWSNGARACNWSNGAYATHCARGARCCNTAYTAYGGNMGNMG NGGNAARAAYAARAAYAARGGNAAYCCNTGGGGNCCNAARCARWSNAARMGNAAR SNAARGGNAAYCARAARACNA AYACNGTNACNGCNCCNGCNGCNYTNAARGCNTTYGCNGGNTGYGCNAARATHGAYCCNCCNGTNATGAAYATHA.CN
CARGTNAAYGGN SNYTNYTNGTNATHYTNCAYGCNCCNAAYYTNCCNTAYMGNTAYCARAARGARAARAAYGTN S NATHGARGAYTAYTAYGARYTNYTNTAYMGNGTNTTYATHATHAAYAAY SNYTNGARAARGARCARAARGTNTAYG ARGGNGCNCAYMGNGCNGTNGARATHGARGCNYTNACNCCNCAY SNWSNTAYTGYGTNGTNGCNGARATHTAYCAR CCNATGYTNGAYMGNMGNWSNCARMGN SNGARGARMGNTGYGTNGARATHCCN
Reverse Translation of primate, e.g., human, DCRS4.2 (SEQ ID NO: 29). N may be A, C, G, or T. ATGATGCCNAARCAYTGYTTYYTNGGNTTYYTNATHWSNTTYTTYYTNACNGGNGTNGCNGGNACNCARWSNACNCA
YGARWSNYTNAARCCNCARMGNGTNCARTTYCARWSNMGNAAYTTYCAYAAYATHYTNCARTGGCARCCNGGNMGNG CNYTNACNGGNAAYWSNWSNGTNTAYTTYGTNCARTAYAARATHTAYGGNCARMGNCARTGGAARAAYAARGARGAY TGYTGGGGNACNCARGARYTN SNTGYGAYYTNACN SNGARACNWSNGAYATHCARGARCCNTAYTAYGGNMGNGT NMGNGCNGCNWSNGCNGGNWSNTAY SNGARTGGWSNATGACNCCNMGNTTYACNCCNTGGTGGGARACNAARATHG AYCCNCCNGTNATGAAYATHACNCARGTNAAYGGN SNYTNYTNGTNATHYTNCAYGCNCCNAAYYTNCCNTAYMGN TAYCARAARGARAARAAYGTN SNATHGARGAYTAYTAYGARYTNYTNTAYMGNGTNTTYATHATHAAYAAY SNYT NGARAARGARCARAARGTNTAYGARGGNGCNCAYMGNGCNGTNGARATHGARGCNYTNACNCCNCAY SNWSNTAYT GYGTNGTNGCNGARATHTAYCARCCNATGYTNGAYMGNMGN SNCARMGNWSNGARGARMGNTGYGTNGARATHCCN Reverse Translation of primate, e.g., human, DCRS4.3 (SEQ ID NO : 32) . N may be A, C, G, or T.
ATGATGCCNAARCAYTGYTTYYTNGGNTTYYTNATHWSNTTYTTYYTNACNGGNGTNGCNGGNACNCARWSNACNCA
YGARWSNYTNAARCCNCARMGNGTNCARTTYCAR SNMGNAAYTTYCAYAAYATHYTNCARTGGCARCCNGGNMGNG CNYTNACNGGNAAYWSNWSNGTNTAYTTYGTNCARTAYAARATHTAYGGNCARMGNCARTGGAARAAYAARGARGAY TGYTGGGGNACNCARGARYTNWSNTGYGAYYTNACNWSNGARACNWSNGAYATHCARGARWSNTAYTAYGGNMGNGT NMGNGCNGCNWSNGCNGGNWSNTAYWSNGARTGGWSNATGACNCCNMGNTTYACNCCNTGGTGGGARMGNGCNAARG GNYTN
5 Nucleic acid sequence comparison of three DCRS4 embodiments :
DCRS4.1 1 ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTCTTCCTTAC 50
DCRS4.2 1 ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTCTTCCTTAC 50
DCRS4.3 1 ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTTTTCCTTAC 50
]_ o ***************************************** ********
DCRS4.1 51 TGGTGTAGCAGGAACTCAGTCAACGCATGAGTCTCTGAAGCCTCAGAGGG 100
DCRS4.2 51 TGGTGTAGCAGGAACTCAGTCAACGCATGAGTCTCTGAAGCCTCAGAGGG 100
DCRS4.3 51 TGGTGTAGCAGGAACTCAGTCAACGCATGAGTCTCTGAAGCCTCAGAGGG 100
15 * **************************************************
DCRS4.1 101 TACAATTTCAGTCCCGAAATTTTCACAACATTTTGCAATGGCAGCCTGGG 150
DCRS4.2 101 TACAATTTCAGTCCCGAAATTTTCACAACATTTTGCAATGGCAGCCCGGG 150
DCRS4.3 101 TACAATTTCAGTCCCGAAATTTTCACAACATTTTGCAATGGCAGCCTGGG 150
20 ********************************************** ***
DCRS4.1 151 AGGGCACTTACTGGCAACAGCAGTGTCTATTTTGTGCAGTACAAAATATA 200
DCRS4.2 151 AGGGCACTTACTGGCAACAGCAGTGTCTATTTTGTGCAGTACAAAATATA 200
DCRS4.3 151 AGGGCACTTACTGGCAACAGCAGTGTCTATTTTGTGCAGTACAAAATATA 200
25 **************************************************
DCRS4.1 201 TGGACAGAGACAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAAC 250
DCRS4.2 201 TGGACAGAGACAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAAC 250
DCRS4.3 201 TGGACAGAGACAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAAC 250
30 **************************************************
DCRS4.1 251 TCTCTTGTGACCTTACCAGTGAAACCTCAGACATACAGGAACCTTATTAC 300
DCRS4.2 251 TCTCTTGTGACCTTACCAGTGAAACCTCAGACATACAGGAACCTTATTAC 300
DCRS4.3 251 TCTCTTGTGACCTTACCAGTGAAACCTCAGACATACAGGAATCTTATTAC 300
35 ***************************************** ********
DCRS4.1 301 GGGAGGAGGGGCAAAAATAAAAATAAAGGGAATCCTTGGGGGCCAAAACA 350
DCRS4.2 301 GGGAGGGTG AGGGCGGCCTCGGC 323
DCRS4.3 301 GGGAGGGTG AGGGCGGCCTCGGC 323 0 ****** * **** *** **
DCRS4.1 351 AAGTAAACGGAAATCAAAGGGGAACCAGAAGACCAACACAGTGACTGCCC 400
DCRS4.2 324 TGGGAGCTACTCAGAATGGAGCATGA CGCCGCGGTTCACT 363
DCRS4.3 324 TGGGAGCTACTCAGAATGGAGCATGA CGCCGCGGTTCACT 363 5 * * * *** * *** * ** * * * * * *
DCRS4.1 401 CAGCTGCCCTGAAGGCATTTGCTGGATGTGCAAAAATAGATCCTCCAGTC 450
DCRS4.2 364 C CCTGGTGGGAA ACAAAAATAGATCCTCCAGTC 396
DCRS4.3 364 C CCTGGTGGGAAAGAGCAAAAGGTTTATGAAGGGGCTCACAGA- 406
50 * **** ** * * * * * ***
DCRS4.1 451 ATGAATATAACCCAAGTC- -AATGGCTCTTTGTTGGTAATTCTCCATGCT 498
DCRS4.2 397 ATGAATATAACCCAAGTC- -AATGGCTCTTTGTTGGTAATTCTCCATGCT 444
DCRS4.3 407 GCGGTTGAAATTGAAGCTCTAACACCACACTCCAGCTACTGTGTAGTGGC 456
55 * * ** *** ** * * * * ** * ** DCRS4.1 499 CCAAATTTACCATATAGATACCAAAAGGAAAAAAATGTATCTATAGAAGA 548 DCRS4.2 445 CCAAATTTACCATATAGATACCAAAAGGAAAAAAATGTATCTATAGAAGA 494 DCRS4.3 457 TGAAATATATCA-GCCCACGTTAGACAGAAGAAGTCAGAGAAGT-GAAGA 504
**** ** ** *** ** *****
DCRS4.1 549 TTACTATGAACTACTATACCGAGTTTTTATAATTAACAATTCACTAGAAA 598 DCRS4.2 495 TTACTATGAACTACTATACCGAGTTTTTATAATTAACAATTCACTAGAAA 544 DCRS4.3 505 GAGATGTGTGGAAATTCCATGA 526
DCRS4.1 599 AGGAGCAAAAGGTTTATGAAGGGGCTCACAGAGCGGTTGAAATTGAAGCT 648 DCRS4.2 545 AGGAGCAAAAGGTTTATGAAGGGGCTCACAGAGCGGTTGAAATTGAAGCT 594 DCRS4.3 527 526 -
DCRS4.1 649 CTAACACCACACTCCAGCTACTGTGTAGTGGCTGAAATATATCAGCCCAT 698 DCRS4.2 595 CTAACACCACACTCCAGCTACTGTGTAGTGGCTGAAATATATCAGCCCAT 644 DCRS4.3 527 526
DCRS4.1 699 GTTAGACAGAAGAAGTCAGAGAAGTGAAGAGAGATGTGTGGAAATTCCAT 748 DCRS4.2 645 GTTAGACAGAAGAAGTCAGAGAAGTGAAGAGAGATGTGTGGAAATTCCAT 694 DCRS4.3 527 526
DCRS4.1 749 GA 750 DCRS4.2 695 GA 696 DCRS4.3 527 526
Table 5: Alignment of various cytokine receptor subunits with DCRS3.1. IL-2R is SEQ ID NO: 7; IL-9R is SEQ ID NO: 8; GM/IL-3/5 receptor b subunit common (ILRbc) is SEQ ID NO: 9; TPOR is SEQ ID NO: 10; and IL-7R is SEQ ID NO: 11 (see GenBank) .
IL-2R_HU VNG- -TSQFTC FYNSRANISCVWSQ-DGALQDTSCQVHAWPDRRR N QTC
DCRS3_HU LCS--PKPPPT KASLPTDPPGWGC-PDLVCYTDYLQTVICILEM N- -LHP- -STL
IL- 9R_HU ICI C-TC VCLGVSVTGEGQGPRSRTFTCLTNNILRIDCH S APELGQG ILRbc_HU ILTPNGNEDTTADFFLTTMPTDSLSVST-LPLPEVQCFVFNVEYMNCT NSSSEPQPTNL
TPOR_HU LLASDSEPLKC FSRTFEDLTCFWDE-EEAAPSGTYQLLYAYPREKPR- -ACP- -LSS
IL-7R HU VSGESGYAQNG DLEDAELDDYSFSC-YSQLEVNGSQHSLTCAFEDPD VN
IL-2R_HU ELLPVSQAΞWACN LILG APDS- -QKLTTVD IV
DCRS3_HU TLTWILSNNTGCYIKDR TLDLRQ-DQYE- -ELKDEA-TSCSLHR SAHNAT
IL- 9R_HU SSPWLLFTSNQAPG G-THKCILR- -GSECTWLPPE- -AVLVPSD NFT
ILRbc_HU TLHY YKNSDNDK VQKCSHY LFSEEITSGCQLQK-K EIHLYQ
TPOR_HU QSMPHFGTRYVCQFPDQ--EEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSII IL-7R HU TTNLEFEICGALV EVKCLNFR KLQEIYFIETKKFL LI
IL-2R_HU TLRVLCREGVRWRV MAIQDFKPFENLRLMAPISLQV VHVETHRCNIS WEI
DCRS3_HU HATYTCHMDVFHF MADDIFS- -VNITDQSGNYSQECGSFLLAESRQYNIS WRS IL-9R_HU ITFHHCMSGREQVS LVDPEYLPRRHVKLDPPSDLQS NISSGHCILT WSI
ILRbc_HU TFWQLQDPREPRR QATQMLKLQNLVIPWAPENLTL HKLSESQLELN WNN
TPOR_HU KAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNS TGPTVIQLIATETCCPA
IL-7R HU GKSNICVK-VGEKS LTCKKIDLTTIVKPEAPFDLSVI YREGANDFWT FNT IL-2R_HU SQASHYFERHLE FEARTLSPGHTWEEAPLLTLK- - ■--QKQEWICLETLT-PDTQ
DCRS3_HU DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRK IS- • -VDSRSVSLLPLEFRKDSS
IL-9R_HU SPALEPMTTLLS YELAFKKQEEAWEQAQHRDHIV- • -G-VTWLILEAFELDPGFI
ILRbc_HU RFLNHCLEHLV QYRTD WDHSWTEQSV- - ■ -DYRHKFSLPSVDGQKRYT
TPOR_HU LQRPHSASALD QSPCAQPTMPWQDGPKQTSPSREASALTAEGGSCLISGLQPGNS
IL-7R HU SHLQKKYVKVLMHD-VAYRQEKDENKWTHVNLSST KLTLLQRK- -LQPAAM
IL-2R_HU YEFQVRVKPLQGEFT TWSPWSQPLAFRTKPAALG
DCRS3_HU YELQVRAGPMPGSSYQG TWSEWSDPVIFQTQSEELK
IL- 9R_HU HEARLRVQMATLEDDWEEERYTGQWSEWSQPVCFQAPQRQGP
ILRbc_HU FRVRSRFNPLCGSAQ HWSEWSHPIHWGΞNTSKEN
TPOR_HU YWLQLRSEPDGISLGG SWGSWSLPVTVDLPGDAVA IL-7R HU YEIKVRSIPDHYFKG FWSEWSPSYYFRTPEINNS
Alignment of various cytokine receptor subunits with DCRS4.1. IL-lORb is the beta subunit of IL-10R, human is SEQ ID NO: 12, mouse is SEQ ID NO: 13; INaRl is the beta subunit of IFNa with human SEQ ID NO: 14 and mouse SEQ ID NO: 15; INgR is interferon gamma receptor subunit alpha with human SEQ ID NO: 16 and mouse SEQ ID NO: 17; IL-lORa is the alpha receptor subunit with mouse SEQ ID NO: 18 and human SEQ ID NO: 19; INgS (SEQ ID NO: 20) is the beta receptor subunit for INFg; Zcytor7 (SEQ ID NO: 21) and CYTOR11 (SEQ ID NO: 22) are from patent filings from Zymogenetics, and INaR2 (SEQ ID NO: 23) is the beta subunit of the receptor for IFNa.
IL-10Rb_Hu PENVRMNSVNFKNILQWES-PAFAKGNL- -TFTAQYLSY RIFQDKCMNTTL IL-10Rb_Mu PEKVRMNSVNFKNILQWEV-PAFPKTNL- -TFTAQYESY RSFQDHCKRTAS
INaRl_HU PQKVEVDIIDDNFILRWNR-SDESVGNV--TFSFDYQKTGMD NWIKLSGCQNITS
INaRl_MU PENIDVYIIDDNYTLKWΞS-HGEΞMGSV- -TFSAEYRTKDEA KWLKVPECQHTTT
INgR_HU PTNVTIESYNMNPIVYWEY-QIMPQVP VFTVEVKNYGVK NSEWIDACINISH
INgR_MU PTNVLIKSYNLNPWCWEY-QNMSQTP IFTVQVKVY SGSWTDSCTNISD IL-10Ra_Mu PSYVWFEARFFQHILHWKP- IPNQSEST- -YYEVALKQYGNS TWNDIHICRKAQA
IL-10Ra_Hu PPSVWFEAEFFHHILHWTP- IPNQSEST- -CYEVALLRYGIE SWNSISNC- -SQT
INgS_HU PLNPRLHLYNDEQILTWEP-SPSSNDPRPWYQVEYSFIDGΞW HRLLEPNCTDITE
Zcytor7_Hu PANITFLSINMKNVLQWTPPEGLQGVKV- -TYTVQYFIYGQK KWLNKSECRNINR
CYTORll_HU LQHVKFQSSNFENILTWDΞ-GPEGTPDT--VYΞIEYKTYGER DWVAKKGCQRITR INaR2_HU SCTFKISLRNFRSILSWEL-KNHSIVPTHYTLLYTIMSKPE DLKWKNCANTTR
DCRS4.1 HU PQRVQFQSRNFHNILQWQPGRALTGNSS- -VYFVQYKIYGQR QWKNKEDCWGTQE
IL-10Rb_Hu TECDFSSLSK YGDHTLRVRAEFADEHSDWVNIT-FCPVDDTIIGPPG- -MQVEV IL-10Rb_Mu TQCDFSHLSK YGDYTVRVRAELADEHSEWVNVT-FCPVEDTIIGPPE- -MQIES
INaRl_HU TKCNFSSLKLN VYEEIKLRIRAEKEN-TSSWYEVDSFTPFRKAQIGPPE- -VHLEA
INaRl_MU TKCEFSLLDTN VYIKTQFRVRAEEGNSTSS NEVDPFIPFYTAHMSPPE- -VRLEA
INgR_HU HYCNISDHVGDP SNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIR-KE
INgR_MU HCCNIYGQIMYP DVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKK IL-10Ra_Mu LSCDLTTFTLDLYHR-SYGYRARVRAVDNSQYSNWTTTETRFTVDEVILTVDS- -VTLKA
IL-10Ra_Hu LSYDLTAVTLDLYH--SNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGS--VNLEI
INgS_HU TKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSKWVGLEPFQHYENVTVGPPKN-ISVTP
Zcytor7_Hu TYCDLSAETSDY EHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPE- -VALTT
CYTORll_HU KSCNLTVETGN LTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDV-TCISK INaR2_HU SFCDLTDEWRS THEAYVTVLEGFSGNTTLFSCSHNFWLAIDMSFEPPE- -FEIVG
DCRS4.1 HU LSCDLTSETSD IQEPYYGRRGKNKNKGNPWGPKQSKRKSKGNQKTNTVT-APAAL IL-10Rb_Hu LADSLHMRFLAPKIENEYE TWTMKNVYNSWTYNVQYWKNGTDEKFQ-ITPQYDFEVL
IL-10Rb_Mu LAESLHLRFSAPQIENEPE TWTLKNIYDSWAYRVQYWKNGTNEKFQ-WSPYDSEVL
INaRl_HU EDKAIVIHISPGTKDSV MWALD- -GLSFTYSLLIWKNSSGVEER-IENIYSRHKI
INaRl_MU EDKAILVHISPPGQDGN MWALE- -KPSFSYTIRIWQKSSSDKKT- INSTYYVEKI
INgR_HU EKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGS-EIQY-KILTQKEDDC
INgR_MU EEQLSVLVFHPEVWNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILH-TKHTVEKEEC
IL-10Ra_Mu MDGIIYGTIHPPRPTITPA- -GDEYEQVFKDLRVYKISIRKFS- -ELKN-ATKRVKQETF
IL-10Ra_Hu HNGFILGKIQLPRPKMAPA--NDTYESIFSHFREYEIAIRKVPG-NFTF-THKKVKHENF
INgS_HU GKGSLVIHFSPPFDVFHG ATFQYLVHYWEKSETQQEQ-VEGPFKSNSI
Zcytor7_Hu DEKSISWLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWS-QCVTNHTLVL
CYT0R11_HU VRSIQMIVHPTPTPIRAGDG-HRLTLEDIFHDLFYHLELQVNRTYQMHL-GGKQREYEFF
INaR2_HU FTNHINVMVKFPSIVEEEL Q FDLSLVIEEQSEGIVKKHKPEIKGNMSGNF
DCRS4.1 HU KAFAGCAKIDPPVMNITQ VNGSLLVILHAPNLPYRYQ-KEKNVSIEDY -
IL-10Rb_Hu RN LEPWTTYCVQVRGFLPDRN KAGEWSEPVCEQ
IL-10Rb_Mu RN LEPWTTYCIQVQGFLLDQN RTGEWSEPICER
INaRl_HU YK LSPETTYCLKVKAALLTSW KIGVYSPVHCIK
INaRl_MU PE LLPETTYCLEVKAIHPSLK KHSNYSTVQCIS
INgR_HU DEIQCQLAI PVSSLNSQYCVSAEGVLH G VTTEKSKEVCIT
INgR_MU NETLCELNI SVSTLDSRYCISVDGISSFWQ VRTEKSKDVCIP
IL-10Ra_Mu TLT VPIGVRKFCVKVLPRLESRI NKAEWSEEQCLL
IL-10Ra_Hu S L TSGEVGEFCVQVKPSVASRS NKGMWSKEECIS
INgS_HU VLG NLKPYRVYCLQTEAQLILKNKK IRPHGLLSNVSCHE
Zcytor7_Hu TW LEPNTLYCVHVESFVPGPP RRAQPSEKQCAR
CYTORll_HU GLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYL
INaR2_HU TYIID KLIPNTNYCVSVYLEHSDEQ AVIKSPLKCTL
DCRS4.1 HU γE LLYRVFIINNSLE KEQKVYEGAHRA
IL-10Rb_Hu TTHDETVP-
IL-10Rb_Mu TGNDEITP-
INaRl_HU TTVENELPP
INaRl_MU TTVANKMPV
INgR_HU IFNSSIKG-
INgR_MU PFHDDRKD-
IL-10Ra_Mu ITTEQYFT-
IL-10Ra_Hu LT-RQYFT-
INgS_HU TTANASAR-
Zcytor7_Hu TLKDQSSE-
CYT0R11_HU SYRYVTKPP
INaR2_HU LPPGQESES
DCRS4.1 HU VEIEALTP-
Table 5 shows comparison of sequences of cytokine receptor subunits with the primate, e.g., human, DCRS3.1 (50R) , and DCRS4.1 (cytor) . Both of the new genes are likely alpha type receptor subunits, and thus should bind to ligand without the need for a beta subunit. Based upon structural features, the ligand for the DCRS3 subunits are likely to be a member of the family of cytokines which includes IL-2, IL-4, IL-7, IL-9, and the additional cytokines which signal through IL-2γ common receptor-like subunits IL-13, IL-15, and the TSLP ligand. Similarly, the ligand for the DCRS4 receptor subunits are probably a ligand in the IL-10 or IFN families, which may be a multi-subunit cytokine, analogous to IL-6 and IL-12. As used herein, the term DCRS3 shall be used to describe a protein comprising an amino acid sequence shown in Table 1; likewise with DCRS4 and Table 3. In many cases, a substantial fragment thereof will be functionally or structurally equivalent, including, e.g., an extracellular or intracellular domain. The invention also includes a protein variation of a DCRS3 allele whose sequence is provided, e.g., a mutein or soluble extracellular construct. Typically, such agonists or antagonists will exhibit less than about 10% sequence differences, and thus will often have between 1- and 11 -fold substitutions, e.g., 2-, 3-, 5-, 7-fold, and others. It also encompasses allelic and other variants, e.g., natural polymorphic, of the protein described. Typically, it will bind to its corresponding biological ligand, perhaps in a dimerized state with an alpha receptor subunit, with high affinity, e.g., at least about 100 nM, usually better than about 30 nM, preferably better than about 10 nM, and more preferably at better than about 3 nM. The term shall also be used herein to refer to related naturally occurring forms, e.g., alleles, polymorphic variants, and metabolic variants of the mammalian protein. Preferred forms of the receptor complexes will bind the appropriate ligand with an affinity and selectivity appropriate for a ligand-receptor interaction.
This invention also encompasses combinations of proteins or peptides having substantial amino acid sequence identity with the amino acid sequences in Tables 1 or 3. It will include sequence variants with relatively few substitutions, e.g., preferably less than about 3-5.
A substantial polypeptide "fragment", or "segment", is a stretch of amino acid residues of at least about 8 amino acids, generally at least 10 amino acids, more generally at least 12 amino acids, often at least 14 amino acids, more often at least 16 amino acids, typically at least 18 amino acids, more typically at least 20 amino acids, usually at least 22 amino acids, more usually at least 24 amino acids, preferably at least 26 amino acids, more preferably at least 28 amino acids, and, in particularly preferred embodiments, at least about 30 or more amino acids. Sequences of segments of different proteins can be compared to one another over appropriate length stretches . In many situations, fragments may exhibit functional properties of the intact subunits, e.g., the extracellular domain of the transmembrane receptor may retain the ligand binding features, and may be used to prepare a soluble receptor-like complex. Amino acid sequence homology, or sequence identity, is determined by optimizing residue matches. In some comparisons, gaps may be introduces, as required. See, e.g., Needleham, et al., (1970) J. Mol. Biol. 48:443-453; Sankoff, et al . , (1983) chapter one in Time Warps, String Edits, and Macromolecules: The Theory and Practice of Sequence Comparison, Addison-Wesley, Reading, MA; and software packages from IntelliGenetics, Mountain View, CA; and the University of Wisconsin Genetics Computer Group (GCG), Madison, WI ; each of which is incorporated herein by reference. This changes when considering conservative substitutions as matches. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. Homologous amino acid sequences are intended to include natural allelic and interspecies variations in the cytokine sequence. Typical homologous proteins or peptides will have from 50-100% homology (if gaps can be introduced), to 60-100% homology (if conservative substitutions are included) with an amino acid sequence segment of Table 1 or 3. Homology measures will be at least about 70%, generally at least 76%, more generally at least 81%, often at least 85%, more often at least 88%, typically at least 90%, more typically at least 92%, usually at least 94%, more usually at least 95%, preferably at least 96%, and more preferably at least 97%, and in particularly preferred embodiments, at least 98% or more. The degree of homology will vary with the length of the compared segments. Homologous proteins or peptides, such as the allelic variants, will share most biological activities with the embodiments described in Table 1 or 3. As used herein, the term "biological activity" is used to describe, without limitation, effects on inflammatory responses, innate immunity, and/or morphogenic development by cytokine- like ligands. For example, these receptors should mediate phosphatase or phosphorylase activities, which activities are easily measured by standard procedures. See, e.g., Hardie, et al . (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, CA; Hanks, et al . (1991) Meth. Enzvmol . 200:38-62; Hunter, et al . (1992) Cell 70:375-388; Lewin (1990) Cell 61:743-752; Pines, et al . (1991) Cold Spring Harbor Symp. Quant. Biol. 56:449-463; and Parker, et al . (1993) Nature 363:736-738. The receptors, or portions thereof, may be useful as phosphate labeling enzymes to label general or specific substrates. The subunits may also be functional immunogens to elicit recognizing antibodies, or antigens capable of binding antibodies.
The terms ligand, agonist, antagonist, and analog of, e.g., a DCRS3, include molecules that modulate the characteristic cellular responses to cytokine ligand proteins, as well as molecules possessing the more standard structural binding competition features of ligand-receptor interactions, e.g., where the receptor is a natural receptor or an antibody. The cellular responses likely are typically mediated through receptor tyrosine kinase pathways .
Also, a ligand is a molecule which serves either as a natural ligand to which said receptor, or an analog thereof, binds, or a molecule which is a functional analog of the natural ligand. The functional analog may be a ligand with structural modifications, or may be a wholly unrelated molecule which has a molecular shape which interacts with the appropriate ligand binding determinants. The ligands may serve as agonists or antagonists, see, e.g., Goodman, et al . (eds. 1990) Goodman & Gilman's: The Pharmacological Bases of Therapeutics, Pergamon Press, New York.
Rational drug design may also be based upon structural studies of the molecular shapes of a receptor or antibody and other effectors or ligands. See, e.g., Herz, et al . (1997) J. Recept . Signal Transduct . Res. 17:671-776; and Chaiken, et al . (1996) Trends Biotechnol . 14:369-375. Effectors may be other proteins which mediate other functions in response to ligand binding, or other proteins which normally interact with the receptor. One means for determining which sites interact with specific other proteins is a physical structure determination, e.g., x-ray crystallography or 2 dimensional NMR techniques. These will provide guidance as to which amino acid residues form molecular contact regions. For a detailed description of protein structural determination, see, e.g., Blundell and
Johnson (1976) Protein Crystallography, Academic Press, New York, which is hereby incorporated herein by reference.
II. Activities The cytokine receptor-like proteins will have a number of different biological activities, e.g., modulating cell proliferation, or in phosphate metabolism, being added to or removed from specific substrates, typically proteins. Such will generally result in modulation of an inflammatory function, other innate immunity response, or a morphological effect, as typical of cytokine or interleukin signaling. The subunit may have a specific low affinity binding to the ligand.
The receptors may signal through the JAK pathway. See, e.g., Ihle, et al . (1997) Stem Cells 15(suppl. 1) .105-111; Silvennoinen, et al . (1997) APMIS 105:497-509; Levy (1997)
Cytokine Growth Factor Review 8:81-90; Winston and Hunter (1996) Current Biol . 6:668-671; Barrett (1996) Baillieres Clin. Gastroenterol . 10:1-15; and Briscoe, et al . (1996) Philos . Trans. R. Soc . Lond. B. Biol. Sci. 351:167-171. The biological activities of the cytokine receptor subunits will be related to addition or removal of phosphate moieties to substrates, typically in a specific manner, but occasionally in a non specific manner. Substrates may be identified, or conditions for enzymatic activity may be assayed by standard methods, e.g., as described in Hardie, et al . (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, CA; Hanks, et al . (1991) Meth. Enzvmol. 200:38-62;
Hunter, et al . (1992) Cell 70:375-388; Lewin (1990) Cell 61:743- 752; Pines, et al . (1991) Cold Spring Harbor Symp. Quant. Biol. 56:449-463; and Parker, et al . (1993) Nature 363:736-738.
The receptor subunits may combine with other subunits, e.g., beta subunits, to form functional complexes, e.g., which may be useful for binding ligand or preparing antibodies. These will have substantial diagnostic uses, including detection or quantitation.
III. Nucleic Acids
This invention contemplates use of isolated nucleic acid or fragments, e.g., which encode these or closely related proteins, or fragments thereof, e.g., to encode a corresponding polypeptide, preferably one which is biologically active. In addition, this invention covers isolated or recombinant DNAs which encode combinations of such proteins or polypeptides having characteristic sequences, e.g., of DCRS3s or DCRS4s. Typically, the nucleic acid is capable of hybridizing, under appropriate conditions, with a nucleic acid sequence segment shown in Tables 1 or 3 , but preferably not with a corresponding segment of other receptors, e.g., described in Table 5. Said biologically active protein or polypeptide can be a full length protein, or fragment, and will typically have a segment of amino acid sequence highly homologous, e.g., exhibiting significant stretches of identity, to ones shown in Tables 1 or 3. Further, this invention covers the use of isolated or recombinant nucleic acid, or fragments thereof, which encode proteins having fragments which are equivalent to DCRS3 or DCRS4 proteins . The isolated nucleic acids can have the respective regulatory sequences in the 5' and 3' flanks, e.g., promoters, enhancers, poly-A addition signals, and others from the natural gene. Combinations, as described, are also provided. An "isolated" nucleic acid is a nucleic acid, e.g., an RNA, DNA, or a mixed polymer, which is substantially pure, e.g., separated from other components which naturally accompany a native sequence, such as ribosomes, polymerases, and flanking genomic sequences from the originating species. The term embraces a nucleic acid sequence which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates, which are thereby distinguishable from naturally occurring compositions, and chemically synthesized analogs or analogs biologically synthesized by heterologous systems. A substantially pure molecule includes isolated forms of the molecule, either completely or substantially pure.
An isolated nucleic acid will generally be a homogeneous composition of molecules, but will, in some embodiments, contain heterogeneity, preferably minor. This heterogeneity is typically found at the polymer ends or portions not critical to a desired biological function or activity.
A "recombinant" nucleic acid is typically defined either by its method of production or its structure. In reference to its method of production, e.g., a product made by a process, the process is use of recombinant nucleic acid techniques, e.g., involving human intervention in the nucleotide sequence. Typically this intervention involves in vitro manipulation, although under certain circumstances it may involve more classical animal breeding techniques. Alternatively, it can be a nucleic acid made by generating a sequence comprising fusion of two fragments which are not naturally contiguous to each other, but is meant to exclude products of nature, e.g., naturally occurring mutants as found in their natural state. Thus, for example, products made by transforming cells with an unnaturally occurring vector is encompassed, as are nucleic acids comprising sequence derived using any synthetic oligonucleotide process. Such a process is often done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a restriction enzyme sequence recognition site. Alternatively, the process is performed to join together nucleic acid segments of desired functions to generate a single genetic entity comprising a desired combination of functions not found in the commonly available natural forms, e.g., encoding a fusion protein. Restriction enzyme recognition sites are often the target of such artificial manipulations, but other site specific targets, e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design. A similar concept is intended for a recombinant, e.g., fusion, polypeptide. This will include a dimeric repeat. Specifically included are synthetic nucleic acids which, by genetic code redundancy, encode equivalent polypeptides to fragments of DCRS3 or DCRS4 and fusions of sequences from various different related molecules, e.g., other cytokine receptor family members. A "fragment" in a nucleic acid context is a contiguous segment of at least about 17 nucleotides, generally at least 21 nucleotides, more generally at least 25 nucleotides, ordinarily at least 30 nucleotides, more ordinarily at least 35 nucleotides, often at least 39 nucleotides, more often at least 45 nucleotides, typically at least 50 nucleotides, more typically at least 55 nucleotides, usually at least 60 nucleotides, more usually at least 66 nucleotides, preferably at least 72 nucleotides, more preferably at least 79 nucleotides, and in particularly preferred embodiments will be at least 85 or more nucleotides. Typically, fragments of different genetic sequences can be compared to one another over appropriate length stretches, particularly defined segments such as the domains described below.
A nucleic acid which codes for a DCRS3 or DCRS4 will be particularly useful to identify genes, mRNA, and cDNA species which code for itself or closely related proteins, as well as DNAs which code for polymorphic, allelic, or other genetic variants, e.g., from different individuals or related species. Preferred probes for such screens are those regions of the interleukin which are conserved between different polymorphic variants or which contain nucleotides which lack specificity, and will preferably be full length or nearly so. In other situations, polymorphic variant specific sequences will be more useful .
This invention further covers recombinant nucleic acid molecules and fragments having a nucleic acid sequence identical to or highly homologous to the isolated DNA set forth herein. In particular, the sequences will often be operably linked to DNA segments which control transcription, translation, and DNA replication. These additional segments typically assist in expression of the desired nucleic acid segment . Homologous, or highly identical, nucleic acid sequences, when compared to one another, e.g., DCRS3 sequences, exhibit significant similarity. The standards for homology in nucleic acids are either measures for homology generally used in the art by sequence comparison or based upon hybridization conditions. Comparative hybridization conditions are described in greater detail below.
Substantial identity in the nucleic acid sequence comparison context means either that the segments, or their complementary strands, when compared, are identical when optimally aligned, with appropriate nucleotide insertions or deletions, in at least about 60% of the nucleotides, generally at least 66%, ordinarily at least 71%, often at least 76%, more often at least 80%, usually at least 84%, more usually at least 88%, typically at least 91%, more typically at least about 93%, preferably at least about 95%, more preferably at least about 96 to 98% or more, and in particular embodiments, as high at about 99% or more of the nucleotides, including, e.g., segments encoding structural domains such as the segments described below. Alternatively, substantial identity will exist when the segments will hybridize under selective hybridization conditions, to a strand or its complement, typically using a sequence derived from Tables 1 or 3. Typically, selective hybridization will occur when there is at least about 55% homology over a stretch of at least about 14 nucleotides, more typically at least about 65%, preferably at least about 75%, and more preferably at least about 90%. See, Kanehisa (1984) Nucl . Acids Res . 12:203-213, which is incorporated herein by reference. The length of homology comparison, as described, may be over longer stretches, and in certain embodiments will be over a stretch of at least about 17 nucleotides, generally at least about 20 nucleotides, ordinarily at least about 24 nucleotides, usually at least about 28 nucleotides, typically at least about 32 nucleotides, more typically at least about 40 nucleotides, preferably at least about 50 nucleotides, and more preferably at least about 75 to 100 or more nucleotides. This includes, e.g., 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 544, and other lengths. Stringent conditions, in referring to homology in the hybridization context, will be stringent combined conditions of salt, temperature, organic solvents, and other parameters typically controlled in hybridization reactions. Stringent temperature conditions will usually include temperatures in excess of about 30 C, more usually in excess of about 37 C, typically in excess of about 45 C, more typically in excess of about 55 C, preferably in excess of about 65 C, and more preferably in excess of about 70 C. Stringent salt conditions will ordinarily be less than about 500 mM, usually less than about 400 mM, more usually less than about 300 mM, typically less than about 200 mM, preferably less than about 100 mM, and more preferably less than about 80 M, even down to less than about 20 mM. However, the combination of parameters is much more important than the measure of any single parameter. See, e.g., Wetmur and Davidson (1968) J. Mol . Biol. 31:349-370, which is hereby incorporated herein by reference.
The isolated DNA can be readily modified by nucleotide substitutions, nucleotide deletions, nucleotide insertions, and inversions of nucleotide stretches. These modifications result in novel DNA sequences which encode this protein or its derivatives. These modified sequences can be used to produce mutant proteins (muteins) or to enhance the expression of variant species. Enhanced expression may involve gene amplification, increased transcription, increased translation, and other mechanisms. Such mutant DCRS-like derivatives include predetermined or site-specific mutations of the protein or its fragments, including silent mutations using genetic code degeneracy. "Mutant DCRS3" as used herein encompasses a polypeptide otherwise falling within the homology definition of the DCRS3 as set forth above, but having an amino acid sequence which differs from that of other cytokine receptor-like proteins as found in nature, whether by way of deletion, substitution, or insertion. In particular, "site specific mutant DCRS3" encompasses a protein having substantial sequence identity with a protein of Table 1, and typically shares most of the biological activities or effects of the forms disclosed herein. Likewise in reference to DCRS4.
Although site specific mutation sites are predetermined, mutants need not be site specific. Mammalian DCRS3 mutagenesis can be achieved by making amino acid insertions or deletions in the gene, coupled with expression. Substitutions, deletions, insertions, or many combinations may be generated to arrive at a final construct. Insertions include amino- or carboxy- terminal fusions. Random mutagenesis can be conducted at a target codon and the expressed mammalian DCRS3 mutants can then be screened for the desired activity, providing some aspect of a structure- activity relationship. Methods for making substitution mutations at predetermined sites in DNA having a known sequence are well known in the art, e.g., by M13 primer mutagenesis. See also Sambrook, et al . (1989) and Ausubel, et al . (1987 and periodic Supplements) .
The mutations in the DNA normally should not place coding sequences out of reading frames and preferably will not create complementary regions that could hybridize to produce secondary mRNA structure such as loops or hairpins . The phosphoramidite method described by Beaucage and Carruthers (1981) Tetra. Letts. 22:1859-1862, will produce suitable synthetic DNA fragments. A double stranded fragment will often be obtained either by synthesizing the complementary strand and annealing the strand together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence. Polymerase chain reaction (PCR) techniques can often be applied in mutagenesis. Alternatively, mutagenesis primers are commonly used methods for generating defined mutations at predetermined sites. See, e.g., Innis, et al . (eds. 1990) PCR Protocols: A Guide to Methods and Applications Academic Press, San Diego, CA; and Dieffenbach and Dveksler (1995; eds.) PCR Primer: A Laboratory Manual Cold Spring Harbor Press, CSH, NY.
Certain embodiments of the invention are directed to combination compositions comprising the receptor or ligand sequences described. In other embodiments, functional portions of the sequences may be joined to encode fusion proteins. In other forms, variants of the described sequences may be substituted.
IV. Proteins, Peptides
As described above, the present invention encompasses primate DCRS3, e.g., whose sequences are disclosed in Table 1, and described above. Allelic and other variants are also contemplated, including, e.g., fusion proteins combining portions of such sequences with others, including, e.g., epitope tags and functional domains.
The present invention also provides recombinant proteins, e.g., heterologous fusion proteins using segments from these primate or rodent proteins. A heterologous fusion protein is a fusion of proteins or segments which are naturally not normally fused in the same manner. Thus, the fusion product of a DCRS3 with another cytokine receptor is a continuous protein molecule having sequences fused in a typical peptide linkage, typically made as a single translation product and exhibiting properties, e.g., sequence or antigenicity, derived from each source peptide. A similar concept applies to heterologous nucleic acid sequences. Combinations of various designated proteins into complexes are also provided.
In addition, new constructs may be made from combining similar functional or structural domains from other related proteins, e.g., cytokine receptors or Toll-like receptors, including species variants. For example, ligand-binding or other segments may be "swapped" between different new fusion polypeptides or fragments. See, e.g., Cunningham, et al . (1989) Science 243:1330-1336; and O'Dowd, et al . (1988) J. Biol. Chem. 263:15985-15992, each of which is incorporated herein by reference. Thus, new chimeric polypeptides exhibiting new combinations of specificities will result from the functional linkage of receptor-binding specificities. For example, the ligand binding domains from other related receptor molecules may be added or substituted for other domains of this or related proteins. The resulting protein will often have hybrid function and properties. For example, a fusion protein may include a targeting domain which may serve to provide sequestering of the fusion protein to a particular subcellular organelle.
Candidate fusion partners and sequences can be selected from various sequence data bases, e.g., GenBank, c/o
IntelliGenetics, Mountain View, CA; and BCG, University of Wisconsin Biotechnology Computing Group, Madison, WI , which are each incorporated herein by reference. In particular, combinations of polypeptide sequences provided in Tables 1 and 3 are particularly preferred. Variant forms of the proteins may be substituted in the described combinations.
The present invention particularly provides muteins which bind cytokine-like ligands, and/or which are affected in signal transduction. Structural alignment of human DCRS3 or DCRS4 with other members of the cytokine receptor family show conserved features/residues. See Table 5. Alignment of human DCRS3 or DCRS4 sequence with other members of the cytokine receptor family indicates various structural and functionally shared features. See also, Bazan, et al . (1996) Nature 379:591; Lodi , et al . (1994) Science 263:1762-1766; Sayle and Milner-White
(1995) TIBS 20:374-376; and Gronenberg, et al . (1991) Protein Engineering 4:263-269.
Substitutions with either mouse sequences or human sequences are particularly preferred. Conversely, conservative substitutions away from the ligand binding interaction regions will probably preserve most signaling activities; and conservative substitutions away from the intracellular domains will probably preserve most ligand binding properties.
"Derivatives" of primate DCRS3 include amino acid sequence mutants, glycosylation variants, metabolic derivatives and covalent or aggregative conjugates with other chemical moieties. Covalent derivatives can be prepared by linkage of functionalities to groups which are found in DCRS3 amino acid side chains or at the N- or C- termini, e.g., by means which are well known in the art. These derivatives can include, without limitation, aliphatic esters or amides of the carboxyl terminus, or of residues containing carboxyl side chains, O-acyl derivatives of hydroxyl group-containing residues, and N-acyl derivatives of the amino terminal amino acid or amino-group containing residues, e.g., lysine or arginine. Acyl groups are selected from the group of alkyl -moieties, including C3 to C18 normal alkyl, thereby forming alkanoyl aroyl species.
In particular, glycosylation alterations are included, e.g., made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing, or in further processing steps. Particularly preferred means for accomplishing this are by exposing the polypeptide to glycosylating enzymes derived from cells which normally provide such processing, e.g., mammalian glycosylation enzymes. Deglycosylation enzymes are also contemplated. Also embraced are versions of the same primary amino acid sequence which have other minor modifications, including phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine , or phosphothreonine .
A major group of derivatives are covalent conjugates of the receptors or fragments thereof with other proteins of polypeptides. These derivatives can be synthesized in recombinant culture such as N- or C-terminal fusions or by the use of agents known in the art for their usefulness in cross-linking proteins through reactive side groups. Preferred derivatization sites with cross-linking agents are at free amino groups, carbohydrate moieties, and cysteine residues. Fusion polypeptides between the receptors and other homologous or heterologous proteins are also provided. Homologous polypeptides may be fusions between different receptors, resulting in, for instance, a hybrid protein exhibiting binding specificity for multiple different cytokine ligands, or a receptor which may have broadened or weakened specificity of substrate effect. Likewise, heterologous fusions may be constructed which would exhibit a combination of properties or activities of the derivative proteins. Typical examples are fusions of a reporter polypeptide, e.g., luciferase, with a segment or domain of a receptor, e.g., a ligand-binding segment, so that the presence or location of a desired ligand may be easily determined. See, e.g., Dull, et al . , U.S. Patent No. 4,859,609, which is hereby incorporated herein by reference. Other gene fusion partners include glutathione-S-transferase (GST) , bacterial β-galactosidase, trpE, Protein A, β-lactamase, alpha amylase, alcohol dehydrogenase, and yeast alpha mating factor. See, e.g., Godowski, et al . (1988) Science 241:812-816. Labeled proteins will often be substituted in the described combinations of proteins .
The phosphoramidite method described by Beaucage and Carruthers (1981) Tetra. Letts. 22:1859-1862, will produce suitable synthetic DNA fragments. A double stranded fragment will often be obtained either by synthesizing the complementary strand and annealing the strand together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
Such polypeptides may also have amino acid residues which have been chemically modified by phosphorylation, sulfonation, biotinylation, or the addition or removal of other moieties, particularly those which have molecular shapes similar to phosphate groups. In some embodiments, the modifications will be useful labeling reagents, or serve as purification targets, e.g., affinity ligands.
Fusion proteins will typically be made by either recombinant nucleic acid methods or by synthetic polypeptide methods. Techniques for nucleic acid manipulation and expression are described generally, for example, in Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual (2d ed.), Vols. 1-3, Cold Spring Harbor Laboratory, and Ausubel, et al . (eds. 1987 and periodic supplements) Current Protocols in Molecular Biology, Greene/Wiley, New York, which are each incorporated herein by reference. Techniques for synthesis of polypeptides are described, for example, in Merrifield (1963) J. Amer. Chem. Soc . 85:2149-2156; Merrifield (1986) Science 232: 341-347; and Atherton, et al . (1989) Solid Phase Peptide
Synthesis: A Practical Approach, IRL Press, Oxford; each of which is incorporated herein by reference. See also Dawson, et al . (1994) Science 266:776-779 for methods to make larger polypeptides . This invention also contemplates the use of derivatives of a DCRS3 or DCRS4 other than variations in amino acid sequence or glycosylation. Such derivatives may involve covalent or aggregative association with chemical moieties. These derivatives generally fall into three classes: (1) salts, (2) side chain and terminal residue covalent modifications, and (3) adsorption complexes, for example with cell membranes. Such covalent or aggregative derivatives are useful as immunogens, as reagents in immunoassays, or in purification methods such as for affinity purification of a receptor or other binding molecule, e.g., an antibody. For example, a cytokine ligand can be immobilized by covalent bonding to a solid support such as cyanogen bromide-activated Sepharose, by methods which are well known in the art, or adsorbed onto polyolefin surfaces, with or without glutaraldehyde cross-linking, for use in the assay or purification of a cytokine receptor, antibodies, or other similar molecules. The ligand can also be labeled with a detectable group, for example radioiodinated by the chloramine T procedure, covalently bound to rare earth chelates, or conjugated to another fluorescent moiety for use in diagnostic assays.
A combination, e.g., including a DCRS3 or DCRS4 , of this invention can be used as an immunogen for the production of antisera or antibodies specific, e.g., capable of distinguishing between other cytokine receptor family members, for the combinations described. The complexes can be used to screen monoclonal antibodies or antigen-binding fragments prepared by immunization with various forms of impure preparations containing the protein. In particular, the term "antibodies" also encompasses antigen binding fragments of natural antibodies, e.g., Fab, Fab2 , Fv, etc. A purified DCRS3 can also be used as a reagent to detect antibodies generated in response to the presence of elevated levels of expression, or immunological disorders which lead to antibody production to the endogenous receptor. Additionally, DCRS3 fragments may also serve as immunogens to produce the antibodies of the present invention, as described immediately below. For example, this invention contemplates antibodies having binding affinity to or being raised against the amino acid sequences shown in Table 1, fragments thereof, or various homologous peptides. In particular, this invention contemplates antibodies having binding affinity to, or having been raised against, specific fragments which are predicted to be, or actually are, exposed at the exterior protein surface of a native DCRS3. Complexes of combinations of proteins will also be useful, and antibody preparations thereto can be made.
The blocking of physiological response to the receptor ligands may result from the inhibition of binding of the ligand to the receptor, likely through competitive inhibition. Thus, in vitro assays of the present invention will often use antibodies or antigen binding segments of these antibodies, or fragments attached to solid phase substrates. These assays will also allow for the diagnostic determination of the effects of either ligand binding region mutations and modifications, or other mutations and modifications, e.g., which affect signaling or enzymatic function.
This invention also contemplates the use of competitive drug screening assays, e.g., where neutralizing antibodies to the receptor complexes or fragments compete with a test compound for binding to a ligand or other antibody. In this manner, the neutralizing antibodies or fragments can be used to detect the presence of a polypeptide which shares one or more binding sites to a receptor and can also be used to occupy binding sites on a receptor that might otherwise bind a ligand.
V. Making Nucleic Acids and Protein
DNA which encodes the protein or fragments thereof can be obtained by chemical synthesis, screening cDNA libraries, or by screening genomic libraries prepared from a wide variety of cell lines or tissue samples. Natural sequences can be isolated using standard methods and the sequences provided herein, e.g., in Tables 1 or 3. Other species counterparts can be identified by hybridization techniques, or by various PCR techniques, combined with or by searching in sequence databases, e.g., GenBank.
This DNA can be expressed in a wide variety of host cells for the synthesis of a full-length receptor or fragments which can in turn, for example, be used to generate polyclonal or monoclonal antibodies; for binding studies; for construction and expression of modified ligand binding or kinase/phosphatase domains; and for structure/function studies. Variants or fragments can be expressed in host cells that are transformed or transfected with appropriate expression vectors. These molecules can be substantially free of protein or cellular contaminants, other than those derived from the recombinant host, and therefore are particularly useful in pharmaceutical compositions when combined with a pharmaceutically acceptable carrier and/or diluent. The protein, or portions thereof, may be expressed as fusions with other proteins. Combinations of the described proteins, or nucleic acids encoding them, are particularly interesting.
Expression vectors are typically self-replicating DNA or RNA constructs containing the desired receptor gene or its fragments, usually operably linked to suitable genetic control elements that are recognized in a suitable host cell. These control elements are capable of effecting expression within a suitable host. The multiple genes may be coordinately expressed, and may be on a polycistronic message. The specific type of control elements necessary to effect expression will depend upon the eventual host cell used. Generally, the genetic control elements can include a prokaryotic promoter system or a eukaryotic promoter expression control system, and typically include a transcriptional promoter, an optional operator to control the onset of transcription, transcription enhancers to elevate the level of mRNA expression, a sequence that encodes a suitable ribosome binding site, and sequences that terminate transcription and translation. Expression vectors also usually contain an origin of replication that allows the vector to replicate independently of the host cell .
The vectors of this invention include those which contain DNA which encodes a combination of proteins, as described, or a biologically active equivalent polypeptide. The DNA can be under the control of a viral promoter and can encode a selection marker. This invention further contemplates use of such expression vectors which are capable of expressing eukaryotic cDNAs coding for such proteins in a prokaryotic or eukaryotic host, where the vector is compatible with the host and where the eukaryotic cDNAs are inserted into the vector such that growth of the host containing the vector expresses the cDNAs in question. Usually, expression vectors are designed for stable replication in their host cells or for amplification to greatly increase the total number of copies of the desirable gene per cell. It is not always necessary to require that an expression vector replicate in a host cell, e.g., it is possible to effect transient expression of the protein or its fragments in various hosts using vectors that do not contain a replication origin that is recognized by the host cell. It is also possible to use vectors that cause integration of the protein encoding portions into the host DNA by recombination.
Vectors, as used herein, comprise plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles which enable the integration of DNA fragments into the genome of the host. Expression vectors are specialized vectors which contain genetic control elements that effect expression of operably linked genes. Plasmids are the most commonly used form of vector but all other forms of vectors which serve an equivalent function and which are, or become, known in the art are suitable for use herein. See, e.g., Pouwels, et al . (1985 and Supplements) Cloning Vectors : A Laboratory Manual , Elsevier, N.Y., and Rodriguez, et al . (eds. 1988) Vectors: A Survey of Molecular Cloning Vectors and Their Uses. Buttersworth, Boston, which are incorporated herein by reference.
Transformed cells are cells, preferably mammalian, that have been transformed or transfected with vectors constructed using recombinant DNA techniques. Transformed host cells usually express the desired proteins, but for purposes of cloning, amplifying, and manipulating its DNA, do not need to express the subject proteins. This invention further contemplates culturing transformed cells in a nutrient medium, thus permitting the proteins to accumulate. The proteins can be recovered, either from the culture or, in certain instances, from the culture medium.
For purposes of this invention, nucleic sequences are operably linked when they are functionally related to each other. For example, DNA for a presequence or secretory leader is operably linked to a polypeptide if it is expressed as a preprotein or participates in directing the polypeptide to the cell membrane or in secretion of the polypeptide. A promoter is operably linked to a coding sequence if it controls the transcription of the polypeptide; a ribosome binding site is operably linked to a coding sequence if it is positioned to permit translation. Usually, operably linked means contiguous and in reading frame, however, certain genetic elements such as repressor genes are not contiguously linked but still bind to operator sequences that in turn control expression.
Suitable host cells include prokaryotes, lower eukaryotes, and higher eukaryotes. Prokaryotes include both gram negative and gram positive organisms, e.g., E. coli and B. subtilis. Lower eukaryotes include yeasts, e.g., S. cerevisiae and Pichia , and species of the genus Dictyostelium. Higher eukaryotes include established tissue culture cell lines from animal cells, both of non-mammalian origin, e.g., insect cells, and birds, and of mammalian origin, e.g., human, primates, and rodents.
Prokaryotic host -vector systems include a wide variety of vectors for many different species. As used herein, E. coli and its vectors will be used generically to include equivalent vectors used in other prokaryotes. A representative vector for amplifying DNA is pBR322 or many of its derivatives. Vectors that can be used to express the receptor or its fragments include, but are not limited to, such vectors as those containing the lac promoter (pUC-series) ; trp promoter
(pBR322-trp) ; Ipp promoter (the pIN-series) ; lambda-pP or pR promoters (pOTS) ; or hybrid promoters such as ptac (pDR540) . See Brosius, et al . (1988) "Expression Vectors Employing Lambda-, trp-, lac-, and Ipp-derived Promoters", in Vectors : A Survey of Molecular Cloning Vectors and Their Uses, (eds.
Rodriguez and Denhardt) , Buttersworth, Boston, Chapter 10, pp. 205-236, which is incorporated herein by reference.
Lower eukaryotes, e.g., yeasts and Dictyostelium, may be transformed with DCRS3 or DCRS4 sequence containing vectors. For purposes of this invention, the most common lower eukaryotic host is the baker's yeast, Saccharomyces cerevisiae. It will be used to generically represent lower eukaryotes although a number of other strains and species are also available. Yeast vectors typically consist of a replication origin (unless of the integrating type), a selection gene, a promoter, DNA encoding the receptor or its fragments, and sequences for translation termination, polyadenylation, and transcription termination. Suitable expression vectors for yeast include such constitutive promoters as 3-phosphoglycerate kinase and various other glycolytic enzyme gene promoters or such inducible promoters as the alcohol dehydrogenase 2 promoter or metallothionine promoter. Suitable vectors include derivatives of the following types: self-replicating low copy number (such as the YRp-series) , self-replicating high copy number (such as the YEp-series) ; integrating types (such as the YIp-series) , or mini-chromosomes (such as the YCp-series) . Higher eukaryotic tissue culture cells are normally the preferred host cells for expression of the functionally active interleukin or receptor proteins. In principle, many higher eukaryotic tissue culture cell lines are workable, e.g., insect baculovirus expression systems, whether from an invertebrate or vertebrate source. However, mammalian cells are preferred. Transformation or transfection and propagation of such cells has become a routine procedure. Examples of useful cell lines include HeLa cells, Chinese hamster ovary (CHO) cell lines, baby rat kidney (BRK) cell lines, insect cell lines, bird cell lines, and monkey (COS) cell lines. Expression vectors for such cell lines usually include an origin of replication, a promoter, a translation initiation site, RNA splice sites (if genomic DNA is used), a polyadenylation site, and a transcription termination site. These vectors also usually contain a selection gene or amplification gene. Suitable expression vectors may be plasmids, viruses, or retroviruses carrying promoters derived, e.g., from such sources as from adenovirus, SV40, parvoviruses, vaccinia virus, or cytomegalovirus . Representative examples of suitable expression vectors include pCDNAl ; pCD, see Okayama, et al. (1985) Mol. Cell Biol. 5:1136-1142; pMClneo PolyA, see Thomas, et al . (1987) Cell 51:503-512; and a baculovirus vector such as pAC 373 or pAC 610.
For secreted proteins and some membrane proteins, an open reading frame usually encodes a polypeptide that consists of a mature or secreted product covalently linked at its N-terminus to a signal peptide. The signal peptide is cleaved prior to secretion of the mature, or active, polypeptide. The cleavage site can be predicted with a high degree of accuracy from empirical rules, e.g., von-Heijne (1986) Nucleic Acids Research 14:4683-4690 and Nielsen, et al . (1997) Protein Eng . 10:1-12, and the precise amino acid composition of the signal peptide often does not appear to be critical to its function, e.g., Randall, et al . (1989) Science 243:1156-1159; Kaiser et al . (1987) Science 235:312-317. The mature proteins of the invention can be readily determined using standard methods. It will often be desired to express these polypeptides in a system which provides a specific or defined glycosylation pattern. In this case, the usual pattern will be that provided naturally by the expression system. However, the pattern will be modifiable by exposing the polypeptide, e.g., an unglycosylated form, to appropriate glycosylating proteins introduced into a heterologous expression system. For example, the receptor gene may be co-transformed with one or more genes encoding mammalian or other glycosylating enzymes. Using this approach, certain mammalian glycosylation patterns will be achievable in prokaryote or other cells. Expression in prokaryote cells will typically lead to unglycosylated forms of protein.
The source of DCRS3 or DCRS4 can be a eukaryotic or prokaryotic host expressing recombinant DCRS, such as is described above. The source can also be a cell line, but other mammalian cell lines are also contemplated by this invention, with the preferred cell line being from the human species.
Now that the sequences are known, a primate DCRS3 or DCRS4 , fragments, or derivatives thereof can be prepared by conventional processes for synthesizing peptides. These include processes such as are described in Stewart and Young (1984) Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, IL; Bodanszky and Bodanszky (1984) The Practice of Peptide Synthesis , Springer-Verlag, New York; and Bodanszky (1984) The Principles of Peptide Synthesis, Springer-Verlag, New York; all of each which are incorporated herein by reference. For example, an azide process, an acid chloride process, an acid anhydride process, a mixed anhydride process, an active ester process (for example, p-nitrophenyl ester, N-hydroxysuccinimide ester, or cyanomethyl ester), a carbodiimidazole process, an oxidative-reductive process, or a dicyclohexylcarbodiimide (DCCD) /additive process can be used. Solid phase and solution phase syntheses are both applicable to the foregoing processes. Similar techniques can be used with partial DCRS3 or DCRS4 sequences . DCRS3 or DCRS4 proteins, fragments, or derivatives are suitably prepared in accordance with the above processes as typically employed in peptide synthesis, generally either by a so-called stepwise process which comprises condensing an amino acid to the terminal amino acid, one by one in sequence, or by coupling peptide fragments to the terminal amino acid. Amino groups that are not being used in the coupling reaction typically must be protected to prevent coupling at an incorrect location. If a solid phase synthesis is adopted, the C-terminal amino acid is bound to an insoluble carrier or support through its carboxyl group. The insoluble carrier is not particularly limited as long as it has a binding capability to a reactive carboxyl group. Examples of such insoluble carriers include halomethyl resins, such as chloromethyl resin or bromomethyl resin, hydroxymethyl resins, phenol resins, tert-alkyloxycarbonylhydrazidated resins, and the like.
An amino group-protected amino acid is bound in sequence through condensation of its activated carboxyl group and the reactive amino group of the previously formed peptide or chain, to synthesize the peptide step by step. After synthesizing the complete sequence, the peptide is split off from the insoluble carrier to produce the peptide. This solid-phase approach is generally described by Merrifield, et al . (1963) in J . Am. Chem. Soc . 85:2149-2156, which is incorporated herein by reference.
The prepared protein and fragments thereof can be isolated and purified from the reaction mixture by means of peptide separation, for example, by extraction, precipitation, electrophoresis, various forms of chromatography, and the like. The receptors of this invention can be obtained in varying degrees of purity depending upon desired uses. Purification can be accomplished by use of the protein purification techniques disclosed herein, see below, or by the use of the antibodies herein described in methods of immunoabsorbant affinity chromatography. This immunoabsorbant affinity chromatography is carried out by first linking the antibodies to a solid support and then contacting the linked antibodies with solubilized lysates of appropriate cells, lysates of other cells expressing the receptor, or lysates or supematants of cells producing the protein as a result of DNA techniques, see below.
Generally, the purified protein will be at least about 40% pure, ordinarily at least about 50% pure, usually at least about 60% pure, typically at least about 70% pure, more typically at least about 80% pure, preferable at least about 90% pure and more preferably at least about 95% pure, and in particular embodiments, 97%-99% or more. Purity will usually be on a weight basis, but can also be on a molar basis. Different assays will be applied as appropriate. Individual proteins may be purified and thereafter combined.
VI. Antibodies Antibodies can be raised to various mammalian, e.g., primate DCRS3 or DCRS4 proteins and fragments thereof, both in naturally occurring native forms and in their recombinant forms, the difference being that antibodies to the active receptor are more likely to recognize epitopes which are only present in the native conformations. Denatured antigen detection can also be useful in, e.g., Western analysis. Anti-idiotypic antibodies are also contemplated, which would be useful as agonists or antagonists of a natural receptor or an antibody.
Antibodies, including binding fragments and single chain versions, against predetermined fragments of the protein can be raised by immunization of animals with conjugates of the fragments with immunogenic proteins. Monoclonal antibodies are prepared from cells secreting the desired antibody. These antibodies can be screened for binding to normal or defective protein, or screened for agonistic or antagonistic activity.
These monoclonal antibodies will usually bind with at least a K-Q of about 1 mM, more usually at least about 300 μM, typically at least about lOOμM, more typically at least about 30 μM, preferably at least about 10 μM, and more preferably at least about 3 μM or better.
The antibodies, including antigen binding fragments, of this invention can have significant diagnostic or therapeutic value. They can be potent antagonists that bind to the receptor and inhibit binding to ligand or inhibit the ability of the receptor to elicit a biological response, e.g., act on its substrate. They also can be useful as non-neutralizing antibodies and can be coupled to toxins or radionuclides to bind producing cells, or cells localized to the source of the interleukin. Further, these antibodies can be conjugated to drugs or other therapeutic agents, either directly or indirectly by means of a linker. The antibodies of this invention can also be useful in diagnostic applications. As capture or non-neutralizing antibodies, they might bind to the receptor without inhibiting ligand or substrate binding. As neutralizing antibodies, they can be useful in competitive binding assays. They will also be useful in detecting or quantifying ligand. They may be used as reagents for Western blot analysis, or for immunoprecipitation or immunopurification of the respective protein. Likewise, nucleic acids and proteins may be immobilized to solid substrates for affinity purification or detection methods. The substrates may be, e.g., solid resin beads or sheets of plastic. Protein fragments may be joined to other materials, particularly polypeptides, as fused or covalently joined polypeptides to be used as immunogens. Mammalian cytokine receptors and fragments may be fused or covalently linked to a variety of immunogens, such as keyhole limpet hemocyanin, bovine serum albumin, tetanus toxoid, etc. See Microbiology, Hoeber Medical Division, Harper and Row, 1969; Landsteiner (1962) Specificity of Serological Reactions, Dover Publications, New York; and Williams, et al . (1967) Methods in Immunology and Immunochemistry. Vol. 1, Academic Press, New York; each of which are incorporated herein by reference, for descriptions of methods of preparing polyclonal antisera. A typical method involves hyperimmunization of an animal with an antigen. The blood of the animal is then collected shortly after the repeated immunizations and the gamma globulin is isolated.
In some instances, it is desirable to prepare monoclonal antibodies from various mammalian hosts, such as mice, rodents, primates, humans, etc. Description of techniques for preparing such monoclonal antibodies may be found in, e.g., Stites, et al . (eds.) Basic and Clinical Immunology (4th ed.), Lange Medical Publications, Los Altos, CA, and references cited therein; Harlow and Lane (1988) Antibodies: A Laboratory Manual, CSH Press; Goding (1986) Monoclonal Antibodies: Principles and Practice (2d ed.) Academic Press, New York; and particularly in Kohler and Milstein (1975) in Nature 256: 495-497, which discusses one method of generating monoclonal antibodies. Each of these references is incorporated herein by reference.
Summarized briefly, this method involves injecting an animal with an immunogen. The animal is then sacrificed and cells taken from its spleen, which are then fused with myeloma cells. The result is a hybrid cell or "hybridoma" that is capable of reproducing in vitro . The population of hybridomas is then screened to isolate individual clones, each of which secrete a single antibody species to the immunogen. In this manner, the individual antibody species obtained are the products of immortalized and cloned single B cells from the immune animal generated in response to a specific site recognized on the immunogenic substance.
Other suitable techniques involve in vitro exposure of lymphocytes to the antigenic polypeptides or alternatively to selection of libraries of antibodies in phage or similar vectors. See, Huse, et al . (1989) "Generation of a Large
Combinatorial Library of the Immunoglobulin Repertoire in Phage Lambda," Science 246:1275-1281; and Ward, et al . (1989) Nature 341:544-546, each of which is hereby incorporated herein by reference. The polypeptides and antibodies of the present invention may be used with or without modification, including chimeric or humanized antibodies. Frequently, the polypeptides and antibodies will be labeled by joining, either covalently or non-covalently, a substance which provides for a detectable signal. A wide variety of labels and conjugation techniques are known and are reported extensively in both the scientific and patent literature. Suitable labels include radionuclides, enzymes, substrates, cofactors, inhibitors, fluorescent moieties, chemiluminescent moieties, magnetic particles, and the like. Patents, teaching the use of such labels include U.S. Patent Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241. Also, recombinant or chimeric immunoglobulins may be produced, see Cabilly, U.S.
Patent No. 4,816,567; or made in transgenic mice, see Mendez, et al . (1997) Nature Genetics 15:146-156. These references are incorporated herein by reference.
The antibodies of this invention can also be used for affinity chromatography in isolating DCRS3 proteins or peptides. Columns can be prepared where the antibodies are linked to a solid support, e.g., particles, such as agarose, Sephadex, or the like, where a cell lysate may be passed through the column, the column washed, followed by increasing concentrations of a mild denaturant, whereby the purified protein will be released. Alternatively, the protein may be used to purify antibody. Appropriate cross absorptions or depletions may be applied.
The antibodies may also be used to screen expression libraries for particular expression products. Usually the antibodies used in such a procedure will be labeled with a moiety allowing easy detection of presence of antigen by antibody binding.
Antibodies raised against a cytokine receptor will also be used to raise anti-idiotypic antibodies. These will be useful in detecting or diagnosing various immunological conditions related to expression of the protein or cells which express the protein. They also will be useful as agonists or antagonists of the ligand, which may be competitive inhibitors or substitutes for naturally occurring ligands. A cytokine receptor protein that specifically binds to or that is specifically immunoreactive with an antibody generated against a defined immunogen, such as an immunogen consisting of the amino acid sequence of SEQ ID NO: 2, 25, 5, 28, or 31, is typically determined in an immunoassay. The immunoassay typically uses a polyclonal antiserum which was raised, e.g., to a protein of SEQ ID NO: 2, 25, 5, 28, or 31. This antiserum is selected to have low crossreactivity against other cytokine receptor family members, e.g., IL-11 receptor subunit alpha, IL- 6 receptor subunit alpha, or p40, preferably from the same species, and any such crossreactivity is removed by immunoabsorption prior to use in the immunoassay. In order to produce antisera for use in an immunoassay, the protein, e.g., of SEQ ID NO: 2, 25, 5, 28, or 31, is isolated as described herein. For example, recombinant protein may be produced in a mammalian cell line. An appropriate host, e.g., an inbred strain of mice such as Balb/c, is immunized with the selected protein, typically using a standard adjuvant, such as Freund's adjuvant, and a standard mouse immunization protocol (see Harlow and Lane, supra) . Alternatively, a synthetic peptide derived from the sequences disclosed herein and conjugated to a carrier protein can be used an immunogen. Polyclonal sera are collected and titered against the immunogen protein in an immunoassay, e.g., a solid phase immunoassay with the immunogen immobilized on a solid support. Polyclonal antisera with a titer of 104 or greater are selected and tested for their cross reactivity against other cytokine receptor family members, e.g., IL-2, IL-7, IL-9, or EPO receptor subunit, using a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573. Preferably at least two cytokine receptor family members are used in this determination. These cytokine receptor family members can be produced as recombinant proteins and isolated using standard molecular biology and protein chemistry techniques as described herein.
Immunoassays in the competitive binding format can be used for the crossreactivity determinations. For example, the protein of SEQ ID NO: 2, 25, 5, 28, or 31 can be immobilized to a solid support. Proteins added to the assay compete with the binding of the antisera to the immobilized antigen. The ability of the above proteins to compete with the binding of the antisera to the immobilized protein is compared to the proteins, e.g., of IL-2, IL-7, IL-9, or EPO receptor subunit. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the proteins listed above are selected and pooled. The cross-reacting antibodies are then removed from the pooled antisera by immunoabsorption with the above-listed proteins. The immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein to the immunogen protein (e.g., DCRS3 like protein of SEQ ID NO: 2) . In order to make this comparison, the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required is less than twice the amount of the protein of the selected protein or proteins that is required, then the second protein is said to specifically bind to an antibody generated to the immunogen .
It is understood that these cytokine receptor proteins are members of a family of homologous proteins that comprise at least 6 so far identified genes. For a particular gene product, such as a DCRS3 or DCRS4, the term refers not only to the amino acid sequences disclosed herein, but also to other proteins that are allelic, non-allelic, or species variants. It is also understood that the terms include nonnatural mutations introduced by deliberate mutation using conventional recombinant technology such as single site mutation, or by excising short sections of DNA encoding the respective proteins, or by substituting new amino acids, or adding new amino acids. Such minor alterations typically will substantially maintain the immunoidentity of the original molecule and/or its biological activity. Thus, these alterations include proteins that are specifically immunoreactive with a designated naturally occurring DCRS3 or DCRS4 protein. The biological properties of the altered proteins can be determined by expressing the protein in an appropriate cell line and measuring the appropriate effect, e.g., upon transfected lymphocytes. Particular protein modifications considered minor would include conservative substitution of amino acids with similar chemical properties, as described above for the cytokine receptor family as a whole. By aligning a protein optimally with the protein of the cytokine receptors and by using the conventional immunoassays described herein to determine immunoidentity, one can determine the protein compositions of the invention.
VII. Kits and quantitation
Both naturally occurring and recombinant forms of the cytokine receptor like molecules of this invention are particularly useful in kits and assay methods. For example, these methods would also be applied to screening for binding activity, e.g., ligands for these proteins. Several methods of automating assays have been developed in recent years so as to permit screening of tens of thousands of compounds per year. See, e.g., a BIOMEK automated workstation, Beckman Instruments, Palo Alto, California, and Fodor, et al . (1991) Science 251:767- 773, which is incorporated herein by reference. The latter describes means for testing binding by a plurality of defined polymers synthesized on a solid substrate. The development of suitable assays to screen for a ligand or agonist/antagonist homologous proteins can be greatly facilitated by the availability of large amounts of purified, soluble cytokine receptors in an active state such as is provided by this invention. Purified DCRS3 or DCRS4 can be coated directly onto plates for use in the aforementioned ligand screening techniques. However, non-neutralizing antibodies to these proteins can be used as capture antibodies to immobilize the respective receptor on the solid phase, useful, e.g., in diagnostic uses. This invention also contemplates use of DCRS3 or DCRS4 , fragments thereof, peptides, and their fusion products in a variety of diagnostic kits and methods for detecting the presence of the protein or its ligand. Alternatively, or additionally, antibodies against the molecules may be incorporated into the kits and methods. Typically the kit will have a compartment containing either a DCRS3 or DCRS4 peptide or gene segment or a reagent which recognizes one or the other. Typically, recognition reagents, in the case of peptide, would be a receptor or antibody, or in the case of a gene segment, would usually be a hybridization probe.
A preferred kit for determining the concentration of, e.g., DCRS3 in a sample would typically comprise a labeled compound, e.g., ligand or antibody, having known binding affinity for DCRS3, a source of DCRS3 (naturally occurring or recombinant) as a positive control, and a means for separating the bound from free labeled compound, for example a solid phase for immobilizing DCRS3 in the test sample. Compartments containing reagents, and instructions, will normally be provided. Appropriate nucleic acid or protein containing kits are also provided.
Antibodies, including antigen binding fragments, specific for mammalian DCRS3 or a peptide fragment, or receptor fragments are useful in diagnostic applications to detect the presence of elevated levels of ligand and/or its fragments. Diagnostic assays may be homogeneous (without a separation step between free reagent and antibody-antigen complex) or heterogeneous (with a separation step). Various commercial assays exist, such as radioimmunoassay (RIA) , enzyme-linked immunosorbent assay (ELISA) , enzyme immunoassay (EIA) , enzyme-multiplied immunoassay technique (EMIT) , substrate-labeled fluorescent immunoassay (SLFIA) and the like. For example, unlabeled antibodies can be employed by using a second antibody which is labeled and which recognizes the antibody to a cytokine receptor or to a particular fragment thereof. These assays have also been extensively discussed in the literature. See, e.g., Harlow and Lane (1988) Antibodies: A Laboratory Manual, CSH . , and Coligan (ed. 1991 and periodic supplements) Current Protocols In Immunology Greene/Wiley, New York.
Anti-idiotypic antibodies may have similar use to serve as agonists or antagonists of cytokine receptors. These should be useful as therapeutic reagents under appropriate circumstances. Frequently, the reagents for diagnostic assays are supplied in kits, so as to optimize the sensitivity of the assay. For the subject invention, depending upon the nature of the assay, the protocol, and the label, either labeled or unlabeled antibody, or labeled ligand is provided. This is usually in conjunction with other additives, such as buffers, stabilizers, materials necessary for signal production such as substrates for enzymes, and the like. Preferably, the kit will also contain instructions for proper use and disposal of the contents after use. Typically the kit has compartments for each useful reagent, and will contain instructions for proper use and disposal of reagents. Desirably, the reagents are provided as a dry lyophilized powder, where the reagents may be reconstituted in an aqueous medium having appropriate concentrations for performing the assay.
The aforementioned constituents of the diagnostic assays may be used without modification or may be modified in a variety of ways. For example, labeling may be achieved by covalently or non-covalently joining a moiety which directly or indirectly provides a detectable signal. In many of these assays, a test compound, cytokine receptor, or antibodies thereto can be labeled either directly or indirectly. Possibilities for direct labeling include label groups: radiolabels such as 125j/ enzymes (U.S. Pat. No. 3,645,090) such as peroxidase and alkaline phosphatase, and fluorescent labels (U.S. Pat. No. 3,940,475) capable of monitoring the change in fluorescence intensity, wavelength shift, or fluorescence polarization. Both of the patents are incorporated herein by reference. Possibilities for indirect labeling include biotinylation of one constituent followed by binding to avidin coupled to one of the above label groups .
There are also numerous methods of separating the bound from the free ligand, or alternatively the bound from the free test compound. The cytokine receptor can be immobilized on various matrixes followed by washing. Suitable matrices include plastic such as an ELISA plate, filters, and beads. Methods of immobilizing the receptor to a matrix include, without limitation, direct adhesion to plastic, use of a capture antibody, chemical coupling, and biotin-avidin. The last step in this approach involves the precipitation of antibody/antigen complex by any of several methods including those utilizing, e.g., an organic solvent such as polyethylene glycol or a salt such as ammonium sulfate. Other suitable separation techniques include, without limitation, the fluorescein antibody magnetizable particle method described in Rattle, et al . (1984) Clin. Chem. 30:1457-1461, and the double antibody magnetic particle separation as described in U.S. Pat. No. 4,659,678, each of which is incorporated herein by reference.
The methods for linking protein or fragments to various labels have been extensively reported in the literature and do not require detailed discussion here. Many of the techniques involve the use of activated carboxyl groups either through the use of carbodiimide or active esters to form peptide bonds, the formation of thioethers by reaction of a mercapto group with an activated halogen such as chloroacetyl , or an activated olefin such as maleimide, for linkage, or the like. Fusion proteins will also find use in these applications.
Another diagnostic aspect of this invention involves use of oligonucleotide or polynucleotide sequences taken from the sequence of an cytokine receptor. These sequences can be used as probes for detecting levels of the respective cytokine receptor in patients suspected of having an immunological disorder. The preparation of both RNA and DNA nucleotide sequences, the labeling of the sequences, and the preferred size of the sequences has received ample description and discussion in the literature. Normally an oligonucleotide probe should have at least about 14 nucleotides, usually at least about 18 nucleotides, and the polynucleotide probes may be up to several kilobases. Various labels may be employed, most commonly radionuclides, particularly 32p_ However, other techniques may also be employed, such as using biotin modified nucleotides for introduction into a polynucleotide. The biotin then serves as the site for binding to avidin or antibodies, which may be labeled with a wide variety of labels, such as radionuclides, fluorescers, enzymes, or the like. Alternatively, antibodies may be employed which can recognize specific duplexes, including DNA duplexes, RNA duplexes, DNA-RNA hybrid duplexes, or DNA-protein duplexes. The antibodies in turn may be labeled and the assay carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected. The use of probes to the novel anti- sense RNA may be carried out in conventional techniques such as nucleic acid hybridization, plus and minus screening, recombinational probing, hybrid released translation (HRT) , and hybrid arrested translation (HART) . This also includes amplification techniques such as polymerase chain reaction (PCR) .
Diagnostic kits which also test for the qualitative or quantitative presence of other markers are also contemplated. Diagnosis or prognosis may depend on the combination of multiple indications used as markers. Thus, kits may test for combinations of markers. See, e.g., Viallet, et al . (1989) Progress in Growth Factor Res. 1:89-97.
VIII. Therapeutic Utility
This invention provides reagents with significant therapeutic value. See, e.g., Levitzki (1996) Curr. Opin. Cell Biol . 8:239-244. The cytokine receptors (naturally occurring or recombinant), fragments thereof, mutein receptors, and antibodies, along with compounds identified as having binding affinity to the receptors or antibodies, should be useful in the treatment of conditions exhibiting abnormal expression of the receptors of their ligands. Such abnormality will typically be manifested by immunological disorders. Additionally, this invention should provide therapeutic value in various diseases or disorders associated with abnormal expression or abnormal triggering of response to the ligand. For example, the IL-1 ligands have been suggested to be involved in morphologic development, e.g., dorso-ventral polarity determination, and immune responses, particularly the primitive innate responses. See, e.g., Sun, et al . (1991) Eur. J. Biochem. 196:247-254; and Hultmark (1994) Nature 367:116-117.
Recombinant cytokine receptors, muteins, agonist or antagonist antibodies thereto, or antibodies can be purified and then administered to a patient. These reagents can be combined for therapeutic use with additional active ingredients, e.g., in conventional pharmaceutically acceptable carriers or diluents, along with physiologically innocuous stabilizers and excipients. These combinations can be sterile, e.g., filtered, and placed into dosage forms as by lyophilization in dosage vials or storage in stabilized aqueous preparations. This invention also contemplates use of antibodies or binding fragments thereof which are not complement binding. Ligand screening using cytokine receptor or fragments thereof can be performed to identify molecules having binding affinity to the receptors. Subsequent biological assays can then be utilized to determine if a putative ligand can provide competitive binding, which can block intrinsic stimulating activity. Receptor fragments can be used as a blocker or antagonist in that it blocks the activity of ligand. Likewise, a compound having intrinsic stimulating activity can activate the receptor and is thus an agonist in that it simulates the activity of ligand, e.g., inducing signaling. This invention further contemplates the therapeutic use of antibodies to cytokine receptors as antagonists.
The quantities of reagents necessary for effective therapy will depend upon many different factors, including means of administration, target site, reagent physiological life, pharmacological life, physiological state of the patient, and other medicants administered. Thus, treatment dosages should be titrated to optimize safety and efficacy. Typically, dosages used in vitro may provide useful guidance in the amounts useful for in situ administration of these reagents. Animal testing of effective doses for treatment of particular disorders will provide further predictive indication of human dosage. Various considerations are described, e.g., in Gilman, et al . (eds. 1990) Goodman and Gilman' s: The Pharmacological Bases of Therapeutics , 8th Ed., Pergamon Press; and Remington ' s Pharmaceutical Sciences. 17th ed. (1990), Mack Publishing Co., Easton, Penn . ; each of which is hereby incorporated herein by reference. Methods for administration are discussed therein and below, e.g., for oral, intravenous, intraperitoneal , or intramuscular administration, transdermal diffusion, and others. Pharmaceutically acceptable carriers will include water, saline, buffers, and other compounds described, e.g., in the Merck Index, Merck & Co., Rahway, New Jersey. Because of the likely high affinity binding, or turnover numbers, between a putative ligand and its receptors, low dosages of these reagents would be initially expected to be effective. And the signaling pathway suggests extremely low amounts of ligand may have effect. Thus, dosage ranges would ordinarily be expected to be in amounts lower than 1 mM concentrations, typically less than about 10 μM concentrations, usually less than about 100 nM, preferably less than about 10 pM (picomolar) , and most preferably less than about 1 fM (femtomolar) , with an appropriate carrier. Slow release formulations, or slow release apparatus will often be utilized for continuous administration.
Cytokine receptors, fragments thereof, and antibodies or its fragments, antagonists, and agonists, may be administered directly to the host to be treated or, depending on the size of the compounds, it may be desirable to conjugate them to carrier proteins such as ovalbumin or serum albumin prior to their administration. Therapeutic formulations may be administered in many conventional dosage formulations. While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical formulation. Formulations comprise at least one active ingredient, as defined above, together with one or more acceptable carriers thereof . Each carrier must be both pharmaceutically and physiologically acceptable in the sense of being compatible with the other ingredients and not injurious to the patient. Formulations include those suitable for oral, rectal, nasal, or parenteral (including subcutaneous, intramuscular, intravenous and intradermal) administration. The formulations may conveniently be presented in unit dosage form and may be prepared by methods well known in the art of pharmacy. See, e.g., Gilman, et al .
(eds. 1990) Goodman and Gilman' s: The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; and Remington' s Pharmaceutical Sciences, 17th ed. (1990), Mack Publishing Co., Easton, Penn.; Avis, et al . (eds. 1993) Pharmaceutical Dosage Forms: Parenteral Medications Dekker, NY; Lieberman, et al . (eds. 1990) Pharmaceutical Dosage Forms: Tablets Dekker, NY; and Lieberman, et al . (eds. 1990) Pharmaceutical Dosage Forms: Disperse Systems Dekker, NY. The therapy of this invention may be combined with or used in association with other therapeutic agents, particularly agonists or antagonists of other cytokine receptor family members.
IX. Screening
Drug screening using DCRS3 or DCRS4 or fragments thereof can be performed to identify compounds having binding affinity to the receptor subunit, including isolation of associated components. Subsequent biological assays can then be utilized to determine if the compound has intrinsic stimulating activity and is therefore a blocker or antagonist in that it blocks the activity of the ligand. Likewise, a compound having intrinsic stimulating activity can activate the receptor and is thus an agonist in that it simulates the activity of a cytokine ligand. This invention further contemplates the therapeutic use of antibodies to the receptor as cytokine agonists or antagonists.
Similarly, complexes comprising multiple proteins may be used to screen for ligands or reagents capable of recognizing the complex. Most cytokine receptors comprise at least two subunits, which may be the same, or distinct. Alternatively, the transmembrane receptor may bind to a complex comprising a cytokine-like ligand associated with another soluble protein serving, e.g., as a second receptor subunit. One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant DNA molecules expressing, e.g., a DCRS3 in combination with another cytokine receptor subunit. Cells may be isolated which express a receptor in isolation from other functional receptors. Such cells, either in viable or fixed form, can be used for standard antibody/antigen or ligand/receptor binding assays. See also, Parce, et al . (1989) Science 246:243-247; and Owicki, et al . (1990) Proc. Nat ' 1 Acad. Sci. USA 87:4007-4011, which describe sensitive methods to detect cellular responses. Competitive assays are particularly useful, where the cells (source of putative ligand) are contacted and incubated with a labeled receptor or antibody having known binding affinity to the ligand, such as 125 _ antibody, and a test sample whose binding affinity to the binding composition is being measured. The bound and free labeled binding compositions are then separated to assess the degree of ligand binding. The amount of test compound bound is inversely proportional to the amount of labeled receptor binding to the known source. Many techniques can be used to separate bound from free ligand to assess the degree of ligand binding. This separation step could typically involve a procedure such as adhesion to filters followed by washing, adhesion to plastic followed by washing, or centrifugation of the cell membranes. Viable cells could also be used to screen for the effects of drugs on cytokine mediated functions, e.g., second messenger levels, i.e., Ca++; cell proliferation; inositol phosphate pool changes; and others. Some detection methods allow for elimination of a separation step, e.g., a proximity sensitive detection system. Calcium sensitive dyes will be useful for detecting Ca++ levels, with a fluorimeter or a fluorescence cell sorting apparatus.
X. Ligands
The descriptions of DCRS3 or DCRS4 herein provide means to identify ligands, as described above. Such ligand should bind specifically to the respective receptor with reasonably high affinity. Various constructs are made available which allow either labeling of the receptor to detect its ligand. For example, directly labeling cytokine receptor, fusing onto it markers for secondary labeling, e.g., FLAG or other epitope tags, etc., will allow detection of receptor. This can be histological , as an affinity method for biochemical purification, or labeling or selection in an expression cloning approach. A two-hybrid selection system may also be applied making appropriate constructs with the available cytokine receptor sequences. See, e.g., Fields and Song (1989) Nature 340:245-246.
The broad scope of this invention is best understood with reference to the following examples, which are not intended to limit the inventions to the specific embodiments.
EXAMPLES
I . General Methods Some of the standard methods are described or referenced, e.g., in Maniatis, et al . (1982) Molecular Cloning, A Laboratory Manual , Cold Spring Harbor Laboratory, Cold Spring Harbor Press; Sambrook, et al . (1989) Molecular Cloning: A Laboratory Manual, (2d ed.), vols. 1-3, CSH Press, NY; or Ausubel, et al . (1987 and Supplements) Current Protocols in Molecular Biology,
Greene/Wiley, New York. Methods for protein purification include such methods as ammonium sulfate precipitation, column chromatography, electrophoresis, centrifugation, crystallization, and others. See, e.g., Ausubel, et al . (1987 and periodic supplements); Coligan, et al . (ed. 1996) and periodic supplements, Current Protocols In Protein Science Greene/Wiley, New York; Deutscher (1990) "Guide to Protein Purification" in Methods in Enzymology, vol. 182, and other volumes in this series; and manufacturer's literature on use of protein purification products, e.g., Pharmacia, Piscataway,
N.J., or Bio-Rad, Richmond, CA. Combination with recombinant techniques allow fusion to appropriate segments, e.g., to a FLAG sequence or an equivalent which can be fused via a protease- removable sequence. See, e.g., Hochuli (1990) "Purification of Recombinant Proteins with Metal Chelate Absorbent" in Setlow (ed.) Genetic Engineering, Principle and Methods 12:87-98, Plenum Press, N.Y.; and Crowe, et al . (1992) QIAexpress : The High Level Expression & Protein Purification System QUIAGEN, Inc., Chatsworth, CA. Computer sequence analysis is performed, e.g., using available software programs, including those from the GCG (U. Wisconsin) and GenBank sources. Public sequence databases were also used, e.g., from GenBank and others. Many techniques applicable to IL-10 receptors may be applied to DCRS3 or DCRS4 , as described, e.g., in USSN 08/110,683 (IL-10 receptor), which is incorporated herein by reference .
I I . Computational Analysis
Human sequences related to cytokine receptors were identified from genomic sequence database using, e.g., the BLAST server (Altschul, et al . (1994) Nature Genet . 6:119-129).
Standard analysis programs may be used to evaluate structure, e.g., PHD (Rost and Sander (1994) Proteins 19:55-72) and DSC (King and Sternberg (1996) Protein Sci. 5:2298-2310). Standard comparison software includes, e.g., Altschul, et al . (1990) J^ Mol . Biol. 215:403-10; Waterman (1995) Introduction to
Computational Biology: Maps, Sequences, and Genomes Chapman & Hall; Lander and Waterman (eds. 1995) Calculating the Secrets of Life: Applications of the Mathematical Sciences in Molecular Biology National Academy Press; and Speed and Waterman (eds. 1996) Genetic Mapping and DNA Sequencing (IMA Volumes in Mathematics and Its Applications, Vol 81) Springer Verlag.
III. Cloning of full-length DCRS3 or DCRS4 cDNAs ; Chromosomal localization PCR primers derived from DCRS3 or DCRS4 sequence are used to probe a human cDNA library. Sequences may be derived, e.g., from Table 1 or 3 , preferably those adjacent the ends of sequences. Full length cDNAs for primate, rodent, or other species are cloned, e.g., by DNA hybridization screening of λgtlO phage. PCR reactions are conducted using T. aquaticus Taqplus DNA polymerase (Stratagene) under appropriate conditions .
For experimental confirmation of localization, chromosome spreads are prepared. In situ hybridization is performed on chromosome preparations obtained from phytohemagglutinin- stimulated human lymphocytes cultured for 72 h. 5- bromodeoxyuridine was added for the final seven hours of culture (60 μg/ml of medium) , to ensure a posthybridization chromosomal banding of good quality. A PCR fragment, amplified with the help of primers, is cloned into an appropriate vector. The vector is labeled by nick-translation with 3H. The radiolabeled probe is hybridized to metaphase spreads at final concentration of 200 ng/ml of hybridization solution as described in Mattei, et al . (1985) Hum. Genet. 69:327-331.
After coating with nuclear track emulsion (KODAK NTB2), slides are exposed. To avoid any slipping of silver grains during the banding procedure, chromosome spreads are first stained with buffered Giemsa solution and metaphase photographed. R-banding is then performed by the fluorochrome- photolysis-Giemsa (FPG) method and metaphases rephotographed before analysis. Similar appropriate methods are used for other species.
IV. Localization of DCRS mRNA
Human multiple tissue (Cat# 1, 2) and cancer cell line blots (Cat# 7757-1), containing approximately 2 μg of poly(A)+ RNA per lane, are purchased from Clontech (Palo Alto, CA) . Probes are radiolabeled with [α-32P] dATP, e.g., using the Amersham Rediprime random primer labeling kit (RPN1633) . Prehybridization and hybridizations are performed, e.g., at 65° C in 0.5 M Na2HPθ4, 7% SDS, 0.5 M EDTA (pH 8.0). High stringency washes are conducted, e.g., at 65° C with two initial washes in 2 x SSC, 0.1% SDS for 40 min followed by a subsequent wash in 0.1 x SSC, 0.1% SDS for 20 min. Membranes are then exposed at -70° C to X-Ray film (Kodak) in the presence of intensifying screens. More detailed studies by cDNA library Southerns are performed with selected appropriate human DCRS3 clones to examine their expression in hemopoietic or other cell subsets .
Alternatively, two appropriate primers are selected from Tables 1 or 3. RT-PCR is used on an appropriate mRNA sample selected for the presence of message to produce a cDNA, e.g., a sample which expresses the gene.
Full length clones may be isolated by hybridization of cDNA libraries from appropriate tissues pre-selected by PCR signal. Northern blots can be performed. Message for genes encoding DCRS3 or DCRS4 will be assayed by appropriate technology, e.g., PCR, immunoassay, hybridization, or otherwise. Tissue and organ cDNA preparations are available, e.g., from Clontech, Mountain View, CA. Identification of sources of natural expression are useful, as described. And the identification of functional receptor subunit pairings will allow for prediction of what cells express the combination of receptor subunits which will result in a physiological responsiveness to each of the cytokine ligands.
For mouse distribution, e.g., Southern Analysis can be performed: DNA (5 μg) from a primary amplified cDNA library was digested with appropriate restriction enzymes to release the inserts, run on a 1% agarose gel and transferred to a nylon membrane (Schleicher and Schuell, Keene, NH) .
Samples for mouse mRNA isolation may include: resting mouse fibroblastic L cell line (C200) ; Braf:ER (Braf fusion to estrogen receptor) transfected cells, control (C201) ; T cells, THl polarized (Mell4 bright, CD4+ cells from spleen, polarized for 7 days with IFN-γ and anti IL-4; T200); T cells, TH2 polarized (Mell4 bright, CD4+ cells from spleen, polarized for 7 days with IL-4 and anti-IFN-γ; T201) ; T cells, highly THl polarized (see Openshaw, et al . (1995) J . Exp . Med . 182:1357- 1367; activated with anti-CD3 for 2, 6, 16 h pooled; T202); T cells, highly TH2 polarized (see Openshaw, et al . (1995) J . Exp . Med. 182:1357-1367; activated with anti-CD3 for 2, 6, 16 h pooled; T203) ; CD44- CD25+ pre T cells, sorted from thymus (T204) ; THl T cell clone Dl.l, resting for 3 weeks after last stimulation with antigen (T205); THl T cell clone Dl.l, 10 μg/ml ConA stimulated 15 h (T206) ; TH2 T cell clone CDC35, resting for 3 weeks after last stimulation with antigen (T207) ; TH2 T cell clone CDC35, 10 μg/ml ConA stimulated 15 h (T208) ; Mell44- naive T cells from spleen, resting (T209) ; Mell4+ T cells, polarized to Thl with IFN-γ/lL-12/anti-IL-4 for 6, 12, 24 h pooled (T210); Mell4+ T cells, polarized to Th2 with IL-4/anti-IFN-γ for 6, 13, 24 h pooled (T211) ; unstimulated mature B cell leukemia cell line A20 (B200) ; unstimulated B cell line CH12 (B201) ; unstimulated large B cells from spleen (B202); B cells from total spleen, LPS activated (B203); metrizamide enriched dendritic cells from spleen, resting (D200) ; dendritic cells from bone marrow, resting (D201) ; monocyte cell line RAW 264.7 activated with LPS 4 h (M200) ; bone-marrow macrophages derived with GM and M-CSF (M201) ; macrophage cell line J774, resting (M202) ; macrophage cell line J774 + LPS + anti-IL-10 at 0.5, 1, 3, 6, 12 h pooled (M203); macrophage cell line J774 + LPS + IL- 10 at 0.5, 1, 3, 5, 12 h pooled (M204) ; aerosol challenged mouse lung tissue, Th2 primers, aerosol OVA challenge 7, 14, 23 h pooled (see Garlisi, et al . (1995) Clinical Immunology and Immunopathology 75:75-83; X206) ; Nippostrongulus- in ected lung tissue (see Coffman, et al . (1989) Science 245:308-310; X200); total adult lung, normal (O200) ; total lung, rag-1 (see Schwarz, et al. (1993) Immunodeficiency 4:249-252; O205) ; IL-10 K.O. spleen (see Kuhn, et al . (1991) Cell 75:263-274; X201); total adult spleen, normal (O201) ; total spleen, rag-1 (O207) ; IL-10 K.O. Peyer's patches (O202); total Peyer ' s patches, normal (O210) ; IL-10 K.O. mesenteric lymph nodes (X203) ; total mesenteric lymph nodes, normal (0211); IL-10 K.O. colon (X203); total colon, normal (0212); NOD mouse pancreas (see Makino, et al. (1980) Jikken Dobutsu 29:1-13; X205) ; total thymus, rag-1 (O208) ; total kidney, rag-1 (O209) ; total heart, rag-1 (O202); total brain, rag-1 (O203) ; total testes, rag-1 (O204) ; total liver, rag-1 (O206) ; rat normal joint tissue (O300); and rat arthritic joint tissue (X300) .
Samples for human mRNA isolation may include: peripheral blood mononuclear cells (monocytes, T cells, NK cells, granulocytes, B cells), resting (T100); peripheral blood mononuclear cells, activated with anti-CD3 for 2, 6, 12 h pooled (T101) ; T cell, TH0 clone Mot 72, resting (T102); T cell, TH0 clone Mot 72, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T103); T cell, TH0 clone Mot 72, anergic treated with specific peptide for 2, 7, 12 h pooled (T104); T cell, THl clone HY06, resting (T107) ; T cell, THl clone HY06, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T108); T cell, THl clone HY06, anergic treated with specific peptide for 2, 6, 12 h pooled (T109) ; T cell, TH2 clone HY935, resting (T110) ; T cell, TH2 clone HY935, activated with anti-CD28 and anti-CD3 for 2, 7, 12 h pooled (Till) ; T cells CD4+CD45RO- T cells polarized 27 days in anti-CD28, IL-4, and anti IFN-γ, TH2 polarized, activated with anti-CD3 and anti-CD28 4 h (T116) ; T cell tumor lines Jurkat and Hut78, resting (T117) ; T cell clones, pooled AD130.2, Tc783.12, Tc783.13, Tc783.58, Tc782.69, resting (T118); T cell random γδ T cell clones, resting (T119) ; Splenocytes, resting (B100) ; Splenocytes, activated with anti-CD40 and IL-4 (B101) ; B cell EBV lines pooled WT49, RSB, JY, CVIR, 721.221, RM3 , HSY, resting (B102) ; B cell line JY, activated with PMA and ionomycin for 1, 6 h pooled (B103) ; NK 20 clones pooled, resting (K100) ; NK 20 clones pooled, activated with PMA and ionomycin for 6 h (K101) ; NKL clone, derived from peripheral blood of LGL leukemia patient, IL-2 treated (K106) ; NK cytotoxic clone 640-A30-1, resting (K107) ; hematopoietic precursor line TF1, activated with PMA and ionomycin for 1, 6 h pooled (C100) ; U937 premonocytic line, resting (M100) ; U937 premonocytic line, activated with PMA and ionomycin for 1, 6 h pooled (M101) ; elutriated monocytes, activated with LPS, IFNγ, anti-IL-10 for 1, 2, 6, 12, 24 h pooled (M102) ; elutriated monocytes, activated with LPS, IFNγ, IL-10 for 1, 2, 6, 12, 24 h pooled (M103); elutriated monocytes, activated with LPS, IFNγ, anti-IL-10 for 4, 16 h pooled (M106) ; elutriated monocytes, activated with LPS, IFNγ, IL-10 for 4, 16 h pooled (M107) ; elutriated monocytes, activated LPS for 1 h (M108) ; elutriated monocytes, activated LPS for 6 h (M109) ; DC 70% CDla+, from CD34+ GM-CSF, TNFα 12 days, resting (D101) ; DC 70% CDla+, from CD34+ GM-CSF, TNFα 12 days, activated with PMA and ionomycin for 1 hr (D102); DC 70% CDla+, from CD34+ GM-CSF, TNFα 12 days, activated with PMA and ionomycin for 6 hr (D103) ; DC 95% CDla+, from CD34+ GM-CSF, TNFα 12 days FACS sorted, activated with PMA and ionomycin for 1, 6 h pooled (D104) ; DC 95% CD14+, ex CD34+ GM-CSF, TNFα 12 days FACS sorted, activated with PMA and ionomycin 1 , 6 hr pooled (D105) ; DC CDla+ CD86+, from CD34+ GM-CSF, TNFα 12 days FACS sorted, activated with PMA and ionomycin for 1, 6 h pooled (D106) ; DC from monocytes GM- CSF, IL-4 5 days, resting (D107) ; DC from monocytes GM-CSF, IL-4 5 days, resting (D108) ; DC from monocytes GM-CSF, IL-4 5 days, activated LPS 4, 16 h pooled (D109) ; DC from monocytes GM-CSF, IL-4 5 days, activated TNFα, monocyte supe for 4, 16 h pooled (DUO) ; leiomyoma Lll benign tumor (X101) ; normal myometrium M5 (0115) ; malignant leiomyosarcoma GS1 (X103) ; lung fibroblast sarcoma line MRC5, activated with PMA and ionomycin for 1, 6 h pooled (C101) ; kidney epithelial carcinoma cell line CHA, activated with PMA and ionomycin for 1, 6 h pooled (C102) ; kidney fetal 28 wk male (O100) ; lung fetal 28 wk male (O101) ; liver fetal 28 wk male (O102) ; heart fetal 28 wk male (O103) ; brain fetal 28 wk male (0104) ; gallbladder fetal 28 wk male (0106) ; small intestine fetal 28 wk male (O107) ; adipose tissue fetal 28 wk male (O108) ; ovary fetal 25 wk female (0109) ; uterus fetal 25 wk female (O110); testes fetal 28 wk male (0111); spleen fetal 28 wk male (0112) ; adult placenta 28 wk (0113) ; and tonsil inflamed, from 12 year old (X100) .
Similar samples may isolated in other species for evaluation.
V. Cloning of species counterparts of DCRS3 or DCRS4
Various strategies are used to obtain species counterparts of DCRS3 or DCRS4, preferably from other primates or rodents. One method is by cross hybridization using closely related species DNA probes. It may be useful to go into evolutionarily similar species as intermediate steps. Another method is by using specific PCR primers based on the identification of blocks of similarity or difference between genes, e.g., areas of highly conserved or nonconserved polypeptide or nucleotide sequence. Antibody based screening methods are also available, e.g., in expression cloning.
VI . Production of mammalian DCRS3 or DCRS4 protein
An appropriate, e.g., GST, fusion construct is engineered for expression, e.g., in E . coli. For example, a mouse IGIF pGex plasmid is constructed and transformed into E. coli. Freshly transformed cells are grown, e.g., in LB medium containing 50 μg/ml ampicillin and induced with IPTG (Sigma, St. Louis, MO) . After overnight induction, the bacteria are harvested and the pellets containing, e.g., DCRS3 , protein are isolated. The pellets are homogenized, e.g., in TE buffer (50 mM Tris-base pH 8.0 , 10 mM EDTA and 2 mM pefabloc) in 2 liters. This material is passed through a microfluidizer (Microfluidics , Newton, MA) three times. The fluidized supernatant is spun down on a Sorvall GS-3 rotor for 1 h at 13,000 rpm. The resulting supernatant containing the cytokine receptor protein is filtered and passed over a glutathione-SEPHAROSE column equilibrated in 50 mM Tris-base pH 8.0. The fractions containing the DCRS3-GST fusion protein are pooled and cleaved, e.g., with thrombin (Enzyme Research Laboratories, Inc., South Bend, IN) . The cleaved pool is then passed over a Q-SEPHAROSE column equilibrated in 50 mM Tris-base. Fractions containing DCRS3 are pooled and diluted in cold distilled H2O, to lower the conductivity, and passed back over a fresh Q-Sepharose column, alone or in succession with an immunoaffinity antibody column. Fractions containing DCRS3 protein are pooled, aliquoted, and stored in the -70° C freezer.
Comparison of the CD spectrum with cytokine receptor protein may suggest that the protein is correctly folded. See Hazuda, et al . (1969) J. Biol. Chem. 264:1689-1693.
VII. Preparation of antibodies specific for DCRS3 or DCRS4 Inbred Balb/c mice are immunized intraperitoneally with recombinant forms of the protein, e.g., purified DCRS3 or stable transfected NIH-3T3 cells. Animals are boosted at appropriate time points with protein, with or without additional adjuvant, to further stimulate antibody production. Serum is collected, or hybridomas produced with harvested spleens.
Alternatively, Balb/c mice are immunized with cells transformed with the gene or fragments thereof, either endogenous or exogenous cells, or with isolated membranes enriched for expression of the antigen. Serum is collected at the appropriate time, typically after numerous further administrations. Various gene therapy techniques may be useful, e.g., in producing protein in situ, for generating an immune response. Serum or antibody preparations may be cross-absorbed or immunoselected to prepare substantially purified antibodies of defined specificity and high affinity. Monoclonal antibodies may be made. For example, splenocytes are fused with an appropriate fusion partner and hybridomas are selected in growth medium by standard procedures. Hybridoma supe atants are screened for the presence of antibodies which bind to DCRS3 , e.g., by ELISA or other assay. Antibodies which specifically recognize specific DCRS3 embodiments may also be selected or prepared.
In another method, synthetic peptides or purified protein are presented to an immune system to generate monoclonal or polyclonal antibodies. See, e.g., Coligan (ed. 1991) Current
Protocols in Immunology Wiley/Greene; and Harlow and Lane (1989) Antibodies: A Laboratory Manual Cold Spring Harbor Press. In appropriate situations, the binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods. Nucleic acids may also be introduced into cells in an animal to produce the antigen, which serves to elicit an immune response. See, e.g., Wang, et al .
(1993) Proc. Nat ' 1. Acad. Sci. 90:4156-4160; Barry, et al .
(1994) BioTechniques 16:616-619; and Xiang, et al . (1995) Immunity 2: 129-135.
VIII. Production of fusion proteins with DCRS
Various fusion constructs are made with DCRS. A portion of the appropriate gene is fused to an epitope tag, e.g., a FLAG tag, or to a two hybrid system construct. See, e.g., Fields and Song (1989) Nature 340:245-246.
The epitope tag may be used in an expression cloning procedure with detection with anti-FLAG antibodies to detect a binding partner, e.g., ligand for the respective cytokine receptor. The two hybrid system may also be used to isolate proteins which specifically bind to DCRS.
IX. Structure activity relationship
Information on the criticality of particular residues is determined using standard procedures and analysis. Standard mutagenesis analysis is performed, e.g., by generating many different variants at determined positions, e.g., at the positions identified above, and evaluating biological activities of the variants. This may be performed to the extent of determining positions which modify activity, or to focus on specific positions to determine the residues which can be substituted to either retain, block, or modulate biological activity.
Alternatively, analysis of natural variants can indicate what positions tolerate natural mutations. This may result from populational analysis of variation among individuals, or across strains or species. Samples from selected individuals are analyzed, e.g., by PCR analysis and sequencing. This allows evaluation of population polymorphisms.
X. Isolation of a ligand for DCRS A cytokine receptor can be used as a specific binding reagent to identify its binding partner, by taking advantage of its specificity of binding, much like an antibody would be used.
The binding receptor may be a heterodimer of receptor subunits; or may involve, e.g., a complex of the DCRS with another subunit. A binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods.
The binding composition is used to screen an expression library made from a cell line which expresses a binding partner, i.e., ligand, preferably membrane associated. Standard staining techniques are used to detect or sort surface expressed ligand, or surface expressing transformed cells are screened by panning.
Screening of intracellular expression is performed by various staining or immunofluorescence procedures. See also McMahan, et al. (1991) EMBO J. 10:2821-2832.
For example, on day 0, precoat 2-chamber permanox slides with 1 ml per chamber of fibronectin, 10 ng/ml in PBS, for 30 min at room temperature. Rinse once with PBS. Then plate COS cells at 2-3 x 10^ cells per chamber in 1.5 ml of growth media. Incubate overnight at 37°C.
On day 1 for each sample, prepare 0.5 ml of a solution of
66 μg/ml DEAE-dextran, 66 μM chloroquine, and 4 μg DNA in serum free DME. For each set, a positive control is prepared, e.g., of DCRS-FLAG cDNA at 1 and 1/200 dilution, and a negative mock. Rinse cells with serum free DME. Add the DNA solution and incubate 5 hr at 37°C. Remove the medium and add 0.5 ml 10% DMSO in DME for 2.5 min. Remove and wash once with DME. Add 1.5 ml growth medium and incubate overnight .
On day 2, change the medium. On days 3 or 4 , the cells are fixed and stained. Rinse the cells twice with Hank's Buffered Saline Solution (HBSS) and fix in 4% paraformaldehyde * (PFA) /glucose for 5 min. Wash 3X with HBSS. The slides may be stored at -80°C after all liquid is removed. For each chamber, 0.5 ml incubations are performed as follows. Add HBSS/saponin (0.1%) with 32 μl/ml of 1 M NaN3 for 20 min. Cells are then washed with HBSS/saponin IX. Add appropriate DCRS or DCRS/antibody complex to cells and incubate for 30 min. Wash cells twice with HBSS/saponin. If appropriate, add first antibody for 30 min. Add second antibody, e.g., Vector anti- mouse antibody, at 1/200 dilution, and incubate for 30 min. Prepare ELISA solution, e.g., Vector Elite ABC horseradish peroxidase solution, and preincubate for 30 min. Use, e.g., 1 drop of solution A (avidin) and 1 drop solution B (biotin) per 2.5 ml HBSS/saponin. Wash cells twice with HBSS/saponin. Add ABC HRP solution and incubate for 30 min. Wash cells twice with HBSS, second wash for 2 min, which closes cells. Then add Vector diaminobenzoic acid (DAB) for 5 to 10 min. Use 2 drops of buffer plus 4 drops DAB plus 2 drops of H2O2 per 5 ml of glass distilled water. Carefully remove chamber and rinse slide in water. Air dry for a few minutes, then add 1 drop of Crystal
Mount and a cover slip. Bake for 5 min at 85-90°C. Evaluate positive staining of pools and progressively subclone to isolation of single genes responsible for the binding .
Alternatively, receptor reagents are used to affinity purify or sort out cells expressing a putative ligand. See, e.g., Sambrook, et al . or Ausubel, et al .
Another strategy is to screen for a membrane bound receptor by panning. The receptor cDNA is constructed as described O
CO φ cn -. φ Φ XI 4-> cn 4H
-H U φ d ε cn 0
Φ Φ d TJ d X) d Φ Φ Φ -H -> CΛ x: rrj 0 Φ 4-1 rd ε
Xl B X! rd H Φ >, c. CO Pi u TJ -H XI c 0 υ 4-> rH rd XI rd
-H u C r-l -H Φ Φ 4-> r-H TJ u rH 4 5 o 5H Q 4-> rd rd 4-> 4-1 4-1 d r-l 0 TJ υ o ft O ε d φ rd J 0 -H C TJ
HI 0 rd d ω ε rrj 5-ι ft φ -H & E rd φ x XI XJ
-H Φ rrj 4J 4-> φ TJ υ
H ft 4-1 rd Tl d ε O >ι 5-ι rd d O - d a TJ d
U ft 0 Cn d O XI 0 υ Φ rd υ ι Φ cn Φ -H α. rd rd rd r-l . ^ CO -H > H r-l ft 4-) Φ φ U • XI fc φ d G TJ d » 4-1 d ft x; -H 54
4-1 u TJ c cn 1 d -H 0 c -H Φ -H 0 rd υ ε Φ
0 d Φ O Φ Φ TJ -H 0 φ -H -H ft U H H xi
Φ CO -H 4-> α φ 4 r-H S-i 4-> CO 0 Φ φ Φ rH φ a -H 4-) rd O α d υ φ m -H υ ft i-H A TJ
CO σ rd υ H r-H Φ rr X! υ r-H X! cn cn ft 4-) Φ φ a Φ SH Φ 5-4 U Φ Φ -H 4 ε 0 XI 4J
CO i-H ft ^ 4-> TJ r-H rd TJ Φ rd 4-1 4-1 d
>. Cfl Φ 0 cn υ • rd φ X) a 4-1 d x: X 0 0 Φ
X) o φ CO α cn t ) -H 4-> a TJ 0 rd H Φ CO 4-1 CO a -H ft -H • 5-ι rd ft -H CO 4 Φ
TS TJ 4-1 ft CO φ Φ ft 5-4 > CO 4-) 4-1 ε d 4 5H φ PL. O 0 rd cn A O O i-H -H d -H . 0 n Φ 0 ft
> I φ ~ 5-1 ft rd TJ 0 4-> Φ -l d φ rd -H O 4-1 H. d CO ft 5-4 a d -H -H 5-ι >ι 4-1 rd d
-H -) Φ 0 ft rrj φ ft O Tj -H 4-) ft rd rd > cn Φ m -. co Λ r-H υ d
. X υ a rd υ -H rd CO 5 Φ -H -H Φ rd υ 4-> φ P d > TJ -H Φ X. a Xl rd σi C cn -H 4-1 -H -H d 5-1 CO
• : 4-) tj d
4-t u Φ M. φ d 0 J rd rd 4-) 4-> XI Φ 0 Φ φ Φ 0 ε 0 -H x: φ c > H . H >
X) Φ -C 4-J H. υ 01 54 d TJ XI 4H 4-> rd
~ Φ > υ ft rrj Φ C rd r-l TJ ε -H φ 0 d x; ι Φ O -H -H Φ H. 4-> -H X! i-H c 0 5-ι TJ Φ
N a CO . υ X) r-H d υ rd Φ rd 5-1 TJ Φ Φ φ > 4-> ε -H H. d Φ i-H Φ -H rd U υ 4-1 Φ 4-1 4-> ft d rd d a Φ M. r-l Φ XI φ φ -H d CO r-l 4-1 -H o -H : d en XI υ XI rd 4-4 Φ d Cn i-H 0 ε υ 4-1
0 0 Φ O 4-1 d rd i-H φ 4-1 -H 5H 0 d -H -H cn Φ
-H υ 5-4 (U 4-) O 0 -l X! -H υ Φ -H -H J φ rH x: cn
4 Φ 0 -H υ Φ 4-1 4-> 4-> CO 54 r- 4-> 4-1
H. TJ c CO φ -H cn cn ft Φ rd rd φ r-l d
N ^ • rrj 0 cn 4-) 4-1 d rd cn 5-1 υ rd Φ XI a T Φ
-H ,d 4-> cn Φ -H Φ rd -H 0 -H ft CO d 4H d r-H υ CJ Φ r-H 4-> H. -H υ -H 4J cn ε . 4-1 Φ O -H 0 rd -H
-H -H a -H rd ft H. Φ 4 d rd XI -H TJ i Φ 4-> Φ TJ
XI xi 54 T) d r-\ X ft ft rd φ Ξs TJ 4-> 5-1 x; 0
0 S 4-J 0 0 O φ 0 cn 4-) 4 TJ 0 4-> Φ O 4-> TJ ε O Xl -H CO 5-1 -H X d Φ H ε ø o X! -H φ ε ω d - 4-> -H φ ft 5 υ φ 0 4-> 0 4-> X! rH i φ t-~ M Φ 0 4-) rd Cn Q< 0 -H rd : J d 4-) 4-1
*o -H υ C υ r-H rd r-H r-H φ 4 H d 4-) 4-> Φ 0 -H -H υ τi rd -H rd X! i-H r-H ε rd 0 rd -H d X. H s 4-) -H φ -. . o d 4-1 a Ol rd <C rd U ft 2 5 Φ -H 4-> d 4-1 rH
Φ -Q O 4 -H 4-> . ω -H rl 54 5-4 d 01 φ H ft o > -H -H CO r-H d CO r-H r-H 0 Φ rd U Φ d υ ε
O 0 4-> CO 5-4 ft φ tf i-H φ ft U TJ ft CO > 0 φ Φ rd
X) d a -H ε > U -H ; ft d rd ft Φ d rH 5π ft X rd rd 4-1 4-1 rd φ Q s -U rd -H ε rd TJ -H rd rd CO φ
LΠ o o

Claims

WHAT IS CLAIMED IS:
1. A composition of matter selected from: a) a substantially pure or recombinant DCRS3 polypeptide comprising at least three distinct nonoverlapping segments of at least four amino acids identical to segments of SEQ ID NO: 2 or 25; b) a substantially pure or recombinant DCRS3 polypeptide comprising at least two distinct nonoverlapping ' segments of at least five amino acids identical to segments of SEQ ID NO: 2 or 25; c) a natural sequence DCRS3 comprising mature SEQ ID NO: 2 or 25; d) a fusion polypeptide comprising DCRS3 sequence; e) a substantially pure or recombinant DCRS4 polypeptide comprising at least three distinct nonoverlapping segments of at least four amino acids identical to segments of SEQ ID NO: 5, 28, or 31; f) a substantially pure or recombinant DCRS4 polypeptide comprising at least two distinct nonoverlapping segments of at least five amino acids identical to segments of SEQ ID NO: 5, 28, or 31; g) a natural sequence DCRS4 comprising mature SEQ ID NO:
5, 28, or 31; or h) a fusion polypeptide comprising DCRS4 sequence.
2. The substantially pure or isolated antigenic DCRS3 or DCRS4 polypeptide of Claim 1, wherein said distinct nonoverlapping segments of identity: a) include one of at least eight amino acids; b) include one of at least four amino acids and a second of at least five amino acids; c) include at least three segments of at least four, five, and six amino acids, or d) include one of at least twelve amino acids.
3. The composition of matter of Claim 1, wherein said: a) DCRS3 polypeptide: i) comprises a mature sequence of Table 1; ii) is an unglycosylated form of DCRS3 ; iii) is from a primate, such as a human; iv) comprises at least seventeen amino acids of SEQ ID NO: 2 or 25; v) exhibits at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 2 or 25; vi) comprises a sequence of at least 3 amino acids on each side across an exon boundary; vii) is a natural allelic variant of DCRS3 ; viii) has a length at least about 30 amino acids; ix) exhibits at least two non-overlapping epitopes which are specific for a primate DCRS3 ; x) is glycosylated; xi) has a molecular weight of at least 30 kD with natural glycosylation; xii) is a synthetic polypeptide; xiii) is attached to a solid substrate; xiv) is conjugated to another chemical moiety; xv) is a 5-fold or less substitution from natural sequence; or xvi) is a deletion or insertion variant from a natural sequence; or CRS4 polypeptide: i) comprises a mature sequence of Table 3 ; ii) is an unglycosylated form of DCRS4 ; iii) is from a primate, such as a human; iv) comprises at least seventeen amino acids of SEQ ID NO: 5, 28, or 31; v) exhibits at least four nonoverlapping segments of at least seven amino acids of SEQ ID NO: 5, 28, or 31; vi) comprises a sequence of at least 3 amino acids on each side across an exon boundary; vii) is a natural allelic variant of DCRS4 ; viii) has a length at least about 30 amino acids; ix) exhibits at least two non-overlapping epitopes which are specific for a primate DCRS4 ; x) is glycosylated; xi) has a molecular weight of at least 30 kD with natural glycosylation; xii) is a synthetic polypeptide; xiii) is attached to a solid substrate; xiv) is conjugated to another chemical moiety; xv) is a 5-fold or less substitution from natural sequence; or xvi) is a deletion or insertion variant from a natural sequence .
4. A composition comprising: a) a substantially pure DCRS3 and another cytokine receptor family member; b) a sterile DCRS3 polypeptide of Claim 1 ; c) said DCRS3 polypeptide of Claim 1 and a carrier, wherein said carrier is: i) an aqueous compound, including water, saline, and/or buffer; and/or ii) formulated for oral, rectal, nasal, topical, or parenteral administration; or d) a substantially pure DCRS4 and another cytokine receptor family member; e) a sterile DCRS4 polypeptide of Claim 1 ; f) said DCRS4 polypeptide of Claim 1 and a carrier, wherein said carrier is: i) an aqueous compound, including water, saline, and/or buffer; and/or ii) formulated for oral, rectal, nasal, topical, or parenteral administration.
5. The fusion polypeptide of Claim 1, comprising: a) mature protein sequence of Table 1; b) mature protein sequence of Table 1; c) a detection or purification tag, including a FLAG,
His6, or Ig sequence; or d) sequence of another cytokine receptor protein.
6. A kit comprising a polypeptide of Claim 1, and: a) a compartment comprising said protein or polypeptide; or b) instructions for use or disposal of reagents in said kit.
7. A binding compound comprising an antigen binding site from an antibody, which specifically binds to a natural :
A) DCRS3 polypeptide of Claim 1, wherein: a) said binding compound is in a container; b) said polypeptide is from a human; c) said binding compound is an Fv, Fab, or Fab2 fragment; d) said binding compound is conjugated to another chemical moiety; or e) said antibody: i) is raised against a peptide sequence of a mature polypeptide of Table 1 ; ii) is raised against a mature DCRS3; iii) is raised to a purified human DCRS3 ; iv) is immunoselected; v) is a polyclonal antibody; vi) binds to a denatured DCRS3 ; vii) exhibits a Kd to antigen of at least 30 μM; viii) is attached to a solid substrate, including a bead or plastic membrane ; ix) is in a sterile composition; or x) is detectably labeled, including a radioactive or fluorescent label; or
B) DCRS4 polypeptide of Claim 1, wherein: a) said binding compound is in a container; b) said polypeptide is from a human; c) said binding compound is an Fv, Fab, or Fab2 fragment; d) said binding compound is conjugated to another chemical moiety; or e) said antibody: i) is raised against a peptide sequence of a mature polypeptide of Table 3; ii) is raised against a mature DCRS4 ; iii) is raised to a purified human DCRS4; iv) is immunoselected; v) is a polyclonal antibody; * vi) binds to a denatured DCRS4 ; vii) exhibits a Kd to antigen of at least 30 μM; viii) is attached to a solid substrate, including a bead or plastic membrane; ix) is in a sterile composition; or x) is detectably labeled, including a radioactive or fluorescent label .
8. A kit comprising said binding compound of Claim 7, and: a) a compartment comprising said binding compound; or b) instructions for use or disposal of reagents in said kit.
9. A method of producing an antigen : antibody complex, comprising contacting under appropriate conditions a primate: a) DCRS3 polypeptide with an antibody of Claim 7, thereby allowing said complex to form; or b) DCRS4 polypeptide with an antibody of Claim 7, thereby allowing said complex to form.
10. The method of Claim 9, wherein: a) said complex is purified from other cytokine receptors; b) said complex is purified from other antibody; c) said contacting is with a sample comprising an interferon; d) said contacting allows quantitative detection of said antigen; e) said contacting is with a sample comprising said antibody; or f) said contacting allows quantitative detection of said antibody.
11. A composition comprising: a) a sterile binding compound of Claim 7, or b) said binding compound of Claim 7 and a carrier, wherein said carrier is: i) an aqueous compound, including water, saline, and/or buffer; and/or ii) formulated for oral, rectal, nasal, topical, or parenteral administration.
12. An isolated or recombinant nucleic acid encoding said:
A) DCRS3 polypeptide of Claim 1, wherein said: a) DCRS3 is from a human; or b) said nucleic acid: i) encodes an antigenic peptide sequence of Table 1 ; ii) encodes a plurality of antigenic peptide sequences of Table 1 ; iii) exhibits identity over at least thirteen nucleotides to a natural cDNA encoding said segment ; iv) is an expression vector; v) further comprises an origin of replication; vi) is from a natural source; vii) comprises a detectable label; viii) comprises synthetic nucleotide sequence; ix) is less than 6 kb, preferably less than 3 kb; x) is from a primate; xi) comprises a natural full length coding sequence; xii) is a hybridization probe for a gene encoding said DCRS3 ; or xiii) is a PCR primer, PCR product, or mutagenesis primer; or
B) DCRS4 polypeptide of Claim 1, wherein said: a) DCRS4 is from a human; or b) said nucleic acid: i) encodes an antigenic peptide sequence of Table 3; ii) encodes a plurality of antigenic peptide sequences of Table 3 ; iii) exhibits identity over at least thirteen nucleotides to a natural cDNA encoding said segment ; iv) is an expression vector; v) further comprises an origin of replication; vi) is from a natural source; vii) comprises a detectable label; viii) comprises synthetic nucleotide sequence; ix) is less than 6 kb, preferably less than 3 kb; x) is from a primate; xi) comprises a natural full length coding sequence ; xii) is a hybridization probe for a gene encoding said DCRS4 ; or xiii) is a PCR primer, PCR product, or mutagenesis primer.
13. A cell or tissue comprising said recombinant nucleic acid of Claim 12.
14. The cell of Claim 13, wherein said cell is: a) a prokaryotic cell; b) a eukaryotic cell; c) a bacterial cell; d) a yeast cell; e) an insect cell; f) a mammalian cell; g) a mouse cell; h) a primate cell; or i) a human cell.
15. A kit comprising said nucleic acid of Claim 12, and: a) a compartment comprising said nucleic acid; b) a compartment further comprising a primate DCRS3 or DCRS4 polypeptide; or c) instructions for use or disposal of reagents in said kit.
16. A nucleic acid which: a) hybridizes under wash conditions of 30 minutes at 30° C and less than 2M salt to the coding portion of SEQ ID
NO: 1 or 24; or b) exhibits identity over a stretch of at least about 30 nucleotides to a primate DCRS3 ; a) hybridizes under wash conditions of 30 minutes at 30° C and less than 2M salt to the coding portion of SEQ ID
NO: 4, 27, or 30; or b) exhibits identity over a stretch of at least about 30 nucleotides to a primate DCRS4.
17. The nucleic acid of Claim 16, wherein: a) said wash conditions are at 45° C and/or 500 mM salt; or b) said stretch is at least 55 nucleotides.
18. The nucleic acid of Claim 16, wherein: a) said wash conditions are at 55° C and/or 150 mM salt; or b) said stretch is at least 75 nucleotides.
19. A method of modulating physiology or development of a cell or tissue culture cells comprising contacting said cell with an agonist or antagonist of a mammalian DCRS3 or DCRS4.
20. The method of Claim 19, wherein said cell is transformed with a nucleic acid encoding a DCRS3 or DCRS4 and another cytokine receptor subunit .
EP00982122A 1999-11-18 2000-11-16 Mammalian receptor proteins; related reagents and methods Withdrawn EP1230368A2 (en)

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US44306099A 1999-11-18 1999-11-18
US443060 1999-11-18
US17032099P 1999-12-13 1999-12-13
US170320P 1999-12-13
PCT/US2000/031363 WO2001036467A2 (en) 1999-11-18 2000-11-16 Mammalian receptor proteins; related reagents and methods

Publications (1)

Publication Number Publication Date
EP1230368A2 true EP1230368A2 (en) 2002-08-14

Family

ID=26865975

Family Applications (1)

Application Number Title Priority Date Filing Date
EP00982122A Withdrawn EP1230368A2 (en) 1999-11-18 2000-11-16 Mammalian receptor proteins; related reagents and methods

Country Status (6)

Country Link
EP (1) EP1230368A2 (en)
JP (1) JP2003523179A (en)
AU (1) AU1919201A (en)
CA (1) CA2392109A1 (en)
MX (1) MXPA02005058A (en)
WO (1) WO2001036467A2 (en)

Families Citing this family (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6057128A (en) 1998-03-17 2000-05-02 Genetics Institute, Inc. MU-1, member of the cytokine receptor family
US7198789B2 (en) 1998-03-17 2007-04-03 Genetics Institute, Llc Methods and compositions for modulating interleukin-21 receptor activity
CA2393369A1 (en) 1999-12-03 2001-06-07 Zymogenetics, Inc. Human cytokine receptor
US20030170823A1 (en) 1999-12-23 2003-09-11 Presnell Scott R. Novel cytokine ZCYTO18
EP2177616B1 (en) 2000-08-08 2012-02-29 ZymoGenetics, Inc. Soluble zcytor 11 cytokine receptors
US7268223B2 (en) 2000-09-22 2007-09-11 Wyeth Isolated nucleic acid molecules which encode a soluble IL-TIF receptor or binding protein which binds to IL-TIF/IL-22, and uses thereof
US7094570B2 (en) 2003-03-11 2006-08-22 Ludwig Institute For Cancer Research Isolated nucleic acid molecules which encode a soluble IL-TIF/IL-22 receptor or binding protein which binds to IL-TIF/IL-22, and uses thereof
EP1191035A3 (en) * 2000-09-25 2002-04-17 Schering Aktiengesellschaft Three members of the cytokin-receptor class II family
EP1404831A2 (en) * 2001-01-12 2004-04-07 Genetics Institute, LLC Type 2 cytokine receptor and nucleic acids encoding same
WO2002070655A2 (en) 2001-03-02 2002-09-12 Zymogenetics, Inc. Mouse cytokine receptor
CA2439961A1 (en) * 2001-03-27 2002-10-03 Zymogenetics, Inc. Human cytokine receptor
EP1546358A4 (en) 2002-03-22 2006-06-07 Zymogenetics Inc Anti-il-tif antibodies and methods of using in inflammation
GB0216661D0 (en) * 2002-07-17 2002-08-28 Ares Trading Sa Protein
DE602004025332D1 (en) 2003-03-14 2010-03-18 Wyeth Corp ANTIBODY TO IL21 RECEPTOR AND ITS USE
EP1606317B1 (en) 2003-03-24 2010-07-28 ZymoGenetics, Inc. Anti-il-22ra antibodies and binding partners and methods of using in inflammation
EA015706B1 (en) 2004-10-22 2011-10-31 Займоджинетикс, Инк. Monoclonal antibody or its fragment, binding to il-22ra polypeptide, humanized antibody derived from said antibody, hybridomas and use of said antibody
AU2006342792A1 (en) 2005-12-02 2007-11-08 Genentech, Inc. Compositions and methods for the treatment of diseases and disorders associated with cytokine signaling involving antibodies that bind to IL-22 and IL-22R
US12012441B2 (en) 2020-10-26 2024-06-18 Neptune Biosciences Llc Engineered human IL-21 cytokines and methods for using the same
WO2023187201A1 (en) * 2022-04-01 2023-10-05 Universite Catholique De Louvain Thrombopoietin receptor fragments and uses thereof

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2011450C (en) * 1989-03-07 2002-06-04 Tadatsugu Taniguchi Recombinant b-chain of the il-2 receptor
US5945511A (en) * 1997-02-20 1999-08-31 Zymogenetics, Inc. Class II cytokine receptor
US5965704A (en) * 1997-08-05 1999-10-12 Zymogenetics, Inc. Class two cytokine receptor-11
AU2661199A (en) * 1998-02-06 1999-08-23 Schering Corporation Mammalian receptor proteins; related reagents and methods
AU5104799A (en) * 1998-08-04 2000-02-28 Regeneron Pharmaceuticals, Inc. Novel orphan cytokine receptors
WO2000027882A1 (en) * 1998-11-06 2000-05-18 Smithkline Beecham Corporation Hnovilr
AU5142300A (en) * 1999-05-18 2000-12-05 Millennium Pharmaceuticals, Inc. Il-9/il-2 receptor-like molecules and uses thereof
CA2393369A1 (en) * 1999-12-03 2001-06-07 Zymogenetics, Inc. Human cytokine receptor
JP2003524415A (en) * 1999-12-23 2003-08-19 ザイモジェネティクス,インコーポレイティド Cytokine ZCYTO18

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0136467A2 *

Also Published As

Publication number Publication date
JP2003523179A (en) 2003-08-05
WO2001036467A2 (en) 2001-05-25
MXPA02005058A (en) 2002-11-07
AU1919201A (en) 2001-05-30
CA2392109A1 (en) 2001-05-25
WO2001036467A3 (en) 2002-05-10

Similar Documents

Publication Publication Date Title
US7510853B2 (en) Nucleic acids encoding DCRS5
US20050009145A1 (en) Mammalian receptor proteins; related reagents and methods
EP1315743A2 (en) Mammalian genes; related reagents and methods
AU2001261351A1 (en) Mammalian receptor proteins; related reagents and methods
WO1999040195A1 (en) Mammalian receptor proteins; related reagents and methods
WO2001036467A2 (en) Mammalian receptor proteins; related reagents and methods
JP2015007129A (en) Mammalian receptor proteins; related reagents and methods
WO1999046379A2 (en) Human receptor proteins; related reagents and methods
US7812126B2 (en) DIRS1 polypeptides
US6326472B1 (en) Human receptor proteins; related reagents and methods
US20050106673A1 (en) Mammalian receptor proteins; related reagents and methods
AU2007202362B2 (en) Mammalian receptor proteins; related reagents and methods
MXPA00008848A (en) Human receptor proteins;related reagents and methods

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20020517

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Free format text: AL;LT;LV;MK;RO PAYMENT 20020517;SI PAYMENT 20020517

17Q First examination report despatched

Effective date: 20040813

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20050224