EP1171623A2 - Production of attenuated negative stranded rna virus vaccines - Google Patents
Production of attenuated negative stranded rna virus vaccinesInfo
- Publication number
- EP1171623A2 EP1171623A2 EP00922075A EP00922075A EP1171623A2 EP 1171623 A2 EP1171623 A2 EP 1171623A2 EP 00922075 A EP00922075 A EP 00922075A EP 00922075 A EP00922075 A EP 00922075A EP 1171623 A2 EP1171623 A2 EP 1171623A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- virus
- recombinant
- stranded rna
- rsv
- negative stranded
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 241000700605 Viruses Species 0.000 title claims abstract description 573
- 230000002238 attenuated effect Effects 0.000 title claims abstract description 188
- 238000004519 manufacturing process Methods 0.000 title claims description 7
- 229960005486 vaccine Drugs 0.000 title abstract description 75
- 230000035772 mutation Effects 0.000 claims abstract description 422
- 241001493065 dsRNA viruses Species 0.000 claims abstract description 202
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 74
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 74
- 239000002157 polynucleotide Substances 0.000 claims abstract description 74
- 208000015181 infectious disease Diseases 0.000 claims abstract description 70
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims abstract description 34
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims abstract description 34
- 230000028993 immune response Effects 0.000 claims abstract description 26
- 241000725643 Respiratory syncytial virus Species 0.000 claims description 324
- 108090000623 proteins and genes Proteins 0.000 claims description 319
- 235000001014 amino acid Nutrition 0.000 claims description 187
- 238000000034 method Methods 0.000 claims description 138
- 102000004169 proteins and genes Human genes 0.000 claims description 138
- 235000018102 proteins Nutrition 0.000 claims description 129
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 124
- 238000006467 substitution reaction Methods 0.000 claims description 119
- 101001065501 Escherichia phage MS2 Lysis protein Proteins 0.000 claims description 92
- 230000003612 virological effect Effects 0.000 claims description 73
- 241000711408 Murine respirovirus Species 0.000 claims description 72
- 239000002773 nucleotide Substances 0.000 claims description 70
- 125000003729 nucleotide group Chemical group 0.000 claims description 70
- 241000712079 Measles morbillivirus Species 0.000 claims description 56
- 241000282414 Homo sapiens Species 0.000 claims description 54
- 210000004027 cell Anatomy 0.000 claims description 40
- COLNVLDHVKWLRT-QMMMGPOBSA-N phenylalanine group Chemical group N[C@@H](CC1=CC=CC=C1)C(=O)O COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 claims description 38
- 238000012217 deletion Methods 0.000 claims description 36
- 230000037430 deletion Effects 0.000 claims description 36
- 238000003780 insertion Methods 0.000 claims description 35
- 230000037431 insertion Effects 0.000 claims description 35
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 claims description 35
- 241001559185 Mammalian rubulavirus 5 Species 0.000 claims description 34
- 230000002458 infectious effect Effects 0.000 claims description 34
- 241000711386 Mumps virus Species 0.000 claims description 33
- 101710117545 C protein Proteins 0.000 claims description 32
- 241000711798 Rabies lyssavirus Species 0.000 claims description 32
- 241000711975 Vesicular stomatitis virus Species 0.000 claims description 30
- 230000014509 gene expression Effects 0.000 claims description 30
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 claims description 29
- 241000711404 Avian avulavirus 1 Species 0.000 claims description 29
- 241000712083 Canine morbillivirus Species 0.000 claims description 29
- 208000002606 Paramyxoviridae Infections Diseases 0.000 claims description 28
- 230000008859 change Effects 0.000 claims description 28
- 241000711920 Human orthopneumovirus Species 0.000 claims description 26
- 230000012010 growth Effects 0.000 claims description 26
- 108090000288 Glycoproteins Proteins 0.000 claims description 25
- 239000000203 mixture Substances 0.000 claims description 25
- 101710133291 Hemagglutinin-neuraminidase Proteins 0.000 claims description 23
- 108010067390 Viral Proteins Proteins 0.000 claims description 23
- 230000002163 immunogen Effects 0.000 claims description 23
- 230000004048 modification Effects 0.000 claims description 22
- 238000012986 modification Methods 0.000 claims description 22
- 230000035945 sensitivity Effects 0.000 claims description 21
- 241000283690 Bos taurus Species 0.000 claims description 20
- 241000894007 species Species 0.000 claims description 20
- 230000005847 immunogenicity Effects 0.000 claims description 18
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 15
- 102000003886 Glycoproteins Human genes 0.000 claims description 14
- 238000007792 addition Methods 0.000 claims description 14
- 239000002245 particle Substances 0.000 claims description 14
- 241001529936 Murinae Species 0.000 claims description 13
- 229910052698 phosphorus Inorganic materials 0.000 claims description 13
- 108091006027 G proteins Proteins 0.000 claims description 11
- 102000030782 GTP binding Human genes 0.000 claims description 11
- 108091000058 GTP-Binding Proteins 0.000 claims description 11
- 229910052799 carbon Inorganic materials 0.000 claims description 11
- 230000036961 partial effect Effects 0.000 claims description 11
- 201000010099 disease Diseases 0.000 claims description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 10
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 10
- 229910052757 nitrogen Inorganic materials 0.000 claims description 10
- 101710118188 DNA-binding protein HU-alpha Proteins 0.000 claims description 9
- 101710085938 Matrix protein Proteins 0.000 claims description 9
- 101710127721 Membrane protein Proteins 0.000 claims description 9
- 101710144128 Non-structural protein 2 Proteins 0.000 claims description 9
- 101710199667 Nuclear export protein Proteins 0.000 claims description 9
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 9
- 108020004705 Codon Proteins 0.000 claims description 8
- 101150095629 NS2 gene Proteins 0.000 claims description 8
- 230000000295 complement effect Effects 0.000 claims description 8
- 230000001105 regulatory effect Effects 0.000 claims description 8
- 230000002103 transcriptional effect Effects 0.000 claims description 8
- 241001519465 Avian metapneumovirus Species 0.000 claims description 7
- 101150107578 SH gene Proteins 0.000 claims description 7
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 7
- 239000004473 Threonine Substances 0.000 claims description 7
- 230000008707 rearrangement Effects 0.000 claims description 7
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 7
- 241000711895 Bovine orthopneumovirus Species 0.000 claims description 6
- 101710128560 Initiator protein NS1 Proteins 0.000 claims description 6
- 101710144127 Non-structural protein 1 Proteins 0.000 claims description 6
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 claims description 6
- 101710130262 Probable Vpr-like protein Proteins 0.000 claims description 6
- 239000013604 expression vector Substances 0.000 claims description 6
- 229960000310 isoleucine Drugs 0.000 claims description 6
- 101150062031 L gene Proteins 0.000 claims description 5
- 235000004279 alanine Nutrition 0.000 claims description 5
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 5
- 101150082239 G gene Proteins 0.000 claims description 4
- 210000000987 immune system Anatomy 0.000 claims description 4
- 210000004671 cell-free system Anatomy 0.000 claims description 3
- 241000271566 Aves Species 0.000 claims description 2
- 101150033828 NS1 gene Proteins 0.000 claims description 2
- 230000004936 stimulating effect Effects 0.000 claims description 2
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 claims 3
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 claims 3
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 claims 3
- 208000003265 stomatitis Diseases 0.000 claims 2
- 208000005925 vesicular stomatitis Diseases 0.000 claims 2
- 101150034814 F gene Proteins 0.000 claims 1
- 150000001413 amino acids Chemical group 0.000 abstract description 78
- 238000012546 transfer Methods 0.000 abstract description 24
- 241000712003 Human respirovirus 3 Species 0.000 description 95
- 230000010076 replication Effects 0.000 description 73
- 229940024606 amino acid Drugs 0.000 description 69
- 210000002345 respiratory system Anatomy 0.000 description 45
- 241000699800 Cricetinae Species 0.000 description 37
- 241001465754 Metazoa Species 0.000 description 34
- 108700026244 Open Reading Frames Proteins 0.000 description 34
- 241000711513 Mononegavirales Species 0.000 description 30
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 28
- 241000282579 Pan Species 0.000 description 23
- 101710141454 Nucleoprotein Proteins 0.000 description 21
- 239000002299 complementary DNA Substances 0.000 description 21
- 238000002703 mutagenesis Methods 0.000 description 21
- 231100000350 mutagenesis Toxicity 0.000 description 21
- 210000002966 serum Anatomy 0.000 description 21
- 238000002474 experimental method Methods 0.000 description 18
- 238000002864 sequence alignment Methods 0.000 description 18
- 210000004072 lung Anatomy 0.000 description 17
- 239000013612 plasmid Substances 0.000 description 17
- 229940125575 vaccine candidate Drugs 0.000 description 16
- 230000004075 alteration Effects 0.000 description 15
- 230000000694 effects Effects 0.000 description 15
- 238000013518 transcription Methods 0.000 description 15
- 230000035897 transcription Effects 0.000 description 15
- 238000004458 analytical method Methods 0.000 description 14
- 239000012634 fragment Substances 0.000 description 14
- 241000282412 Homo Species 0.000 description 13
- 241000726041 Human respirovirus 1 Species 0.000 description 13
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 13
- 125000000539 amino acid group Chemical group 0.000 description 13
- 238000004113 cell culture Methods 0.000 description 13
- 230000002068 genetic effect Effects 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- 230000001681 protective effect Effects 0.000 description 13
- 241000282552 Chlorocebus aethiops Species 0.000 description 12
- 241000711902 Pneumovirus Species 0.000 description 12
- 108010008038 Synthetic Vaccines Proteins 0.000 description 12
- 238000005516 engineering process Methods 0.000 description 12
- 229940124551 recombinant vaccine Drugs 0.000 description 12
- 230000002441 reversible effect Effects 0.000 description 12
- 210000001944 turbinate Anatomy 0.000 description 12
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 11
- 241001113283 Respirovirus Species 0.000 description 11
- 108700005077 Viral Genes Proteins 0.000 description 11
- 230000002829 reductive effect Effects 0.000 description 11
- 238000001890 transfection Methods 0.000 description 11
- 238000011161 development Methods 0.000 description 10
- 230000003053 immunization Effects 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 230000009467 reduction Effects 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 241000712045 Morbillivirus Species 0.000 description 9
- 206010061603 Respiratory syncytial virus infection Diseases 0.000 description 9
- 241001533467 Rubulavirus Species 0.000 description 9
- 239000013553 cell monolayer Substances 0.000 description 9
- 238000002649 immunization Methods 0.000 description 9
- 108020004999 messenger RNA Proteins 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 8
- 201000005505 Measles Diseases 0.000 description 8
- 241000282577 Pan troglodytes Species 0.000 description 8
- 239000000427 antigen Substances 0.000 description 8
- 108091007433 antigens Proteins 0.000 description 8
- 102000036639 antigens Human genes 0.000 description 8
- 108091036078 conserved sequence Proteins 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 230000003472 neutralizing effect Effects 0.000 description 8
- 230000007505 plaque formation Effects 0.000 description 8
- 238000011144 upstream manufacturing Methods 0.000 description 8
- 230000001018 virulence Effects 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 101710181008 P protein Proteins 0.000 description 7
- 241000711504 Paramyxoviridae Species 0.000 description 7
- 101710177166 Phosphoprotein Proteins 0.000 description 7
- 206010035664 Pneumonia Diseases 0.000 description 7
- 238000011084 recovery Methods 0.000 description 7
- 108091008146 restriction endonucleases Proteins 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- 238000013519 translation Methods 0.000 description 7
- 108091026890 Coding region Proteins 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 241001559187 Human rubulavirus 2 Species 0.000 description 6
- 241000711502 Paramyxovirinae Species 0.000 description 6
- 108010089430 Phosphoproteins Proteins 0.000 description 6
- 102000007982 Phosphoproteins Human genes 0.000 description 6
- 241000711904 Pneumoviridae Species 0.000 description 6
- 238000012300 Sequence Analysis Methods 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 6
- 108020000999 Viral RNA Proteins 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 6
- 238000010171 animal model Methods 0.000 description 6
- 230000005875 antibody response Effects 0.000 description 6
- 230000000890 antigenic effect Effects 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 230000036039 immunity Effects 0.000 description 6
- 230000001976 improved effect Effects 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 230000008520 organization Effects 0.000 description 6
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 238000003757 reverse transcription PCR Methods 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 230000029812 viral genome replication Effects 0.000 description 6
- 241000282693 Cercopithecidae Species 0.000 description 5
- 241001115402 Ebolavirus Species 0.000 description 5
- 241000711950 Filoviridae Species 0.000 description 5
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- 101150046652 M2 gene Proteins 0.000 description 5
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 5
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 5
- -1 NS 1 Proteins 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 102100034574 P protein Human genes 0.000 description 5
- 241000711931 Rhabdoviridae Species 0.000 description 5
- 208000036071 Rhinorrhea Diseases 0.000 description 5
- 206010039101 Rhinorrhoea Diseases 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- 241000144282 Sigmodon Species 0.000 description 5
- 241001559173 Simian rubulavirus Species 0.000 description 5
- 101710137500 T7 RNA polymerase Proteins 0.000 description 5
- 238000002679 ablation Methods 0.000 description 5
- 230000027455 binding Effects 0.000 description 5
- 238000012512 characterization method Methods 0.000 description 5
- 210000005220 cytoplasmic tail Anatomy 0.000 description 5
- 238000011156 evaluation Methods 0.000 description 5
- 239000002054 inoculum Substances 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 230000003505 mutagenic effect Effects 0.000 description 5
- 238000012809 post-inoculation Methods 0.000 description 5
- 108020001580 protein domains Proteins 0.000 description 5
- 238000010814 radioimmunoprecipitation assay Methods 0.000 description 5
- 238000002741 site-directed mutagenesis Methods 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 238000002255 vaccination Methods 0.000 description 5
- 210000003501 vero cell Anatomy 0.000 description 5
- 241000776207 Bornaviridae Species 0.000 description 4
- 206010006448 Bronchiolitis Diseases 0.000 description 4
- 108700010070 Codon Usage Proteins 0.000 description 4
- 241001183012 Modified Vaccinia Ankara virus Species 0.000 description 4
- 101150084044 P gene Proteins 0.000 description 4
- 108091081024 Start codon Proteins 0.000 description 4
- 206010046865 Vaccinia virus infection Diseases 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 230000001086 cytosolic effect Effects 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000003306 harvesting Methods 0.000 description 4
- 238000002169 hydrotherapy Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 238000004264 monolayer culture Methods 0.000 description 4
- 231100000219 mutagenic Toxicity 0.000 description 4
- 210000001989 nasopharynx Anatomy 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 244000052769 pathogen Species 0.000 description 4
- 238000010188 recombinant method Methods 0.000 description 4
- 230000003362 replicative effect Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 235000002639 sodium chloride Nutrition 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 208000007089 vaccinia Diseases 0.000 description 4
- RDEIXVOBVLKYNT-VQBXQJRRSA-N (2r,3r,4r,5r)-2-[(1s,2s,3r,4s,6r)-4,6-diamino-3-[(2r,3r,6s)-3-amino-6-(1-aminoethyl)oxan-2-yl]oxy-2-hydroxycyclohexyl]oxy-5-methyl-4-(methylamino)oxane-3,5-diol;(2r,3r,4r,5r)-2-[(1s,2s,3r,4s,6r)-4,6-diamino-3-[(2r,3r,6s)-3-amino-6-(aminomethyl)oxan-2-yl]o Chemical compound OS(O)(=O)=O.O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H](CC[C@@H](CN)O2)N)[C@@H](N)C[C@H]1N.O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H](CC[C@H](O2)C(C)N)N)[C@@H](N)C[C@H]1N.O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N RDEIXVOBVLKYNT-VQBXQJRRSA-N 0.000 description 3
- 241000724653 Borna disease virus Species 0.000 description 3
- 108010075254 C-Peptide Proteins 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 241001635598 Enicostema Species 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 102100034349 Integrase Human genes 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 108010065602 L Protein parainfluenza 3 virus Proteins 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- 206010027626 Milia Diseases 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 3
- 229940124679 RSV vaccine Drugs 0.000 description 3
- 241000144290 Sigmodon hispidus Species 0.000 description 3
- 238000000692 Student's t-test Methods 0.000 description 3
- 108020005038 Terminator Codon Proteins 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000013592 cell lysate Substances 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000000120 cytopathologic effect Effects 0.000 description 3
- MWRBNPKJOOWZPW-CLFAGFIQSA-N dioleoyl phosphatidylethanolamine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(COP(O)(=O)OCCN)OC(=O)CCCCCCC\C=C/CCCCCCCC MWRBNPKJOOWZPW-CLFAGFIQSA-N 0.000 description 3
- 238000009510 drug design Methods 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 229940124590 live attenuated vaccine Drugs 0.000 description 3
- 229940023012 live-attenuated vaccine Drugs 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 230000000717 retained effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 230000003248 secreting effect Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000002356 single layer Substances 0.000 description 3
- 229940031626 subunit vaccine Drugs 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 230000035899 viability Effects 0.000 description 3
- 230000009385 viral infection Effects 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 2
- 208000031504 Asymptomatic Infections Diseases 0.000 description 2
- 108091062157 Cis-regulatory element Proteins 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 208000000655 Distemper Diseases 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 239000006145 Eagle's minimal essential medium Substances 0.000 description 2
- 101710121417 Envelope glycoprotein Proteins 0.000 description 2
- 241001455610 Ephemerovirus Species 0.000 description 2
- 241001200922 Gagata Species 0.000 description 2
- 101000881168 Homo sapiens SPARC Proteins 0.000 description 2
- 241000712041 Human parainfluenza virus 4a Species 0.000 description 2
- 241000712036 Human parainfluenza virus 4b Species 0.000 description 2
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- 102000013462 Interleukin-12 Human genes 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241000711828 Lyssavirus Species 0.000 description 2
- 241001115401 Marburgvirus Species 0.000 description 2
- 241000699673 Mesocricetus auratus Species 0.000 description 2
- 241000711941 Murine orthopneumovirus Species 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 239000012124 Opti-MEM Substances 0.000 description 2
- 238000009004 PCR Kit Methods 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 101000621511 Potato virus M (strain German) RNA silencing suppressor Proteins 0.000 description 2
- 230000006819 RNA synthesis Effects 0.000 description 2
- 102100030852 Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Human genes 0.000 description 2
- 102100037599 SPARC Human genes 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 241000711970 Vesiculovirus Species 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 229940031567 attenuated vaccine Drugs 0.000 description 2
- 230000037429 base substitution Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 229960000074 biopharmaceutical Drugs 0.000 description 2
- 239000002962 chemical mutagen Substances 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- MYSWGUAQZAJSOK-UHFFFAOYSA-N ciprofloxacin Chemical compound C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 MYSWGUAQZAJSOK-UHFFFAOYSA-N 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 229940044627 gamma-interferon Drugs 0.000 description 2
- 238000012224 gene deletion Methods 0.000 description 2
- 150000002333 glycines Chemical class 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000035931 haemagglutination Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000005745 host immune response Effects 0.000 description 2
- 229960002591 hydroxyproline Drugs 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 230000008676 import Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 230000008506 pathogenesis Effects 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 235000013930 proline Nutrition 0.000 description 2
- 150000003148 prolines Chemical class 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 206010039083 rhinitis Diseases 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 230000014621 translational initiation Effects 0.000 description 2
- 238000011282 treatment Methods 0.000 description 2
- 150000003668 tyrosines Chemical group 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229910052720 vanadium Inorganic materials 0.000 description 2
- 230000006648 viral gene expression Effects 0.000 description 2
- 229960004854 viral vaccine Drugs 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- BEJKOYIMCGMNRB-GRHHLOCNSA-N (2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-amino-3-phenylpropanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BEJKOYIMCGMNRB-GRHHLOCNSA-N 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- WTLKTXIHIHFSGU-UHFFFAOYSA-N 2-nitrosoguanidine Chemical compound NC(N)=NN=O WTLKTXIHIHFSGU-UHFFFAOYSA-N 0.000 description 1
- BRMWTNUJHUMWMS-UHFFFAOYSA-N 3-Methylhistidine Natural products CN1C=NC(CC(N)C(O)=O)=C1 BRMWTNUJHUMWMS-UHFFFAOYSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- 101150096316 5 gene Proteins 0.000 description 1
- FHIDNBAQOFJWCA-UAKXSSHOSA-N 5-fluorouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 FHIDNBAQOFJWCA-UAKXSSHOSA-N 0.000 description 1
- 229940117976 5-hydroxylysine Drugs 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 1
- 241000272478 Aquila Species 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241001115070 Bornavirus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 241000712462 Bovine ephemeral fever virus Species 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241001353878 Canine parainfluenza virus Species 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 241000122205 Chamaeleonidae Species 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 241001481833 Coryphaena hippurus Species 0.000 description 1
- 206010011416 Croup infectious Diseases 0.000 description 1
- 241000712467 Cytorhabdovirus Species 0.000 description 1
- 101710158312 DNA-binding protein HU-beta Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 101000686777 Escherichia phage T7 T7 RNA polymerase Proteins 0.000 description 1
- 108700039887 Essential Genes Proteins 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 108060003393 Granulin Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000893570 Hendra henipavirus Species 0.000 description 1
- 241000724709 Hepatitis delta virus Species 0.000 description 1
- 101000966403 Homo sapiens Dynein light chain 1, cytoplasmic Proteins 0.000 description 1
- 101000635799 Homo sapiens Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Proteins 0.000 description 1
- 241001559186 Human rubulavirus 4 Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 241000726306 Irus Species 0.000 description 1
- 101710172804 K protein Proteins 0.000 description 1
- 238000012218 Kunkel's method Methods 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 206010024971 Lower respiratory tract infections Diseases 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- DTERQYGMUDWYAZ-ZETCQYMHSA-N N(6)-acetyl-L-lysine Chemical compound CC(=O)NCCCC[C@H]([NH3+])C([O-])=O DTERQYGMUDWYAZ-ZETCQYMHSA-N 0.000 description 1
- NTNWOCRCBQPEKQ-YFKPBYRVSA-N N(omega)-methyl-L-arginine Chemical compound CN=C(N)NCCC[C@H](N)C(O)=O NTNWOCRCBQPEKQ-YFKPBYRVSA-N 0.000 description 1
- JDHILDINMRGULE-LURJTMIESA-N N(pros)-methyl-L-histidine Chemical compound CN1C=NC=C1C[C@H](N)C(O)=O JDHILDINMRGULE-LURJTMIESA-N 0.000 description 1
- JJIHLJJYMXLCOY-BYPYZUCNSA-N N-acetyl-L-serine Chemical compound CC(=O)N[C@@H](CO)C(O)=O JJIHLJJYMXLCOY-BYPYZUCNSA-N 0.000 description 1
- PYUSHNKNPOHWEZ-YFKPBYRVSA-N N-formyl-L-methionine Chemical compound CSCC[C@@H](C(O)=O)NC=O PYUSHNKNPOHWEZ-YFKPBYRVSA-N 0.000 description 1
- 102000011931 Nucleoproteins Human genes 0.000 description 1
- 108010061100 Nucleoproteins Proteins 0.000 description 1
- 241000712466 Nucleorhabdovirus Species 0.000 description 1
- 101150068419 ORF 1 gene Proteins 0.000 description 1
- 101150087393 PIN3 gene Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 1
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 1
- 241000710181 Potato virus M Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 208000018569 Respiratory Tract disease Diseases 0.000 description 1
- 206010057190 Respiratory tract infections Diseases 0.000 description 1
- 241000724205 Rice stripe tenuivirus Species 0.000 description 1
- 208000006257 Rinderpest Diseases 0.000 description 1
- 241000711897 Rinderpest morbillivirus Species 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 241000711955 Turkey rhinotracheitis virus Species 0.000 description 1
- 241001428384 Zamora Species 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 150000001295 alanines Chemical group 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- DIZPMCHEQGEION-UHFFFAOYSA-H aluminium sulfate (anhydrous) Chemical compound [Al+3].[Al+3].[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O.[O-]S([O-])(=O)=O DIZPMCHEQGEION-UHFFFAOYSA-H 0.000 description 1
- INJRKJPEYSAMPD-UHFFFAOYSA-N aluminum;silicic acid;hydrate Chemical compound O.[Al].[Al].O[Si](O)(O)O INJRKJPEYSAMPD-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 1
- 229960003942 amphotericin b Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000007416 antiviral immune response Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 238000010170 biological method Methods 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 208000014058 canine distemper Diseases 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 230000002612 cardiopulmonary effect Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229960003405 ciprofloxacin Drugs 0.000 description 1
- 238000005352 clarification Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- KDLRVYVGXIQJDK-AWPVFWJPSA-N clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 description 1
- 229960002227 clindamycin Drugs 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 201000010549 croup Diseases 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 230000001066 destructive effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000005546 dideoxynucleotide Substances 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000009585 enzyme analysis Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 230000004545 gene duplication Effects 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000004077 genetic alteration Effects 0.000 description 1
- 231100000118 genetic alteration Toxicity 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 230000005802 health problem Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000007236 host immunity Effects 0.000 description 1
- 102000047519 human DYNLL1 Human genes 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 125000001841 imino group Chemical group [H]N=* 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000002134 immunopathologic effect Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 150000002519 isoleucine derivatives Chemical group 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 244000000010 microbial pathogen Species 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 239000003471 mutagenic agent Substances 0.000 description 1
- 231100000707 mutagenic chemical Toxicity 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 210000001331 nose Anatomy 0.000 description 1
- 238000006213 oxygenation reaction Methods 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 238000000917 particle-image velocimetry Methods 0.000 description 1
- 210000004976 peripheral blood cell Anatomy 0.000 description 1
- 150000002994 phenylalanines Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 101150034575 piv gene Proteins 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000011809 primate model Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 208000030925 respiratory syncytial virus infectious disease Diseases 0.000 description 1
- 208000020029 respiratory tract infectious disease Diseases 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229960004249 sodium acetate Drugs 0.000 description 1
- 229960002668 sodium chloride Drugs 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 150000003588 threonines Chemical group 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5254—Virus avirulent or attenuated
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18611—Respirovirus, e.g. Bovine, human parainfluenza 1,3
- C12N2760/18622—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18611—Respirovirus, e.g. Bovine, human parainfluenza 1,3
- C12N2760/18641—Use of virus, viral particle or viral elements as a vector
- C12N2760/18643—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18611—Respirovirus, e.g. Bovine, human parainfluenza 1,3
- C12N2760/18661—Methods of inactivation or attenuation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18811—Sendai virus
- C12N2760/18822—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- Negative stranded RNA viruses comprise a diverse order (Mononegavirales) of important and highly destructive pathogens.
- Human pathogens within this group include rabies virus (RaV), measles virus (MeV), mumps virus (MuN), respiratory syncytial virus (RSN) and parainfluenza viruses (PIN) of several genotypes.
- RSN this pathogen outranks all other microbial pathogens as a cause of pneumonia and bronchiolitis in infants under one year of age.
- RSV is responsible for more than one in five pediatric hospital admissions due to respiratory tract disease and causes an estimated 91,000 hospitalizations and 4,500 deaths yearly in the United States alone.
- Human PIN viruses (e.g., HPIVl , HPIV2 and HPIV3) also exact a heavy toll among human populations, causing bronchiolitis, croup and pneumonia primarily in infants and children.
- Karron et al. J. Infect. Pis. 172: 1445-50 (1995); Collins et al. "Parainfluenza Viruses", p. 1205-1243.
- Infections by human PIV viruses are responsible for approximately 20% of hospitalizations among young infants and children for respiratory tract infections.
- RSV exists as two antigenic subgroups A and B, and immunity against one subgroup is of reduced effectiveness against the other.
- tsRSV temperature sensitive RSV
- Vaccinia virus recombinant-based vaccines which express the F or G envelope glycoprotein have also been explored. These recombinants express RSV glycoproteins which are indistinguishable from the authentic viral counterpart, and rodents infected intradermally with vaccinia-RSV F and G recombinants developed high levels of specific antibodies that neutralized viral infectivity. Indeed, infection of cotton rats with vaccinia-F recombinants stimulated almost complete resistance to replication of RSV in the lower respiratory tract and significant resistance in the upper tract (Olmsted et al., Proc. ⁇ atl. Acad. Sci. USA 83:7462-7466 (1986)).
- BPIV3 bovine PIV3
- HPIV3 bovine PIV3
- a second PIV3 vaccine candidate, JS cpAS is a cold-adapted mutant ofthe JS wildtype (wt) strain of HPIV3 (Karron et al., (1995b), supra; Belshe et al, J. Med. Virol. 10:235-42 (T982V).
- This live-attenuated, cold-passaged (cp) PIV3 vaccine candidate exhibits temperature-sensitive (ts), cold-adaptation (ca), and attenuation (att) phenotypes which are stable after viral replication in vivo.
- the cp45 virus is protective against human PIV3 challenge in experimental animals and is attenuated, genetically stable, and immunogenic in seronegative human infants and children (Hall et al, Virus Res. 22:173-184 (1992); Karron et al., J. Infect. Pis. 172(6): 1445- 1450 (1995b), supra).
- Recombinant PNA technology has made it possible to recover infectious negative-stranded RNA viruses from cPNA, to genetically manipulate viral clones to construct novel vaccine candidates, and to rapidly evaluate their level of attenuation and phenotypic stability (for reviews, see Conzelmann, J. Gen. Virol. 77:381-89 (1996); Palese et al., Proc.
- the present invention fulfills this goal and provides additional advantages as described hereinbelow.
- recombinant negative stranded RNA viruses are produced from one or more isolated polynucleotide molecules encoding the virus. This is achieved by coexpressing in a cell or cell-free system one or more polynucleotide molecules encoding a recombinant genome or antigenome ofthe virus along with essential viral proteins necessary to produce an infectious virus or viral particle.
- the recombinant genome or antigenome ofthe subject virus is modified to encode a mutation within a recombinant protein ofthe virus at one or more amino acid position(s) corresponding to a site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus.
- the mutation which is thus "transferred” in this adoptive or iterative fashion surprisingly confers an attenuated phenotype on the recombinant virus.
- candidate vaccine viruses are recombinantly engineered to elicit an immune response against selected negative stranded RNA viruses in a host susceptible to infection by the subject virus.
- isolated polynucleotide molecules and vectors are provided that encode an attenuated, recombinant negative stranded viral genome or antigenome.
- the subject genome or antigenome encodes a mutation within a selected, recombinant protein ofthe virus at an amino acid position(s) corresponding to the site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus.
- methods and compositions incorporating attenuated, recombinant negative stranded RNA virus mutated as above for prophylaxis and treatment of infection by the subject virus are provided within the invention.
- the recombinant negative stranded RNA virus is either a respiratory syncytial virus (RSV), parainfluenza virus (PIV) or measles virus.
- the heterologous, mutant negative stranded RNA virus may be a heterologous RSV, human parainfluenza virus (HPIVl, HPIV2, HPIV3), bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NOV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CPV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
- RNA virus RNA virus
- target proteins are amenable to introduction of attenuating mutations from one negative stranded RNA virus at a corresponding site within a heterologous protein, in accordance with the methods ofthe invention.
- five target proteins are strictly conserved and show moderate to high degrees of sequence identity for specific regions or domains.
- all known members ofthe order share a homologous constellation of five proteins: a nucleocapsid protein (N), a nucleocapsid phosphoprotein (P), a nonglycosylated matrix (M) protein, at least one surface glycoprotein (HN, H, or G) and a large polymerase (L) protein.
- N nucleocapsid protein
- P nucleocapsid phosphoprotein
- M nonglycosylated matrix
- HN, H, or G surface glycoprotein
- L large polymerase
- additional proteins are targeted that may be shared only among particular families, subfamilies, genera or species within the Mononegavirales.
- all members ofthe Paramyxovirus family have at least two surface glycoproteins, HN (or H or G) and F.
- HN or H or G
- F Almost all members ofthe Respirovirus, Rubulavirus and Morbillivirus genera have a cysteine-rich protein V.
- Respiroviruses and Morbilliviruses also encode homologous C proteins.
- Pneumoviruses and a subset of Rubulaviruses (Simian virus 5 (SV5) and mumps virus (MuV)) share homologous surface glycoproteins SH.
- NS1, NS2, M2(ORFl) and M2(ORF2) are conserved.
- Avian pneumoviruses lack NS1 and NS2 but have M2(ORFl), M2(ORF2), and SH proteins.
- the methods ofthe invention are based on identification of an attenuating mutation in a first negative stranded RNA virus.
- the mutation identified in terms of mutant versus wild-type sequence at the subject amino acid position(s) marking the site ofthe mutation, provides an index for sequence comparison against a homologous protein in a different virus that is the target virus for recombinant attenuation.
- the attenuating mutation may be previously known or may be identified by mutagenic and reverse genetics techniques applied to generate and characterize biologically-derived mutant virus.
- attenuating mutations of interest may be generated and characterized de novo, eg., by site directed mutagenesis and conventional screening methods.
- Each attenuating mutation identified in a negative stranded RNA virus provides an index for sequence comparison against a homologous protein in one or more heterologous negative stranded virus(es).
- existing sequence alignments may be analyzed, or conventional sequence alignment methods may be employed to yield sequence comparisons for analysis, to identify corresponding protein regions and amino acid positions between the protein bearing the attenuating mutation and a homologous protein of a different virus that is the target recombinant virus for attenuation.
- the genome or antigenome ofthe target virus is recombinantly modified to encode an amino acid deletion, substitution, or insertion to alter the conserved residue(s) in the target virus protein and thereby confer an analogous, attenuated phenotype on the recombinant virus.
- the wild-type identity of residue(s) at amino acid positions marking an attenuating mutation in one negative stranded RNA virus may be conserved strictly, or by conservative substitution, at the corresponding amino acid position(s) in the target virus protein.
- the corresponding residue(s) in the target virus protein may be identical, or may be conservatively related in terms of amino acid side-group structure and function, to the wild-type residue(s) found to be altered by the attenuating mutation in the heterologous, mutant virus.
- analogous attenuation in the recombinant virus may be achieved according to the methods ofthe invention by modifying the recombinant genome or antigenome ofthe target virus to encode the amino acid deletion, substitution, or insertion to alter the conserved residue(s).
- substitution will be identical or conservative to the substitute residue present in the mutant viral protein.
- alter the native amino acid residue at the site of mutation non-conservatively with respect to the substitute residue in the mutant protein (e.g., by using any other amino acid to disrupt or impair the identity and function ofthe wild-type residue).
- mutations marked by deletions or insertions these can transferred as corresponding deletions or insertions into the recombinant virus, however the particular size and amino acid sequence ofthe deleted or inserted protein fragment can vary.
- mutations incorporated within recombinant negative stranded virus may confer a variety of phenotypes in addition to or associated with the desired, attenuated phenotype.
- exemplary mutations incorporated within recombinant proteins ofthe virus may confer temperature sensitive (ts), cold-adapted (ca), small plaque (sp), or host range restricted (hr) phenotypes, or a change in growth or immunogenicity, in addition to or associated with the attenuated phenotype.
- a ts or non-te mutation is incorporated within the large polymerase L protein of a negative stranded virus, for example HPIV3.
- An attenuating mutation is identified in a heterologous, mutant negative stranded RNA virus (e.g. RSV), which may be any virus sharing a conservative protein structural relationship with PIV3 spanning the mutation of interest.
- the attenuating mutation in the heterologous, mutant virus comprises an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV ⁇ pte530 (ATCC VR 2452).
- a ts or non-ts attenuating mutation is incorporated within a recombinant protein of a parainfluenza virus (PIV), for example, human PIV1 (HPIVl), human PIV2 (HPIV2), human PIV3 (HPIV3), bovine PIV (BPIV), or murine PIV (MPIV or Sendai virus).
- PIV parainfluenza virus
- the recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within a N, P, C, O, V, M, F, HN or L protein ofthe recombinant virus.
- the mutation may confer a ts or non- ts attenuation phenotype on the recombinant virus.
- the attenuating mutation in the heterologous, mutant negative stranded RNA virus corresponds to a mutation ofthe biologically-derived mutant HPIV3 strain JS cp45, and is preferably an amino acid substitution within the HPIV3 JS cp45 L protein.
- Exemplary mutations in this context include an amino acid substitution of tyrosine at position 942 ofthe L protein of HPIV3 JS cp45, an amino acid substitution of leucine at position 992 ofthe L protein of HPIV3 JS cp45, and/or an amino acid substitution of threonine at position 1558 ofthe L protein of HPIV3 JS cp45.
- heterologous, mutant negative stranded RNA virus for use in constructing recombinant PIV ofthe invention comprise an amino acid substitution within the F protein of HPIV3 JS cp45.
- the attenuating mutation in the heterologous virus comprises an amino acid substitution of isoleucine at position 420 ofthe F protein of HPIV3 JS cp45.
- the attenuating mutation may comprise an amino acid substitution of alanine at position 450 ofthe F protein of HPIV3 JS cp45.
- attenuation of recombinant PIV can be achieved by modifying the recombinant PIV genome or antigenome to encode an analogous mutation to an attenuating mutation identified in RSV.
- the attenuating mutation identified in RSV comprises an amino acid substitution of phenylalanine at position 521 ofthe RSV L protein.
- the PIV genome or antigenome is modified to encode an alteration of a conserved residue that corresponds conservatively to the alteration marking the attenuating mutation in the heterologous RSV mutant.
- the mutation is inco ⁇ orated within a recombinant HPIV3 protein and comprises an amino acid substitution of phenylalanine at a corresponding position 456 ofthe L protein of said HPIV3.
- PIV vaccine candidates within the invention can be achieved by modifying the recombinant PIV genome or antigenome to encode an analogous mutation to an attenuating mutation identified in Sendai virus (SeV).
- the attenuating mutation comprises an amino acid substitution of phenylalanine at position 170 ofthe C protein of SeV.
- the PIV genome or antigenome is modified to encode an alteration of a conserved residue that corresponds conservatively to the alteration marking the attenuating mutation in the heterologous, SeV mutant.
- the mutation is incorporated within a recombinant HPIV3 protein and comprises an amino acid substitution of phenylalanine at position 164 ofthe C protein of HPIV3.
- a ts or non-ts attenuating mutation is incorporated within a recombinant protein of a measles virus (MeV).
- the heterologous, mutant negative stranded RNA virus in which the attenuating mutation is identified may be a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CPV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
- RSV respiratory syncytial virus
- HPIV human parainfluenza virus
- BPIV bovine PIV
- Sendai virus SeV
- NDV Newcastle disease virus
- SV5 simian virus 5
- Mumps virus MuV
- the heterologous, mutant virus is HPIV3 JS cp45.
- the attenuating mutation identified in HPIV3 JS cp45 comprises an amino acid substitution of tyrosine at position 942 or leucine at position 992 ofthe L protein.
- the recombinant negative stranded RNA virus is a chimeric virus.
- the virus has a recombinant genome or antigenome comprising a partial or complete genome or antigenome of one species, subgroup, or strain of negative stranded RNA virus combined with a heterologous gene or gene segment of a different species, subgroup, or strain of negative stranded RNA virus.
- the chimeric virus is a PIV having a complete genome or antigenome of one PIV species, subgroup, or strain combined with at least one gene or gene segment of the HN and F glycoprotein genes of a heterologous PIV species, subgroup, or strain.
- the chimeric virus is a RSV in which the recombinant genome or antigenome inco ⁇ orates a gene or gene segment of a F, G or SH glycoprotein gene from a heterologous RSV species, subgroup, or strain.
- the F and G glycoprotein genes of human RSV subgroup A are substituted by the F and G glycoprotein genes of human RSV subgroup B in a RSV A background.
- the recombinant negative stranded RNA virus is further modified or attenuated by additional changes to the recombinant genome or antigenome.
- the genome or antigenome is further modified to encode one or more additional attenuating mutations adopted from a biologically-derived mutant negative strand RNA virus.
- the genome or antigenome is modified to encode at least one and up to a full complement of attenuating mutations present within a panel of biologically-derived mutant RSV strains, said panel comprising (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579).
- the recombinant genome or antigenome encodes at least one and up to a full complement of attenuating mutations present within HPIV3 JS cp45.
- at least one ofthe attenuating mutation(s) contemplated herein are stabilized by multiple nucleotide changes in a codon specifying the mutation.
- the recombinant negative stranded RNA virus is further modified or attenuated by a nucleotide modification specifying a phenotypic change selected from a change in growth characteristics, attenuation, temperature-sensitivity, cold-adaptation, small plaque size, host range restriction, or a change in immunogenicity.
- a nucleotide modification specifying a phenotypic change selected from a change in growth characteristics, attenuation, temperature-sensitivity, cold-adaptation, small plaque size, host range restriction, or a change in immunogenicity.
- the recombinant genome or antigenome may inco ⁇ orate a modification ofthe SH, NS1, NS2 or G gene, such as a gene deletion or ablation of gene expression.
- Other nucleotide modifications in RSV and other negative stranded RNA viruses comprise a nucleotide deletion, insertion, addition or rearrangement within a cis-acting regulatory sequence or within the recombinant genome or antigenome
- the invention provides isolated, recombinant negative stranded RNA virus that are attenuated and elicit an immune response in a host susceptible to infection by the subject virus.
- the virus comprises a recombinant genome or antigenome and viral proteins necessary to produce an infectious viral particle ofthe RNA virus.
- the recombinant genome or antigenome is modified to encode a mutation within a recombinant protein ofthe virus at an amino acid position corresponding to an amino acid position of an attenuating mutation identified in a heterologous, mutant negative stranded RNA virus.
- the mutation by inco ⁇ oration within the recombinant protein, confers an attenuated phenotype on the recombinant virus.
- isolated polynucleotide molecules encoding a recombinant genome or antigenome of a recombinant negative stranded RNA virus.
- the recombinant genome or antigenome is likewise modified to encode a mutation within a recombinant protein ofthe virus at an amino acid position corresponding to an amino acid position of an attenuating mutation identified in a heterologous, mutant negative stranded RNA virus.
- the mutation by inco ⁇ oration within the recombinant protein, confers an attenuated phenotype on the recombinant virus.
- expression vectors comprise an operably linked transcriptional promoter, a polynucleotide molecule encoding a recombinant genome or antigenome of a recombinant negative stranded RNA virus as set forth above, and a transcriptional terminator.
- the invention also provides a method for stimulating the immune system of an individual to induce protection against a negative stranded RNA virus.
- the method includes administering to the individual an immunologically sufficient amount of an attenuated, recombinant negative stranded virus as described above combined with a physiologically acceptable carrier.
- an immunogenic composition is provided which elicits an immune response against a negative stranded RNA virus.
- the composition comprises an immunologically sufficient amount of an attenuated, recombinant negative stranded virus ofthe invention combined with a physiologically acceptable carrier.
- the attenuated, recombinant negative stranded virus is a RSV, PIV or measles virus.
- panel A provides an amino acid sequence alignment ofthe L polymerase proteins of RSV (SEQ IP NO. 44), PIV3 (SEQ IP NO. 45), measles (SEQ IP NO. 46) and Sendai (SEQ IP NO. 47) viruses spanning RSV Phe-521 (denoted by arrow).
- a consensus sequence (SEQ IP NO. 48) was generated from an exact match of at least three residues of each position. The numerical position ofthe first amino acid in the sequence presented is indicated. Residues conserved in all four viruses are in bold type.
- FIG. 1 panel C shows the nucleotide sequence (positive sense) encoding the F456L mutation (SEQ IP NO. 50) compared to wt sequence (SEQ IP NO. 49).
- the PIV3 nucleotide sequence numbered according to the complete rwt antigenome is shown for the wt virus and the mutant sequence is shown below. Nucleotide changes are underlined and the codon bearing the F456L mutation is in bold type. The introduced Xmnl restriction endonuclease recognition site in the mutant sequence is in italic type.
- Figure 2 depicts replication of rcp45 and rcp45-456 in the upper respiratory tract of chimpanzees.
- the three reading frames ofthe P mRNA are shown (+1, +2 and +3) with the P, C, O and N ORFs represented by rectangles. Amino acid lengths are indicated.
- the position ofthe R ⁇ A editing site is shown as a vertical line and its sequence motif is shown and numbered according to its nucleotide position in the complete HPIV3 antigenomic sequence.
- panel A depicts organization ofthe unedited P mR ⁇ A.
- the sequence containing the translational start sites ofthe P and C ORFs is shown (SEQ IP NO. 52) and is numbered according to the complete antigenomic sequence.
- the nucleotide positions ofthe P, C, O, and V ORFs in the complete antigenomic sequence are: P, 1784-3595; C, 1794-2393; 0, 2442-2903; V, 2792-3066.
- the AUG that opens the P ORF is at positions 80-82.
- panel B depicts organization of an edited version ofthe P mRNA that contains an insertion of two nontemplated G residues (GG) (SEQ IP NO. 53) in the editing site (SEQ IP NO. 51). This changes the reading register so that the upstream end ofthe P ORF in frame +2 is fused to the O ORF in frame +3.
- the resulting chimeric protein contains the N-terminal 241 amino acids encoded by the P ORF fused to the C- terminal 131 amino acids encoded by the O ORF.
- Figure 4 shows results of a radioimmunoprecipitation assay demonstrating expression ofthe C protein in rF164S.
- Lane (a) 35 S-labeled cell lysates were immunoprecipitated with a polyclonal C-specific rabbit antiserum. A 22kO band corresponding to the C protein (open arrow) is clearly present in rJS and rF164S lysates.
- Lane (b) cell lysates were immunoprecipitated by a mixture of two monoclonal antibodies specific to the HPIV3 HN protein.
- the 64kP band corresponding to the HN protein (closed arrow) is present in each virus lysate confirming they are indeed HPIV3 and express similar levels of proteins.
- Mock lane indicates tissue culture lysates harvested from uninfected cells.
- Figure 5 shows the results of multicycle replication ofthe recombinant mutant virus rF164S compared with the parent virus rJS.
- the virus titers are shown as TCIP 5 o/ml and are the average of duplicate samples.
- the methods ofthe invention provide attenuated, recombinant negative stranded RNA viruses suitable for vaccine use.
- the recombinant negative stranded RNA viruses are produced from one or more isolated polynucleotide molecules encoding the virus. Production of a recombinant virus is achieved by coexpressing in a cell or cell-free system one or more polynucleotide molecules that encode: (i) a recombinant genome or antigenome ofthe virus and (ii) essential viral proteins necessary to produce an infectious virus or subviral particle.
- the recombinant genome or antigenome ofthe subject recombinant virus is modified to encode a mutation within a recombinant protein ofthe virus at one or more amino acid position(s) corresponding to a site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus.
- the attenuating mutation identified in the heterologous negative stranded RNA virus is thus "transferred" to a corresponding site within the recombinant virus to confer an attenuated phenotype on the recombinant virus.
- the transferred mutation typically is identical or conservative to the attenuating mutation identified in the heterologous. mutant virus, although non-conservative substitutions also can be made.
- the instant invention embodies a novel paradigm for rationally designing attenuated vaccine viruses based on the identification of attenuating mutations in a heterologous negative stranded RNA virus.
- Attenuating mutations in the heterologous virus are mapped to one or more amino acid deletion(s), substitution(s), or insertion(s) in a protein of interest in the heterologous, mutant virus, eg., by conventional nucleotide or amino acid sequence comparison between the mutant virus and its non-attenuated parental virus.
- the parental virus is typically a biologically-derived strain that is wild-type, at least for the attenuated phenotype.
- partially attenuated mutant strains may also be used, wherein an additional attenuating mutation may arise through artificial mutagenesis or by natural polymo ⁇ hism, etc.
- parental virus in which attenuating mutations may be introduced and subsequently mapped include artificially produced virus such as are provided through cPNA viral clones in accordance with known reverse genetic methods.
- the attenuating mutations identified in heterologous negative stranded RNA viruses may be previously known or may be generated and/or identified by conventional mutagenic and/or reverse genetics techniques. These techniques may be applied to generate and characterize biologically-derived mutant virus, or to generate and characterize attenuating mutations of interest de novo, eg., by site directed mutagenesis of a wild-type or non-attenuated mutant viral cPNA clone in conjunction with conventional screening methods to identify attenuated derivatives.
- Reverse genetic methods for recovery and genetic manipulation of infections viral clones are known for representative viral groups throughout the Mononegavirales (for reviews, see Conzelmann, J. Gen. Virol. 77:381-89 (1996V. Palese et al.. Proc. Natl. Acad. Sci. U.S.A. 93:11354-58. (1996)).
- Attenuating mutations in heterologous negative stranded RNA viruses may be identified in biologically-derived mutant strains for inco ⁇ oration within a heterologous, recombinant virus ofthe invention.
- the subject mutations may occur naturally or may be introduced into wild-type or partially attenuated parental strains by well known mutagenesis procedures.
- attenuated mutant viral strains can be produced by chemical mutagenesis during virus growth in cell cultures to which a chemical mutagen has been added, by selection of virus that has been subjected to passage at suboptimal temperatures in order to introduce growth restriction mutations, or by selection of a mutagenized virus that produces small plaques (sp) or temperature sensitive (ts) virus in cell culture (see, eg., U.S. Patent Application No. 08/327,263, inco ⁇ orated herein by reference).
- biologically-derived mutant any mutant virus that is not produced by recombinant means.
- biologically-derived mutants include naturally occurring mutants having genomic variations from a reference wild-type sequence, eg., partially attenuated mutant PIV strains.
- biologically-derived mutants include mutants derived from any parental viral strain without recombinant methods by, inter alia, artificial mutagenesis and selection procedures.
- One well known procedure for generating biologically-derived negative stranded RNA virus involves subjecting a wild type or partially attenuated virus to passage in cell culture at progressively lower, attenuating temperatures.
- wild-type virus is typically cultivated at approximately 34-37°C.
- Partially attenuated mutants are produced by passage in cell cultures (e.g., primary bovine kidney cells) at suboptimal temperatures, e.g., 20-26°C.
- the cp mutant or other partially attenuated strain eg., ts-1 or spRSV
- the cp mutant or other partially attenuated strain is adapted to efficient growth at a lower temperature by passage in MRC-5 or Vero cells, down to a temperature of about 20-24°C, preferably 20-22°C.
- This selection of mutant RSV during cold-passage substantially eliminates any residual virulence in the derivative strains as compared to the partially attenuated parent.
- specific mutations can be introduced into biologically- derived viruses by subjecting a wild type or partially attenuated parent virus to chemical mutagenesis, eg., to introduce ts mutations or, in the case of viruses which are already ts, additional ts mutations sufficient to confer increased attenuation and/or stability ofthe ts phenotype on the attenuated derivative.
- Means for the introduction of ts mutations into negative stranded RNA viruses include replication ofthe virus in the presence of a mutagen such as 5-fluorouridine or 5-fluorouracil in a concentration of about 10 " to 10 " M, preferably about 10 "4 M, exposure of virus to nitrosoguanidine at a concentration of about 100 ⁇ g/ml, according to the general procedure described in, e.g., Gha ⁇ ure et al., J. Virol. 3:414-421 (1969) and Richardson et al.. J. Med. Virol. 3:91-100 (1978).
- Other chemical mutagens can also be used. Attenuation can result from a ts mutation in almost any viral gene, although a particularly amenable target for this pu ⁇ ose has been found to be the highly conserved polymerase (L) gene.
- the level of temperature sensitivity of replication in exemplary attenuated virus for use within the invention is determined by comparing its replication at a permissive temperature with that at several restrictive temperatures.
- the lowest temperature at which the replication ofthe virus is reduced 100-fold or more in comparison with its replication at the permissive temperature is termed the shutoff temperature.
- both the replication and virulence of exemplary mutant RSV strains approximately correlate with the mutant's shutoff temperature. Replication of mutants with a shutoff temperature of 39°C is moderately restricted, whereas mutants with a shutoff of 38°C replicate less well and symptoms of illness are mainly restricted to the upper respiratory tract. A virus with a shutoff temperature of 35 to 37°C will typically be fully attenuated in humans.
- Attenuated biologically-derived mutant RSV for use within the invention which are ts will have a shutoff temperature in the range of about 35 to 39°C, and preferably from 35 to 38°C.
- the addition of a ts mutation into a partially attenuated strain produces multiply attenuated virus useful within vaccine compositions ofthe invention.
- Attenuated RSV strains as candidate vaccines have been developed using multiple rounds of chemical mutagenesis to introduce multiple mutations into a virus which had already been attenuated during cold-passage (e.g., Connors et al., Virology 208: 478-484 (1995); Crowe et al., Vaccine 12: 691-699 (1994a); and Crowe et al., Vaccine 12: 783-790 (1994b), inco ⁇ orated herein by reference). Evaluation of these biologically-derived mutants in accepted rodent and chimpanzee models, as well as in human adults and infants, indicates that certain of these candidate vaccine strains are genetically stable, highly immunogenic, and attenuated.
- nucleotide sequence analysis of attenuated mutant viruses involving comparison of mutant to parental, eg., wild-type or partially attenuating, ONA or amino acid sequences can be employed to map attenuating mutations to specific nucleotide and amino acid changes. Often these changes will involve individual amino acid substitutions, however other mutations subject to conservative transfer according to the methods ofthe invention involve multiple amino acid substitutions, amino acid insertions or deletions, as well as more extensive alterations of conserved regions or domains within a target protein.
- nucleotide and amino acid changes identified in an attenuated mutant virus can be introduced into a previously characterized, cONA-encoded virus, thereby allowing the artisan to distinguish between silent, incidental mutations and those responsible for the desired phenotypic changes.
- subject mutations are introduced separately and in various combinations into the genome or antigenome of infectious RSV clones. This process, coupled with evaluation of phenotype characteristics of parental and derivative viruses, further identifies mutations responsible for such desired characteristics as attenuation, temperature sensitivity, cold-adaptation, small plaque size, host range restriction, etc.
- Mutations thus identified and mapped provide a rich source of candidate mutations for designing recombinant negative stranded RNA viruses using the heterologous transfer methods described herein.
- Exemplary disclosures which identify and characterize such attenuating mutations in negative stranded RNA viruses are provided in U.S. Patent Application No. 08/892,403 and corresponding International Application No. WO 98/02530; and U.S. Patent Application No. 08/083,793 and corresponding International Application No. WO 98/53078.
- These and other references inco ⁇ orated herein provide a "menu" of attenuating mutations that are candidates for transfer into heterologous viral clones according to the methods ofthe invention.
- U.S. Patent Application No. 08/892,403 and corresponding International Application No. WO 98/02530 describe cold passaged (cp) and temperature sensitive (ts) mutants of RSV (subfamily Pneumovirinae; genus Pneumovirus), including the exemplary mutants designated cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579.
- cp cold passaged
- ts mutants of RSV subfamily Pneumovirinae; genus Pneumovirus
- an exemplary panel of attenuating mutations has been mapped and characterized, including specific nucleotide changes in the large polymerase gene L resulting in amino acid substitutions at parental residue/sequence positions Phe 5 ⁇ , Gln 8 ⁇ , Metn 69 , and Tyr_ 3 2i, as exemplified by the attenuating substitutions, Leu for Phe 52 ⁇ , Leu for Gln 83 ⁇ , Val for Met ⁇ 69 , and Asn for Tyn 32 ..
- Each of these mutations occurs in the highly conserved L protein and confers a ts phenotype on the mutant virus.
- nucleotide changes encoding ts attenuating amino acid substitutions in the polymerase L gene at parental residue/sequence positions Tyr 2 , Leu 92 , and/or Thr ⁇ 558 .
- Tyr 9 2 is replaced by His
- Leu 9 2 is replaced by Phe
- Thri 558 is replaced by He.
- HPIV3 JS cp45 have been mapped and characterized to encode attenuating amino acid substitutions in the F and C proteins of HPIV3. These include mutations encoding non-ts attenuating amino acid substitutions in the C protein ofthe P gene at the parental residue/position Ile of JS HPIV3, as exemplified by the substitution of Ile 6 to Thr. Further exemplary mutations identified in the F protein of HPIV3 encode amino acid substitutions at parental residue/positions Ile 42 o and Ala ⁇ o, as exemplified by the substitutions Ile 42 o to Val and Ala ⁇ o to Thr.
- Attenuating mutations in non-coding portions of a negative stranded viral gene.
- attenuating mutations may include single or multiple base changes in a gene start sequence, as exemplified by an attenuating base substitution in the RSV M2 gene start sequence at nucleotide 7605. Where such mutations map to conserved nucleotide positions within a heterologous negative stranded RNA virus, they also are amenable to transfer between heterologous taxa according to the methods ofthe invention.
- Each attenuating mutation thus identified in a negative stranded RNA virus provides an index for sequence comparison against a homologous protein in one or more heterologous negative stranded virus.
- existing sequence alignments may be analyzed, or conventional sequence alignment methods may be employed to conduct sequence comparisons to identify corresponding protein regions and amino acid positions between a protein bearing an identified attenuating mutation in one negative stranded RNA virus and a homologous protein in a different virus that is the target virus for recombinant attenuation.
- the focus of this exercise is to identify one or more residues that are associated with the attenuating mutation in the first (heterologous) virus, i.e., which has been altered from a parental sequence where the parent lacks the mutant phenotype. By sequence alignment it is then determined whether the parental sequence ofthe mutant is conserved, by the presence of an identical or conservative amino acid residue at a corresponding amino acid position(s) in the target (recombinant) virus protein.
- the "wild-type" sequence element(s) thus conserved will occur in a conserved region or domain ofthe protein, however isolated residues and blocks of amino acid residues are also widely conserved among different taxa within the Mononegavirales and can provide equally useful targets for heterologous transfer of attenuating mutations between heterologous RNA viruses (wherein all or part ofthe conserved sequence element(s) bearing the mutant change is copied or imported into the recombinant virus to yield a novel attenuated derivative).
- RNA viruses share a homologous constellation of proteins comprising a nucleocapsid protein (N), a nucleocapsid phosphoprotein (P), a nonglycosylated matrix (M) protein, at least one surface attachment glycoprotein (HN, H, or G) and a large polymerase (L) protein.
- N nucleocapsid protein
- P nucleocapsid phosphoprotein
- M nonglycosylated matrix
- HN, H, or G surface attachment glycoprotein
- L large polymerase
- the Order Mononegavirales embraces the families Filoviridae, Paramyxoviridae, Bornaviridae and Rhabdoviridae, which are all comprised of viruses with monopartite negative-stranded RNA genomes, Pringle, Arch Virol. 117:137-140 (1991). A summary ofthe taxonomy within this group, including identification of family/subfamily/generic and type specific groupings is provided by Pringle, Arch Virol. 142(11): 2321-2326 (1997). A representative classification ofthe Mononegavirales, and expanded classification ofthe Paramyxoviridae, is set forth herein in Table 1.
- Vesiculovirus vesicular stomatitis virus
- Genus Lyssavirus (rabies virus) Genus Ephemerovirus (bovine ephemeral fever virus) Other genera -Family Filoviridae (Ebola virus, Marburg virus) -Family Bornaviridae (Borna disease virus)
- the Families Bornaviridae and Filoviridae are represented by single genera.
- the Genus Bornavirus as yet contains only a single species (borna disease virus).
- Four species are recognized in the Genus Filovirus (type species Marburg virus) by virtue of nucleotide sequence and antigenic divergence and differential expression ofthe attachment (G) protein.
- the Family Rhabdoviridae includes five genera, Vesiculovirus, Lyssavirus, Ephemerovirus, Cytorhabdovirus, and Nucleorhabdovirus, which in addition to sequence and antigenic differences are distinguished by host range, presence of supplementary genes, and intracellular site of multiplication.
- the Family Paramyxoviridae is represented by two sub-families; the Paramyxovirinae with three genera, Respirovirus (type species HPIVl), Morbillivirus (type species MeV), and
- Rubulavirus type species MuV
- Pneumovirinae type species human RSV
- one planned additional genus which will include avian pneumovirus.
- Borna disease virus ofthe Bornaviridae, Ebola virus ofthe Filoviridae and eight members ofthe Rhabdoviridae exhibit a basic five gene pattern (N-P-M-G-L), augmented in the case of Ebola virus and four ofthe eight rhabdoviruses by insertion of one or more genes between G and L, or between P and M in the case of three ofthe remaining four rhabdoviruses.
- Paramyxoviruses ofthe Subfamily Paramyxovirinae exhibit an increase in complexity; the basic 5 gene pattern is enhanced by multiple encoding of genetic information in the P gene and the insertion of an additional envelope protein gene (F) between M and the attachment protein (H or HN), and in addition by SH in certain ofthe Rubulaviruses.
- All ofthe paramyxoviruses have at least two surface glycoproteins, HN (or H or G) and F.
- Almost all members ofthe Respirovirus, Rubulavirus and Morbillivirus genera have a cysteine-rich protein V.
- Respiroviruses and Morbilliviruses also encode homologous C proteins.
- Pneumoviruses and a subset of Rubulaviruses (Simian virus 5 (SV5) and mumps virus (MuV)) share homologous surface glycoproteins SH.
- Pneumovirus genus including bovine, ovine and caprine RSV and pneumonia virus of mice— alternatively referred to herein as murine RSV
- murine RSV several additional proteins, NS 1 , NS2, M2(ORFl) and M2(ORF2) are conserved.
- the paramyxoviruses ofthe subfamily Pneumovirinae exhibit unique deviations from the basic pattern, the most significant being possession of additional genes.
- human and murine pneumoviruses the M2 gene encodes two proteins in different reading frames, both of which have significant effects on RNA synthesis in vitro.
- the methods ofthe invention are based on identification of an attenuating mutation in a first negative stranded RNA virus, which mutation is mapped by comparison of a mutant versus a wild-type sequence to yield identification of a subject amino acid position(s) marking the site ofthe mutation.
- these mutations are inco ⁇ orated into a non-attenuated or partially attenuated, recombinant viral clone to verify that the subject change in fact specifies an attenuated phenotype.
- a host of exemplary attenuating mutations in this context are provided in the instant disclosure, and others are readily identifiable in accordance with known mutagenic and reverse genetics techniques in accordance with the description herein.
- Each attenuating mutation identified in one negative stranded RNA virus provides an index for sequence comparison against a homologous protein in one or more heterologous negative stranded virus(es).
- existing sequence alignments may be analyzed, or conventional sequence alignment methods may be employed to yield sequence comparisons for analysis, to identify corresponding protein regions and amino acid positions between the protein bearing the attenuating mutation and a homologous protein of a different virus that is the target recombinant virus for attenuation.
- the genome or antigenome ofthe target virus is recombinantly modified to encode an identical or conservative amino acid deletion, substitution, or insertion to alter the conserved residue(s) in the target virus protein and thereby confer an analogous, attenuated phenotype on the recombinant virus.
- Sequence alignments and analysis to practice this aspect ofthe invention focus on homologous, "counte ⁇ art” genes, gene segments, proteins and/or protein domains in which a polynucleotide or amino acid reference sequence is used as a defined sequence to provide a basis for statistical sequence comparison.
- the reference sequence may be a defined segment of a cPNA or gene, a complete cPNA or gene sequence or a sequence of a protein or sub-portion thereof.
- a reference sequence, for use in defining counte ⁇ art genes or gene segments is at least 20 nucleotides in length, frequently at least 25 nucleotides in length, and often at least 50 nucleotides in length and that for proteins and protein segments is at least 20 amino acids in length.
- two polynucleotides or amino acid sequences may each (1) comprise a sequence (i.e., a portion ofthe complete polynucleotide or protein sequence) that is similar between the two polynucleotides or proteins, and (2) may further comprise a sequence that is divergent between the two polynucleotides or proteins, sequence comparisons between two (or more) polynucleotides or proteins are typically performed by comparing sequences ofthe two subject sequences over a "comparison window" to identify and compare local regions of sequence identity or similarity.
- a “comparison window”, as used herein, refers to a conceptual segment of at least 20 contiguous nucleotide or amino acid positions wherein a sequence may be compared to a reference sequence of at least 20 contiguous nucleotides or amino acids, and wherein the portion ofthe polynucleotide or amino acid sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment ofthe two sequences.
- Optimal alignment of sequences for aligning a comparison window may be conducted by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Natl. Acad. Sci.
- sequence identity means that two polynucleotide or protein sequences are identical (i.e., on a nucleotide-by-nucleotide or residue-by- residue basis) over the window of comparison.
- percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I) or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
- substantially identical denotes a characteristic of two polynucleotide or amino acid sequences which share at least 85 percent sequence identity, preferably at least 90 to 95 percent sequence identity, and sometimes at 99 percent or greater sequence identity over a comparison window of at least 20 nucleotide or amino acid positions, frequently over a window of at least 25-50 nucleotides or amino acids, wherein the percentage of sequence identity is calculated by comparing the reference sequence to a comparison sequence which may include deletions or additions which total 20 percent or less ofthe reference sequence over the window of comparison.
- the reference sequence may be a subset of a larger sequence.
- sequence identity means that the sequences share one or more identical amino acids at corresponding positions.
- sequence similarity means that two sequences are share one or more conservatively related amino acids at corresponding positions, eg., attributable to conservative substitutions.
- substantially sequence identity means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 85 percent sequence identity, preferably at least 90 percent sequence identity, more preferably at least 95 percent sequence identity or more (e.g., 99 percent sequence identity).
- substantially similarity means that two peptide sequences share corresponding percentages of sequence similarity.
- conservative amino acid substitutions refer to the general interchangeability of amino acid residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine
- a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine
- a group of amino acids having amide-containing side chains is asparagine and glutamine
- a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan
- a group of amino acids having basic side chains is lysine, arginine, and histidine
- a group of amino acids having sulfur-containing side chains is cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine- valine, and asparagine-glutamine.
- Stereoisomers e.g., O-amino acids
- unnatural amino acids such as ⁇ , ⁇ -disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids may also be suitable components for polypeptides ofthe present invention.
- Examples of unconventional amino acids include: 4-hydroxyproline, ⁇ -carboxyglutamate, ⁇ -N,N,N- trimethyllysine, ⁇ -N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5 -hydroxy lysine, ⁇ -N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline).
- amino acids may be modified by glycosylation, phosphorylation and the like.
- the L protein includes a highly conserved central region which is thought to contain the active site for RNA synthesis.
- Other conserved structural domains, motifs and sequence elements, including stringently conserved, isolated residues are also identified, some of which are distributed around the conserved central core and are thought to be important for polymerase activity.
- These conserved sequence elements identified in the L protein (see, Poch et al., J. Gen. Virol. 5 : 1153-62,(1990) and Poch et al. EMBO J. 8(12)3867-3874, (1989), particularly Fig. 1, inco ⁇ orated herein by reference), provide detailed information to compare with L protein sequences of heterologous, parental strains from which attenuating mutations have been generated and mapped.
- Stec et al. relies on conventional alignment methods which, among other similar methods, are useful within the instant invention.
- the similarity scoring system was used to construct pairwise global dot matrix alignments between RSV and other negative- strand RNA virus L proteins listed in Table 1. By these methods, regions of unambiguous sequence relatedness were detected between the RSV L protein and the L proteins of distantly related paramyxoviruses and rhabdoviruses. As illustrated in Fig. 3, the regions of sequence relatedness between the RSV L protein and each ofthe others are colinear and concentrated in the amino-proximal region, representing approximately one- fifth of each molecule.
- Stec et al. confirms the presence of a number of short segments in the L proteins of heterologous negative stranded RNA viruses that are almost exactly conserved between different taxa. These nearly identical segments are also shown to be conserved in the RSV L protein, and reside within the highly conserved region shown in Fig. 4 of Stec et al. (inco ⁇ orated herein by reference, see boxed sequences). The amino acid identity within these six segments varies from 30 to 80% among the seven proteins. Numerous residues within the identified segments are invariant among the seven different negative stranded RNA viruses for which the alignment was conducted. Moreover, it is noteworthy that where substitutions have occurred in these conserved segments, many are marked by conservative substitutions. As noted previously, the high degree of identity of these segments among each member of two virus families suggests that they are important for L protein functions.
- the most highly conserved region ofthe L proteins aligned between divergent taxa within the Mononegavirales in Fig. 4 of Stec et al. also contains four distinct polymerase motifs (underlined and designated A-D) consistent with the motifs identified by Poch et al., (1989), supra. These regions homologous to the four polymerase motifs were identified in the RSV L protein between amino acids 696 to 887. Three ofthe four elements (A-C) coincide with the highly conserved segments ofthe paramyxovirus and rhabdovirus L proteins described above.
- the D segment was less well conserved among these viruses but does contain a single invariant lysine and a conserved glycine (in RSV, K-886 and G-877, respectively) that typifies this element.
- sequence alignments and analyses have been published for other proteins shared among the negative stranded RNA viruses and useful as target proteins within the instant invention.
- Barr et al., J. Gen. Virol. 72:677-685 (1991) inco ⁇ orated herein by reference, analyzed sequence conservation in the N protein among heterologous members ofthe Mononegavirales.
- this study showed a high level of amino acid identity (60%) between the predicted amino acid sequences of RSV and PVM N proteins (see Fig.
- Amino acid residues 1 to 150 and 150 to 393 contain 38% and 74% identity respectively, whereas residues 245 to 315 contain 68 identical amino acids out of 71 (96% identity). This high degree of conservation of these proteins is consistent with observations that the N proteins of RSV and PVM are serologically related (Gimenez et al., 1984; Ling & Pringle, 1989).
- the N gene of HPIVl shows extensive homology with SeV; the nucleotide and amino acid identities were 70.8% and 87.8%o, respectively.
- the N protein of HPIV-1 also showed high amino acid identities with HPIV-3 (63.1%) and BPIV-3 (63.3%), and lesser identities to NDV (20.9%), MeV (20.5%), CDV (19.6%), SV41 (18.6%), SV5 (17.9%), HPIV-4A (17.9%), HPIV-4B
- a protease-sensitive "binge” was found at the junction of two defined domains ofthe SeV K protein; (1) an amino-terminal domain which interacts directly with the RNA, and (2) a carboxyl-terminal domain which lies on the surface ofthe assembled nucleocapsid (Heggeness et al.. Virology 114:555-562 (1981), inco ⁇ orated herein by reference)
- Miyahara also compared M protein sequences between the HPIV-1 M protein and 13 other paramyxoviruses (see, eg., Fig. 4 of Miyahara et al.). These heterologous viruses also exhibited a high degree of structural conservation of M protein sequence elements. For example, HPIV-1 and SeV showed levels of nucleotide and amino acid identity for M of 72.6% and 88.4%, respectively. HPIV-1 also showed high levels of conservation with HPIV-3 (65.7%) and BPIV-3 (65.4%), and moderate conservation with MeV (36.4%), CDV (34.6%) and RPV (36.7%).
- Gen. Virol. 72:2289-2292 (1991) provides an exemplary alignment and analysis for the N protein of HPIV-2, SV5, and SV41 (see, eg., Fig. 3).
- Spriggs et al., 1986, Virology 152:241-251 (1986) identifies structurally conserved elements in the F protein among heterologous paramyxoviruses, including RSV.
- Higuchi et al., J. Gen. Virol. 73:1005- 1010 (1992) see, eg., Fig. 4
- Kawano et al. Nuc. Acids. Res. 19(10V2739-2746 (1991) see, eg., Figs.
- recombinant negative stranded RNA virus that has been attenuated by transfer of a mutation identified in a heterologous virus is engineered as a chimeric virus, for example a chimeric RSV or PIV virus.
- Chimeric negative stranded viruses ofthe invention are recombinantly engineered to inco ⁇ orate nucleotide sequences from more than one viral strain or subgroup to produce an infectious, chimeric virus or subviral particle.
- candidate vaccine viruses are recombinantly engineered to elicit an immune response in a mammalian host, including humans and non-human primates.
- Chimeric viruses according to the invention may elicit an immune response to a specific viral subgroup or strain, or they may elicit a polyspecific response against multiple viral subgroups or strains.
- chimeric virus inco ⁇ orating an attenuating mutation as described above may also have heterologous genes or gene segments of a heterologous virus added to or inco ⁇ orated within the recombinant genome or antigenome ofthe subject virus, for example by substituting counte ⁇ art sequence(s) from a heterologous RSV to produce a chimeric RSV genome or antigenome.
- a chimeric virus ofthe invention thus includes a partial or complete "recipient" viral genome or antigenome from one viral strain or subgroup virus combined with an additional or replacement "donor" gene or gene segment of a different viral strain or subgroup.
- the chimeric attenuated virus is an
- RSV comprised of a partial or complete human RSV A or B subgroup genome or antigenome combined with a heterologous gene or gene segment from a different human RSV A or B subgroup virus.
- heterologous donor genes or gene segments from one RSV strain or subgroup is/are combined with or substituted within a recipient genome or antigenome that serves as a backbone for insertion or addition ofthe donor gene or gene segment.
- the recipient genome or antigenome acts as a vector to import and express heterologous genes or gene segments to yield chimeric RSV that exhibit novel structural and/or phenotypic characteristics.
- addition or substitution of a heterologous gene or gene segment within a selected recipient RSV strain yields novel phenotypic effects, for example attenuation, growth changes, altered immunogenicity, or other desired phenotypic changes, as compared with corresponding phenotypes ofthe unmodified recipient and/or donor.
- Exemplary, attenuated chimeric RSV have been developed and characterized which inco ⁇ orate both human RSV B subgroup glycoprotein genes F and G substituted to replace counte ⁇ art F and G glycoprotein genes within an RSV A genome.
- This exemplary chimera has been further modified to inco ⁇ orate attenuating point mutations selected from (i) a panel of mutations specifying temperature-sensitive amino acid substitutions Gln 83 ⁇ to Leu, and Tyr .3 ⁇ to Asn; (ii) a temperature-sensitive nucleotide substitution in the gene-start sequence of gene M2; and (iii) an attenuating panel of mutations adopted from cold-passaged RSV specifying amino acid substitutions Val267 He in the RSV N gene, and Cys319 to Tyr and His .69 o Tyr in the RSV polymerase gene L; or (iv) a deletion ofthe SH gene (see, e.g., U.S.
- chimeric viruses inco ⁇ orate at least two attenuating mutations which may be derived from the same or different mutant viruses.
- exemplary, attenuated chimeric PIV have also been developed and characterized which incorporate heterologous sequences from HPIV-1 and HPIV-3, as well as attenuating mutations adopted from the PIV3 mutant, cp45, as described in U.S. Serial No. 09/083,793, filed May 22, 1998 (corresponding to International Publication No. WO 98/53078) and its priority, provisional application filed May 23, 1997, Serial No. 60/047,575, each inco ⁇ orated herein by reference. More recently, all ofthe attenuating mutations identified in cp45, with the exception of those in the F protein, have been successfully inco ⁇ orated in an attenuated, recombinant HPIV3-1 chimera.
- heterologous immunogenic proteins, domains and epitopes to produce chimeric negative stranded RNA viruses is particularly useful to generate novel immune responses in an immunized host.
- Addition or substitution of an immunogenic gene or gene segment from one donor virus subgroup or strain within a recipient genome or antigenome of a different viral subgroup or strain can generate an immune response directed against the donor subgroup or strain, the recipient subgroup or strain, or against both the donor and recipient subgroup or strain.
- chimeric viruses may also be constructed that express a chimeric protein, e.g., an immunogenic protein having a cytoplasmic tail and/or transmembrane domain specific to one viral strain or subgroup fused to an ectodomain of a different virus.
- a chimeric protein e.g., an immunogenic protein having a cytoplasmic tail and/or transmembrane domain specific to one viral strain or subgroup fused to an ectodomain of a different virus.
- Other exemplary recombinants of this type may express duplicate protein regions, such as duplicate immunogenic regions.
- a variety of gene segments provide useful donor polynucleotides for inclusion within a chimeric genome or antigenome to express chimeric virus having novel and useful properties.
- heterologous gene segments may beneficially encode a cytoplasmic tail, transmembrane domain or ectodomain, an epitopic site or region, a binding site or region, an active site or region containing an active site, etc., of a selected protein from one virus.
- gene segments can be added or substituted for a counte ⁇ art gene segment(s) in another virus to yield novel chimeric recombinants, for example recombinants expressing a chimeric protein having a cytoplasmic tail and/or transmembrane domain of one virus glycoprotein fused to an ectodomain of a glycoprotein of another virus.
- Useful genome segments in this regard range from about 15-35 nucleotides in the case of gene segments encoding small functional domains of proteins, e.g., epitopic sites, to about 50, 75, 100, 200-500, and 500-1,500 or more nucleotides for gene segments encoding larger domains or protein regions.
- heterologous genes may be added or substituted in whole or in part to a background genome or antigenome to form a chimeric genome or antigenome.
- the mutation may be present, along with one or more additional mutations, in the heterologous gene (i.e., donor gene) or gene segment or may be introduced within the partial or complete, recipient antigenome or genome "background.”
- a selected protein or protein region e.g., a cytoplasmic tail, transmembrane domain or ectodomain, an epitopic site or region, a binding site or region, an active site or region containing an active site, etc.
- a selected protein or protein region e.g., a cytoplasmic tail, transmembrane domain or ectodomain, an epitopic site or region, a binding site or region, an active site or region containing an active site, etc.
- a counte ⁇ art gene or gene segment in a different viral genome or antigenome to yield novel recombinants having desired phenotypic changes compared to wild-type or parent strains.
- counte ⁇ art genes, gene segments, proteins or protein regions refer to two counte ⁇ art polynucleotides from a heterologous source, including different genes in a single species or strain, or different variants ofthe same gene, including species and allelic variants among different viral subgroups or strains.
- counte ⁇ art genes and gene segments typically share at least moderate structural similarity.
- counte ⁇ art gene segments may encode a common structural domain of a protein of interest, such as a cytoplasmic domain, transmembrane domain, ectodomain, binding site or region, epitopic site or region, etc.
- a protein of interest such as a cytoplasmic domain, transmembrane domain, ectodomain, binding site or region, epitopic site or region, etc.
- protein domains encoded by counte ⁇ art gene segments may provide a common membrane spanning function, a specific binding activity, an immunological recognition site, etc.
- Counte ⁇ art genes and gene segments for use in constructing attenuated chimeric viruses within the invention embrace an assemblage of alternate species having a range of size and sequence variation.
- a selected polynucleotide reference sequence is as a sequence or portion of a sequence present in either the donor or recipient genome or antigenome.
- This reference sequence is used as a defined sequence to provide a basis for sequence comparison.
- the reference sequence may be a defined segment of a cDNA or gene, or a complete cDNA or gene sequence.
- cDNA-based methods are useful to construct a large panel of recombinant, chimeric viruses and subviral particles inco ⁇ orating attenuating mutations identified in a heterologous virus.
- These recombinant constructs offer improved characteristics of attenuation and immunogenicity for use as vaccine agents.
- desired phenotypic changes in this context are resistance to reversion from an attenuated phenotype, improvements in attenuation in culture or in a selected host environment, immunogenic characteristics (e.g., as determined by enhancement, or diminution, of an elicited immune response), upregulation or downregulation of transcription and/or translation of selected viral products, etc.
- Attenuated recombinant viruses inco ⁇ orating an attenuating mutation identified in a heterologous virus are further modified by introducing one or more additional attenuating mutations that specify an altered attenuating phenotype. These mutations may be generated de novo and tested for attenuating effects according to a rational design mutagenesis strategy.
- the attenuating point mutations are identified in biologically-derived mutants, e.g., an RSV or PIV ts or cp mutant, and thereafter inco ⁇ orated into an attenuated recombinant virus of the invention.
- the recombinant thus further attenuated may be a chimeric virus.
- biologically-derived mutant virus any mutant virus not produced by recombinant means.
- biologically-derived mutant viruses may be of any negative stranded RNA viral species, subgroup or strain, e.g., naturally occurring RSV or PIV having a mutant genomic sequence or RSV or PIV having genomic variations from a reference wild-type sequence, e.g., having a mutation specifying an attenuated phenotype.
- biologically-derived viruses include mutants derived from a parental strain by, inter alia, artificial mutagenesis and selection procedures.
- Attenuating mutations identified as described above are compiled into a "menu” and are then introduced as desired, singly or in combination, to adjust a candidate vaccine virus to an appropriate level of attenuation, immunogenicity, genetic resistance to reversion from an attenuated phenotype, etc., as desired.
- recombinant mutant viruses ofthe invention are attenuated by inco ⁇ oration of at least one, and, more preferably, two or more attenuating point mutations identified from such a menu, for example a panel of RSV mutants such as cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579).
- RSV mutants such as cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/95
- Additional mutations may be inco ⁇ orated from conspecific or heterologous viruses, including viruses having ts, cp, or non-ts or non- ⁇ p attenuating mutations as identified, e.g., in small plaque (sp), cold-adapted (ca) or host-range restricted (hr) mutant strains.
- Attenuating mutations may be selected in coding portions of genes or in non-coding regions such as a cis-regulatory sequence.
- attenuating mutations may include single or multiple base changes in a gene start sequence, as exemplified by a single base substitution in the RSV M2 gene start sequence at nucleotide 7605.
- Attenuation of recombinant vaccine candidates can be finely calibrated for use in one or more classes of patients, including seronegative infants.
- the capability of producing virus from cDNA allows for routine inco ⁇ oration of these mutations, individually or in various selected combinations, into a full-length cDNA clone, whereafter the phenotypes of rescued recombinant viruses containing the introduced mutations can be readily determined.
- the invention provides for other, site-specific modifications at, or within close proximity to, the identified mutation.
- site-specific mutations include insertions, substitutions, deletions or rearrangements of from 1 to 3, up to about 5-15 or more altered nucleotides (e.g., altered from a wild-type sequence, from a sequence of a selected mutant strain, or from a parent recombinant clone subjected to mutagenesis). Such site-specific mutations may be inco ⁇ orated at, or within the region of, a selected attenuating mutation.
- the mutations can be introduced in various other contexts within a viral clone, for example at or near a cis-acting regulatory sequence or nucleotide sequence encoding a protein active site, binding site, immunogenic epitope, etc.
- Site-specific viral mutants typically retain a desired attenuating phenotype, but may exhibit substantially altered phenotypic characteristics unrelated to attenuation, e.g., enhanced or broadened immunogenicity, or improved growth.
- site-specific mutants include recombinant viruses that inco ⁇ orate additional, stabilizing nucleotide mutations in a codon specifying an attenuating mutation.
- two or more nucleotide substitutions are introduced at codons that specify attenuating amino acid changes in a parent mutant or recombinant clone, yielding a recombinant having genetic resistance to reversion from an attenuated phenotype.
- site-specific nucleotide substitutions, additions, deletions or rearrangements are introduced upstream (N-terminal direction with regard to the encoded viral proteins) or downstream (C-terminal direction), e.g, from 1 to 3, 5-10 and up to 15 nucleotides or more 5' or 3', relative to a targeted nucleotide position, e.g., to construct or ablate an existing cis-acting regulatory element.
- changes to attenuated recombinant viruses ofthe invention include deletions, insertions, substitutions or rearrangements of whole genes or gene segments. These mutations may alter small numbers of bases (e.g., from 15-30 bases, up to 35-50 bases or more), or large blocks of nucleotides (e.g., 50-100, 100-300, 300-500, 500-1,000 bases) in the donor or recipient genome or antigenome, depending upon the nature ofthe change (i.e., a small number of bases may be changed to insert or ablate an immunogenic epitope or change a small gene segment, whereas large block(s) of bases are involved when genes or large gene segments are added, substituted, deleted or rearranged.
- bases e.g., from 15-30 bases, up to 35-50 bases or more
- large blocks of nucleotides e.g., 50-100, 100-300, 300-500, 500-1,000 bases
- a small number of bases may be changed to insert or ablate an immunogenic epitope or change
- the invention provides for supplementation of mutations adopted into a recombinant negative stranded viral CDNA from heterologous viruses, e.g., cp and ts mutations, with additional types of mutations involving the same or different genes in a further modified recombinant virus.
- viral proteins can be selectively altered in terms of expression levels, or can be added, deleted, substituted or rearranged, in whole or in part, alone or in combination with other desired modifications, to yield a recombinant, attenuated virus with additional novel vaccine characteristics.
- the present invention also provides a range of additional methods for attenuating and otherwise modifying recombinant vaccine candidates based on recombinant engineering.
- a variety of alterations can be produced in an isolated polynucleotide sequence encoding the recombinant genome or antigenome.
- the invention allows for introduction of modifications which delete, substitute, introduce, or rearrange a selected nucleotide or plurality of nucleotides from a parent genome or antigenome, as well as mutations which delete, substitute, introduce or rearrange whole gene(s) or gene segment(s), within a parent genome or antigenome.
- Desired modifications of attenuated recombinant virues are typically selected to specify a desired phenotypic change, e.g., a change in viral growth, temperature sensitivity, ability to elicit a host immune response, attenuation, etc.
- genes of interest in this regard include any viral gene, e.g., 3'- NS1-NS2-N-P-M-SH-G-F-M2-L-5' in the case of RSV, as well as heterologous genes from other viruses.
- modifications in a recombinant vaccine candidate which alter or ablate expression of a selected gene, e.g., by introducing a termination codon within a selected RSV coding sequence, changing the position of a gene relative to an operably linked promoter, introducing an upstream start codon to alter rates of expression, modifying (e.g., by changing position, altering an existing sequence, or substituting an existing sequence with a heterologous sequence) transcription signals to alter phenotype (e.g., growth, temperature restrictions on transcription, etc.), and various other deletions, substitutions, additions and rearrangements that specify quantitative or qualitative changes in viral replication, transcription of selected gene(s), or translation of selected protein(s).
- the ability to analyze and inco ⁇ orate other types of attenuating mutations into recombinant vaccine candidates extends to a broad assemblage of targeted changes in recombinant clones. For example, deletion ofthe SH gene in RSV yields a recombinant RSV having novel phenotypic characteristics, including enhanced growth.
- an SH gene deletion (or any other non-essential gene or gene segment deletion), is combined in a recombinant virus with one or more additional mutations specifying an attenuated phenotype, e.g., one or more point mutation(s) adopted from a heterologous virus optionally supplemented by one or more further attenuating mutations adopted from a biologically-derived attenuated mutant.
- the SH gene or NS2 gene of RSV is deleted in combination with one or more cp and/or ts mutations adopted from cpts248/404, cpts530/1009, cpts530/1030, or another selected mutant RSV strain, to yield a recombinant RSV having increased yield of virus, enhanced attenuation, and resistance to phenotypic reversion, due to the combined effects ofthe different mutations.
- the modified viral genome is 14,825 nt long, 398 nucleotides less than wild-type.
- the invention provides several readily obtainable methods and materials for improving chimeric RSV growth.
- a variety of other genetic alterations can be produced in a recombinant genome or antigenome for inco ⁇ oration into infectious viruses attenuated in accordance with the methods ofthe invention.
- Additional heterologous genes or gene segments e.g. from different viral genes, or different viral strains or types
- Different or additional modifications in the sequence can be made to facilitate manipulations, such as the insertion of unique restriction sites in various intergenic regions or elsewhere.
- Nontranslated gene sequences can be removed to increase capacity for inserting foreign sequences.
- Preferred mutations in this context include mutations directed toward cis- acting signals, which can be identified, e.g., by mutational analysis of viral minigenomes. For example, insertional and deletional analysis ofthe leader and trailer and flanking sequences identified viral promoters and transcription signals and provided a series of mutations associated with varying degrees of reduction of RNA replication or transcription. Saturation mutagenesis (whereby each position in turn is modified to each ofthe nucleotide alternatives) of these cis-acting signals also has identified many mutations which reduced (or in two cases increased) RNA replication or transcription. Any of these mutations can be inserted into a recombinant antigenome or genome as described herein.
- the level of expression of specific proteins can be increased by substituting the natural codon usage with one which has been designed to be consistent with efficient translation and assembled into synthetic CD ⁇ A.
- codon usage can be a major factor in the level of translation of mammalian viral proteins (Haas et al., Current Biol. 6:315-324 (1996)).
- Examination ofthe codon usage ofthe mR ⁇ As encoding the F and G proteins of RSV, which are the major protective antigens shows that the usage is consistent with poor expression.
- codon usage can be improved by the recombinant methods ofthe invention to achieve improved expression for selected genes.
- a sequence surrounding a translational start site (preferably including a nucleotide in the -3 position) of a selected viral gene is modified, alone or in combination with introduction of an upstream start codon, to modulate gene expression ofthe attenuated recombinant virus by specifying up- or down- regulation of translation.
- Attenuated RSV gene expression can be modulated by altering a transcriptional GS signal of a selected gene(s) ofthe virus.
- the GS signal of ⁇ S2 is modified to include a defined mutation (e.g., the 404(M2) mutation described hereinbelow) to superimpose a ts restriction on viral replication.
- additional attenuated RSV clones can inco ⁇ orate modifications to a transcriptional GE signal.
- RSV clones may be generated which have a substituted or mutated GE signal ofthe NS1 and NS2 genes for that ofthe N gene, resulting in decreased levels of readthrough mRNAs and increased expression of proteins from downstream genes.
- the resulting recombinant virus will exhibit increased growth kinetics and increased plaque size, providing but one example of alteration of RSV growth properties by modification of a cis-acting regulatory element in the RSV genome.
- G protein of an attenuated recombinant RSV is increased by modification ofthe G mRNA.
- the G protein is expressed as both a membrane bound and a secreted form, the latter form being expressed by translational initiation at a start site within the G translational open reading frame.
- the secreted form can account for as much as one-half of the expressed G protein.
- Ablation ofthe internal start site e.g., by sequence alteration, deletion, etc.
- sequence context ofthe upstream start site yields desired changes in G protein expression.
- Ablation ofthe secreted form of G also will improve the quality ofthe host immune response to exemplary, chimeric RSV, because the soluble form of G is thought to act as a "decoy" to trap neutralizing antibodies. Also, soluble G protein has been implicated in enhanced immunopathology due to its preferential stimulation of a Th2- biased response.
- levels of attenuated recombinant viral gene expression are modified at the level of transcription.
- the position of a selected gene in the RSV gene map can be changed to a more promoter-proximal or promotor-distal position, whereby the gene will be expressed more or less efficiently, respectively.
- modulation of expression for specific genes can be achieved yielding reductions or increases of gene expression from two-fold, more typically four-fold, up to ten-fold or more compared to wild-type levels.
- the NS2 gene of RSV (second in order in the RSV gene map) is substituted in position for the SH gene (sixth in order), yielding a predicted decrease in expression of NS2.
- RSV genes due to positional changes can be achieved up to 10-fold or more, often attended by a commensurate decrease in expression levels for reciprocally, positionally substituted genes.
- viral genes may be transpositioned singly or together to a more promoter-proximal or promoter-distal site within the recombinant viral gene map to achieve higher or lower levels of gene expression, respectively.
- Attenuated recombinant viruses are further modified by ablating expression of a viral gene, for example the NS2 gene of RSV, at the translational level without deletion ofthe gene or of a segment thereof, by, e.g., introducing two tandem translational termination codons into a translational open reading frame (ORF).
- ORF translational open reading frame
- These forms of "knock-out" virus can exhibit reduced growth rates and small plaque sizes in tissue culture.
- the methods and compositions ofthe invention provide yet additional, novel types of attenuating mutations which ablate expression of a viral gene that is not one ofthe major viral protective antigens or essential for viral growth.
- knockout virus phenotypes produced without deletion of a gene or gene segment can be alternatively produced by deletion mutagenesis, as described herein, to effectively preclude correcting mutations that may restore synthesis of a target protein.
- Methods for producing these and other knock-outs are well known in the art (as described, for example, in Kretzschmar et al.. Virology 216:309-316 (1996); Radecke et al.. Virology 217:418-412 (1996); and Kato et al.. EMBO J. 16:178-587 (1987); and Schneider et al., Virology 277:314-322 (1996), each inco ⁇ orated herein by reference).
- Infectious recombinant viral clones ofthe invention can also be engineered according to the methods and compositions disclosed herein to enhance immunogenicity and induce a level of protection greater than that provided by infection with a wild-type or parent recombinant virus.
- an immunogenic epitope from a heterologous viral strain or type e.g., PIV
- a recombinant clone e.g., RSV
- viruses can be engineered to add or ablate (e.g., by amino acid insertion, substitution or deletion) immunogenic epitopes associated with desirable or undesirable immunological reactions.
- additional genes or gene segments may be inserted into or proximate to a recipient genome or antigenome. These genes may be under common control with recipient genes, or may be under the control of an independent set of transcription signals. Genes of interest include those encoding cytokines (e.g., IL-2 through IL-15, especially IL-2, IL-6 and IL-12, etc.), gamma- interferon, and proteins rich in T helper cell epitopes. These additional proteins can be expressed either as a separate protein, or as a chimera engineered from a second copy of one ofthe viral proteins, such as SH. This provides the ability to modify and improve the immune responses against the virus both quantitatively and qualitatively.
- cytokines e.g., IL-2 through IL-15, especially IL-2, IL-6 and IL-12, etc.
- gamma- interferon e.g., IL-2, IL-6 and IL-12, etc.
- proteins rich in T helper cell epitopes e
- insertion of foreign genes or gene segments, and in some cases of noncoding nucleotide sequences, within a recombinant viral genome results in a desired increase in genome length causing yet additional, desired phenotypic effects.
- Increased genome length results in attenuation of the resultant virus, dependent in part upon the length ofthe insert.
- certain proteins e.g. a cytokine
- IL-2 expressed in vaccinia virus (e.g. Flexner et al., Nature 33:-259-62 (1987)) and is also expected for gamma interferon.
- bovine RSV sequences are selected for introduction into human RSV based on known aspects of bovine RSV structure and function, as provided in, e.g., Pastey et al., J. Gen. Virol. 76:193-197 (1993); Pastey et al., Virus Res. 29:195-202 (1993); Zamora et al, J. Gen. Virol. 73:737-741 (1992); Mallipeddi et al, J. Gen. Virol.
- mutations of interest for introduction within chimeric RSV are modeled after a tissue culture-adapted nonpathogenic strain of pneumonia virus of mice (the murine counte ⁇ art of human RSV) which lacks a cytoplasmic tail ofthe G protein (Randhawa et al., Virology 207:240-245 (1995)).
- the cytoplasmic and/or transmembrane domains of one or more ofthe human RSV glycoproteins, F, G and SH are added, deleted, modified, or substituted within an attenuated recombinant RSV using a heterologous counte ⁇ art sequence (e.g., a sequence from a cytoplasmic, or transmembrane domain of a F, G, or SH protein of murine pneumonia virus) to achieve a desired attenuation.
- a heterologous counte ⁇ art sequence e.g., a sequence from a cytoplasmic, or transmembrane domain of a F, G, or SH protein of murine pneumonia virus
- a nucleotide sequence at or near the cleavage site ofthe F protein, or the putative attachment domain ofthe G protein can be modified by point mutations, site-specific changes, or by alterations involving entire genes or gene segments to achieve novel effects on viral growth in tissue culture and/or infection and pathogenesis.
- compositions e.g., isolated polynucleotides and vectors comprising a recombinant negative stranded RNA viral genome inco ⁇ orating a mutation identified in a heterologous virus
- infectious viruses and subviral particles are generated from a recombinant genome or antigenome and selected viral proteins, e.g., a nucleocapsid (N) protein, a nucleocapsid phosphoprotein (P), a large (L) polymerase protein, and an RNA polymerase elongation factor in the case of RSV.
- compositions and methods are provided for introducing the aforementioned structural and phenotypic changes into a recombinant virus to yield infectious, attenuated vaccine viruses.
- infectious, recombinant virus introduction ofthe foregoing defined mutations into an infectious, recombinant virus are achieved by a variety of well known methods as referenced above.
- infectious clone is meant cDNA or its product, synthetic or otherwise, which can be transcribed into genomic or antigenomic RNA capable of serving as template to produce an infectious virus or subviral particle.
- defined mutations can be introduced by conventional techniques (e.g., site-directed mutagenesis) into a cPNA copy ofthe genome or antigenome.
- antigenome or genome cPNA subfragments to assemble a complete antigenome or genome cPNA as described herein has the advantage that each region can be manipulated separately (smaller cPNAs are easier to manipulate than large ones) and then readily assembled into a complete cPNA.
- the complete antigenome or genome cPNA, or any subfragment thereof can be used as template for oligonucleotide-directed mutagenesis.
- a mutated subfragment can then be assembled into the complete antigenome or genome cPNA.
- a variety of other mutagenesis techniques are known and available for use in producing the mutations of interest in the antigenome or genome cPNA. Mutations can vary from single nucleotide changes to replacement of large cPNA pieces containing one or more genes or genome regions.
- mutations are introduced by using the Muta-gene phagemid in vitro mutagenesis kit available from Bio-Rad.
- cPNA encoding a portion of an RSV genome or antigenome is cloned into the plasmid pTZl 8U, and used to transform CJ236 cells (Life Technologies).
- Phagemid preparations are prepared as recommended by the manufacturer.
- Oligonucleotides are designed for mutagenesis by introduction of an altered nucleotide at the desired position ofthe genome or antigenome.
- the plasmid containing the genetically altered genome or antigenome fragment is then amplified and the mutated piece is then reintroduced into the full-length genome or antigenome clone.
- the invention also provides methods for producing an attenuated infectious recombinant virus inco ⁇ orating a mutation identified in a heterologous virus from one or more isolated polynucleotides, e.g., one or more cPNAs.
- a cPNA encoding a subject viral genome or antigenome is constructed for intracellular or in vitro coexpression with the necessary viral proteins to form, for example, infectious RSV.
- antigenome is meant an isolated positive-sense polynucleotide molecule which serves as the template for the synthesis of progeny viral genome.
- a cPNA is constructed which is a template for synthesis of a positive-sense version ofthe genome, corresponding to the replicative intermediate RNA, or antigenome, so as to minimize the possibility of hybridizing with positive-sense transcripts ofthe complementing sequences that encode proteins that facilitate generation of a transcribing, replicating nucleocapsid.
- the genome or antigenome ofthe recombinant virus need only contain those genes or portions thereof necessary to render the viral or subviral particles encoded thereby infectious.
- genes or portions thereof may be provided by more than one polynucleotide molecule, i.e., a gene may be provided by complementation or the like from a separate nucleotide molecule.
- recombinant virus is meant a complete virus or virus-like subviral particle derived directly or indirectly from a recombinant expression system or propagated from virus or subviral particles produced therefrom.
- the recombinant expression system will employ a recombinant expression vector which comprises an operably linked transcriptional unit comprising an assembly of at least a genetic element or elements having a regulatory role in viral gene expression, for example, a promoter, a structural or coding sequence which is transcribed into viral RNA, and appropriate transcription initiation and termination sequences.
- the genome or antigenome is expressed according to known methods to (i) produce a nucleocapsid capable of RNA replication, and (ii) render progeny nucleocapsids competent for both RNA replication and transcription. Transcription by the genome nucleocapsid provides the other proteins and initiates a productive infection. Alternatively, additional viral proteins essential for a productive infection can be supplied by coexpression.
- a viral antigenome may be constructed for use in the present invention by, e.g., assembling cloned cPNA segments, representing in aggregate the complete antigenome, by polymerase chain reaction (PCR; described in, e.g., U.S. Patent Nos.
- cPNAs containing the antigenome or portions thereof are assembled in an appropriate expression vector, such as a plasmid or various available cosmid, phage, or PNA virus vectors.
- the vector may be modified by mutagenesis and/or insertion of synthetic polylinker containing unique restriction sites designed to facilitate assembly.
- a particular vector such as RSV
- pBR322 stabilizes the viral sequence which may otherwise sustain nucleotide deletions or insertions.
- propagation of plasmid may be facilitated by selection of a particular bacterial strain (e.g., PHI 0B) to avoid an artifactual duplication and insertion which otherwise occurs (e.g., in the vicinity of nt 4499 for RSV).
- complementing sequences encoding proteins necessary to generate a transcribing, replicating viral nucleocapsid are provided by one or more helper viruses.
- helper viruses can be wild-type or mutant.
- the helper virus can be distinguished phenotypically from the virus encoded by the cPNA.
- Such antibodies can be neutralizing antibodies.
- the antibodies can be used in affinity chromatography to separate the helper virus from the recombinant virus.
- mutations can be introduced into the cPN A to provide antigenic diversity from the helper virus, such as in the RSV HN or F glycoprotein genes.
- nucleotide insertions and deletions can be made in the viral genome or antigenome to generate a modified, attenuated viral clone.
- Members ofthe Paramyxovirus and Morbillivirus genera typically abide by a "rule of six," i.e., genomes (or minigenomes) replicate efficiently only when their nucleotide length is a multiple of six (thought to be a requirement for precise spacing of nucleotide residues relative to encapsidating N protein).
- cPNA encoding a recombinant negative stranded RNA viruses inco ⁇ orating a mutation identified in a heterologous virus
- Alternative means to construct cPNA encoding a recombinant negative stranded RNA viruses inco ⁇ orating a mutation identified in a heterologous virus include by reverse transcription-PCR using improved PCR conditions (e.g., as described in Cheng et al., Proc. Natl. Acad. Sci. USA 91:5695-5699 (1994), inco ⁇ orated herein by reference) to reduce the number of subunit cPNA components to as few as one or two pieces.
- different promoters can be used (e.g., T3, SP6) or different ribozymes (e.g., that of hepatitis delta virus.
- Pifferent PNA vectors e.g., cosmids
- Isolated polynucleotides e.g., cPNA
- cPNA encoding the viral genome or antigenome and, separately or in cis, the necessary viral proteins, are inserted by transfection, electroporation, mechanical insertion, transduction or the like, into cells which are capable of supporting a productive viral infection, e.g., HEp-2, FRhL-PBS2, MRC, and Vero cells.
- Transfection of isolated polynucleotide sequences may be introduced into cultured cells by, for example, calcium phosphate-mediated transfection (Wigler et al., C l j_4:725 (1978); Corsaro and Pearson, Somatic Cell Genetics 7:603 (1981); Graham and Van der Eb, Virology 52:456 (1973)), electroporation (Neumann et al., EMBO J.
- the viral proteins are encoded by one or more expression vectors which can be the same or separate from that which encodes the genome or antigenome, and various combinations thereof.
- Additional proteins may be included as desired, encoded by its own vector or by a vector encoding essential viral proteins.
- Expression ofthe genome or antigenome and proteins from transfected plasmids can be achieved, for example, by each cPNA being under the control of a promoter for T7 RNA polymerase, which in turn is supplied by infection, transfection or transduction with an expression system for the T7 RNA polymerase, e.g., a vaccinia virus MVA strain recombinant which expresses the T7 RNA polymerase (Wyatt et al., Virology, 210:202-205 (1995), inco ⁇ orated herein by reference).
- the viral proteins, and/or T7 RNA polymerase can also be provided from transformed mammalian cells, or by transfection of preformed mRNA or protein.
- antigenome or genome can be conducted in vitro (cell-free) in a combined transcription-translation reaction, followed by transfection into cells.
- antigenome or genome RNA can be synthesized in vitro and transfected into cells expressing viral proteins.
- virus which will be most desired in vaccines ofthe invention must maintain viability, have a stable attenuation phenotype, exhibit replication in an immunized host (albeit at lower levels), and effectively elicit production of an immune response in a vaccinee sufficient to confer protection against serious disease caused by subsequent infection from wild-type virus.
- viruses ofthe invention are not only viable and more attenuated then previous mutants, but are more stable genetically in vivo than those previously studied mutants— retaining the ability to stimulate a protective immune response and in some instances to expand the protection afforded by multiple modifications, e.g., induce protection against different viral strains or subgroups, or protection by a different immunologic basis, e.g., secretory versus serum immunoglobulins, cellular immunity, and the like.
- a number of cell lines which allow for viral growth may be used.
- Preferred cell lines for propagating attenuated viruses for vaccine use include OBS-FRhL-2, MRC-5, and Vero cells. Highest RSV yields are usually achieved with epithelial cell lines such as Vero cells.
- Cells are typically inoculated with virus at a multiplicity of infection ranging from about 0.001 to 1.0 or more, and are cultivated under conditions permissive for replication ofthe virus, e.g., at about 30-37°C and for about 3-5 days, or as long as necessary for virus to reach an adequate titer.
- Virus is removed from cell culture and separated from cellular components, typically by well known clarification procedures, e.g., centrifugation, and may be further purified as desired using procedures well known to those skilled in the art.
- Recombinant virus which has been attenuated as described herein can be tested in various well known and generally accepted in vitro and in vivo models to confirm adequate attenuation, resistance to phenotypic reversion, and immunogenicity for vaccine use.
- the modified virus e.g., a multiply attenuated, biologically-derived or recombinant virus
- the modified virus is tested for temperature sensitivity of virus replication, i.e. ts phenotype, and for the small plaque phenotype.
- Modified viruses are further tested in animal models of viral infection. A variety of animal models for RSV have been described and are summarized in Meignier et al., eds., Animal Models of Respiratory Syncytial Virus Infection.
- the amount of RSV neutralizing antibodies associated with a therapeutic effect in cotton rats as measured by the level of such antibodies in the serum of treated animals is in the same range as that demonstrated for monkeys (i.e., titer of 1 :539) or human infants or small children (i.e., 1 :877).
- a therapeutic effect in cotton rats was manifest by a one hundred fold or greater reduction in virus titer in the lung (Prince et al., J. Virol. 61 :1851-1854) while in monkeys a therapeutic effect was observed to be a 50-fold reduction in pulmonary virus titer.
- mice will also be similarly useful because these animals are moderately permissive for RSV replication and have a core temperature more like that of humans (Wright et al., J. Infect. Pis. 122:501-512 (1970) and Anderson et al., J. Gen. Virol. 71:(1990)). Like models are available and widely known for other negative stranded RNA viruses.
- the invention also provides isolated, infectious attenuated viral compositions for vaccine use.
- the attenuated virus which is a component of a vaccine is in an isolated and typically purified form.
- isolated is meant to refer to RSV which is in other than a native environment of a wild-type virus, such as the nasopharynx of an infected individual. More generally, isolated is meant to include the attenuated virus as a component of a cell culture or other artificial medium.
- attenuated RSV of the invention may be produced by an infected cell culture, separated from the cell culture and added to a stabilizer.
- Vaccines ofthe invention contain as an active ingredient an immunogenically effective amount of a recombinant negative stranded RNA virus bearing a mutation identified in a heterologous virus as described herein.
- Recombinant virus can be used directly in vaccine formulations, or lyophilized. Lyophilized virus will typically be maintained at about 4°C.
- a stabilizing solution e.g., saline or comprising SPG, Mg ⁇ and HEPES, with or without adjuvant, as further described below.
- the biologically-derived or recombinantly modified virus may be introduced into a host with a physiologically acceptable carrier and/or adjuvant.
- Useful carriers are well known in the art, and include, e.g., water, buffered water, 0.4%) saline, 0.3% glycine, hyaluronic acid and the like.
- the resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration, as mentioned above.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, and the like.
- Acceptable adjuvants include incomplete Freund's adjuvant, aluminum phosphate, aluminum hydroxide, or alum, which are materials well known in the art.
- Preferred adjuvants also include StimulonTM QS-21 (Aquila Biopharmaceuticals, Inc., Worchester, MA), MPLTM (3-0-deacylated monophosphoryl lipid A; RIBI ImmunoChem Research, Inc., Hamilton, MT), and interleukin-12 (Genetics Institute, Cambridge, MA).
- the immune system of the host Upon immunization with an attenuated viral vaccine composition as described herein, via aerosol, droplet, oral, topical or other route, the immune system of the host responds to the vaccine by producing antibodies specific for one or more viral proteins, e.g., RSV F and/or G glycoproteins.
- the host becomes at least partially or completely immune to infection by the subject virus, or resistant to developing moderate or severe disease related thereto.
- Vaccines ofthe invention may comprise attenuated virus that elicits an immune response against a single viral strain or antigenic subgroup, e.g. RSV A or B, or against multiple strains or subgroups.
- a chimeric vaccine virus can elicit a monospecific immune response or a polyspecific immune response against multiple strains or subgroups.
- chimeric viruses having different immunogenic characteristics can be combined in a vaccine mixture or administered separately in a coordinated treatment protocol to elicit more effective protection against one RSV strain, or against multiple RSV strains or subgroups.
- the host to which the vaccine is administered can be any mammal susceptible to infection by the subject virus or a closely related virus and capable of generating a protective immune response to antigens ofthe vaccinating virus.
- suitable hosts include humans, non-human primates, bovine, equine, swine, ovine, caprine, lagamo ⁇ h, rodents, etc.
- the invention provides methods for creating vaccines for a variety of human and veterinary uses.
- the vaccine compositions containing the attenuated recombinant virus of the invention are administered to a patient susceptible to or otherwise at risk of infection by the subject virus in an "immunogenically effective dose" which is sufficient to induce or enhance the individual's immune response capabilities against the subject virus.
- the attenuated virus ofthe invention is administered according to well established human vaccine protocols, e.g., as described for RSV in, Wright et al., Infect Immun. 37:397-400 (1982), Kim et al., Pediatrics 52:56-63 (1973), and Wright et al, J . Pediatr. 88:931-936 (1976), which are each inco ⁇ orated herein by reference.
- RSV vaccine e.g., as described for RSV in, Wright et al., Infect Immun. 37:397-400 (1982), Kim et al., Pediatrics 52:56-63 (1973), and Wright et al, J . Pediatr. 88:931-936 (1976), which are each inco ⁇ orated herein by reference.
- RSV vaccine typically in a volume of 0.5 ml of a physiologically acceptable diluent or carrier.
- the precise amount of attenuated viral vaccine administered and the timing and repetition of administration will be determined based on the patient's state of health and weight, the mode of administration, the nature ofthe formulation, etc. Posages will generally range from about 10 to about 10 plaque forming units (PFU) or more of virus per patient, more commonly from about 10 4 to 10 5 PFU virus per patient.
- the vaccine formulations should provide a quantity of attenuated virus ofthe invention sufficient to effectively stimulate or induce an anti-viral immune response, e.g., as can be determined by complement fixation, plaque neutralization, and/or enzyme- linked immunosorbent assay, among other methods. In this regard, individuals are also monitored for signs and symptoms of upper respiratory illness.
- the attenuated virus ofthe vaccine grows in the nasopharynx of vaccinees at levels approximately 10-fold or more lower than wild-type virus, or approximately 10- fold or more lower when compared to levels of incompletely attenuated virus.
- multiple administration may be required to elicit sufficient levels of immunity.
- administration should begin within the first month of life, and at intervals throughout childhood, such as at two months, six months, one year and two years, as necessary to maintain sufficient levels of protection against native (wild-type) RSV infection.
- adults who are particularly susceptible to repeated or serious RSV infection such as, for example, health care workers, day care workers, family members of young children, the elderly, individuals with compromised cardiopulmonary function, may require multiple immunizations to establish and/or maintain protective immune responses.
- Levels of induced immunity can be monitored by measuring amounts of neutralizing secretory and serum antibodies, and dosages adjusted or vaccinations repeated as necessary to maintain desired levels of protection.
- vaccine viruses may be indicated for administration to different recipient groups.
- an engineered recombinant expressing a cytokine or an additional protein rich in T cell epitopes may be particularly advantageous for adults rather than for infants.
- Vaccines produced in accordance with the present invention can be combined with viruses expressing antigens of another subgroup or strain of virus to achieve protection against multiple subgroups or strains.
- the vaccine virus may inco ⁇ orate protective epitopes of multiple viral strains or subgroups engineered into one clone as described herein.
- Attenuated recombinant vaccines ofthe invention elicit production of an immune response that is protective against serious disease, such as pneumonia and bronchiolitis, when the individual is subsequently infected with wild-type virus. While the naturally circulating virus may still be capable of causing infection, there is a very greatly reduced possibility of disease symptoms as a result ofthe vaccination and possible boosting of resistance by subsequent infection by wild-type virus. Following vaccination, there are detectable levels of host engendered serum and secretory antibodies which are capable of neutralizing homologous (ofthe same subgroup) wild-type virus in vitro and in vivo. In many instances the host antibodies will also neutralize wild-type virus of a different, non-vaccine subgroup.
- Preferred attenuated viruses ofthe present invention exhibit a very substantial diminution of virulence when compared to wild-type virus that is circulating naturally in humans.
- the chimeric virus is sufficiently attenuated so that symptoms of infection will not occur in most immunized individuals. In some instances the attenuated virus may still be capable of dissemination to unvaccinated individuals. However, its virulence is sufficiently abrogated such that severe lower respiratory tract infections in the vaccinated or incidental host do not occur.
- the level of attenuation of vaccine viruses of the invention may be determined by, for example, quantifying the amount of virus present, e.g., in the respiratory tract, in an immunized host and comparing the amount to that produced by wild-type or other attenuated viruses which have been evaluated as candidate vaccine strains.
- attenuated RSV ofthe invention will have a greater degree of restriction of replication in the upper respiratory tract of a highly susceptible host, such as a chimpanzee, compared to the levels of replication of wild-type virus, e.g., 10- to 1000- fold less.
- the level of replication of attenuated RSV vaccine strains in the upper respiratory tract ofthe chimpanzee should be less than that ofthe RSV A2 ts-1 mutant, which was demonstrated previously to be incompletely attenuated in seronegative human infants.
- an ideal vaccine candidate virus should exhibit a restricted level of replication in both the upper and lower respiratory tract.
- the attenuated viruses ofthe invention must be sufficiently infectious and immunogenic in humans to confer protection in vaccinated individuals.
- Specimens are obtained by aspiration or washing out of nasopharyngeal secretions and virus quantified in tissue culture or other by laboratory procedure. See, for example, Belshe et al., J. Med. Virology 1:157-162 (1977), Friedewald et al, J. Amer. Med. Assoc. 204:690-694 (1968); Gha ⁇ ure et al, J. Virol. 3:414-421 (1969); and Wright et al., Arch. Ges. Virusforsch. 41:238-247 (1973), each inco ⁇ orated herein by reference.
- the virus can conveniently be measured in the nasopharynx of host animals, such as chimpanzees. Other methods for determining levels and virulence of additional negative stranded RNA viruses are widely known and readily practiced.
- a panel of known mutations within the HPIV3 mutant strain JS 45 was analyzed.
- This panel of mutations includes ts attenuating amino acid substitutions in the polymerase L gene at parental residue/sequence positions Tyr 942 , Leu 92 , and/or Thri 5 5 8 .
- the JS cp45 mutant L protein exhibits attenuating mutations where the parental Tyr 42 is replaced by His, Leu 992 is replaced by Phe, and/or Thr_ 558 is replaced by He (see, U.S. Patent Application No. 08/083,793 and corresponding International Application No. WO 98/53078, inco ⁇ orated herein by reference).
- these mutations were not only mapped against parental sequences to identify the changes, but were also successfully inco ⁇ orated in PIV recombinants (r942, r992, rl558, r942/992, r992/1558, r942/1558, and r942/992/1558), singly and in combination, to confirm their attenuating effects and recoverability into cloned, infectious virus. Additional exemplary mutations were evaluated in the HPIV3 JS cp45 mutant which were mapped and characterized to encode attenuating amino acid substitutions in the F and C proteins of HPIV3.
- mutations include non-ts attenuating amino acid substitutions in the C protein at the parental residue/position Ile 96 of JS HPIV3, as exemplified by the substitution of Ile 6 to Thr.
- Further exemplary mutations identified in the F protein of HPIV3 encode amino acid substitutions at parental residue/positions Ile 42 o and Ala ⁇ o, as exemplified by the substitutions Ile 42 o to Val and Ala ⁇ o to Thr.
- Each attenuating mutation thus identified in HPIV3 provided an index for sequence comparison against a homologous protein in other negative stranded viruses.
- conventional sequence alignments were undertaken in accordance with the methods outlined above to map the mutations identified in the HPIV3 L and F proteins to corresponding sites among a panel of heterologous negative stranded RNA viruses (HPIVl, Sendai virus, HPIV2, BPIV3, MeV and RSV).
- HPIVl Sendai virus
- HPIV2, BPIV3, MeV and RSV heterologous negative stranded RNA viruses
- Table 2 Sequence alignment ofthe region around the attenuating mutations identified in the F and L proteins HPIV3 cp45
- HPIV3 407 1 QGVKIITHKECSTIGINGMLFNTNKEGTLAFYTPNDITLNNSVALDPIDISIE (SEQ ID NO. 1)
- HPIVl 410 RGVTFLTYTNCGLIGINGIELYANKRGRDTTWGNQIIKVGPAVSIRPVDISLN (SEQ ID NO. 3)
- each ofthe L and F mutations analyzed changed a parental sequence element that was substantially conserved, marked either by the presence of identical or conservative amino acid residues, at corresponding positions among the viral taxa shown.
- the cp45 L protein mutation changing the parental residue Tyr 94 to His mapped highly conservatively, as indicated by retention of identical tyrosine residues at corresponding wild-type positions in each ofthe Sendai, HPIV2, HPIV3, BPIV3 and MeV L proteins (Table 2).
- the cp45 L mutation featuring Leu 992 replaced by Phe maps to a parental residue/position that is identically conserved between the Sendai, HPIV3, BPIV3 and MeV L proteins.
- PIV3 431 NAYGSNSAISYENAVDYYQSFIGIKFNKFIEPQLDEDLTIY (SEQ ID NO. 27) 456 Z11575
- CDV 423 NAHASGEGITYSQCIEN KSFAGIRFKCFMPLSLDSDLTMY (SEQ ID NO. 32) 448 P24658
- HENDRA 430 RLKNSGESLTVDDCVKNWESFCGIQFDCFMELKLDSDLSMY (SEQ ID NO. 35) 455 AF017149 ⁇
- SeV 150 MKTERWLRTLIRGEKTKLKDFQKRYEEVHPYLMKEKVEQIIMEEA SLAAHIVQE* (SEQ ID NO. 42)
- HPIV-1 150 MKTERWLRTLIRGKKTKLRDFQKRYEEVHPYLMMERVEQIIMEEA KLAAHIVQE* (SEQ ID NO. 43)
- the concept of heterologous transfer of attenuating mutations across phylogenetic boundaries was tested using the important disease virus RSV as a model.
- RSV important disease virus
- the present example demonstrates that an attenuating (att) mutation identified in RSV, a virus in the pneumovirus genus ofthe Paramyxoviridae family, can be transferred to PIV3, a member ofthe distantly-related Respirovirus genus.
- These viruses represent two different subfamilies within the Paramyxoviridae Family, Pneumovirinae and Paramyxovirinae, respectively.
- an attenuating mutation in a first, heterologous virus (RSV cpt_?530), which altered the parental RSV sequence at a defined site of mutation (Phe 52 ⁇ ofthe RSV L protein) to specify the attenuated phenotype mapped to an identically conserved residue at the corresponding position (F456L) in the L protein of a selected target virus, HPIV3 (Table 3).
- the wild-type HPIV3 sequence element thus conserved was therefore tested as a potential target for heterologous transfer ofthe attenuating mutation between RSV and HPIV3.
- all or part ofthe conserved sequence element(s) bearing the mutant alteration is preferably copied or imported into the recombinant virus to yield a novel attenuated derivative.
- the parental or wild-type residue thus identified as a target may be deleted or replaced by an amino acid insertion at the site of mutation comprising one or more residues that may be unrelated to the residue(s) marking the mutation.
- the residue(s) in the parent clone ofthe recombinant virus corresponding in position to the site ofthe mutation is/are replaced by one or more residues that are conservatively related to the substitute residue(s) identified in the mutant sequence.
- the residue(s) in the parent clone ofthe recombinant virus corresponding to the site ofthe mutation is/are replaced by one or more identical residue(s) to those present in the mutant sequence.
- the phenylalanine to leucine mutation at aa position 521 in the L polymerase of cpts530 was characterized to specify ts and attenuation ( ⁇ tt) phenotypes. Sequence alignment of this region in the L proteins of several distantly-related paramyxoviruses (Table 3) revealed that this phenylalanine is broadly conserved. Using reverse genetics, the analogous phenylalanine at position 456 in the L protein of wild type PIV3 was mutagenized to leucine (F456L).
- the resulting virus designated r456__, was ts (40°C shut-off temperature of plaque formation), and its replication in the upper, but not the lower, respiratory tract of hamsters was 10-fold reduced compared to that ofthe recombinant wild type (rwt) PIV3.
- F456L mutation into two rPIV3 candidate vaccine viruses one bearing three cp45 ts missense mutations in the L protein (rcp45_ . ) and the other bearing all 15 cp45 mutations (rcp45) further attenuated the viruses in vivo. More specifically, the F456L mutation was introduced into two recently-developed recombinant PIV3 vaccine candidates. One is rcp45, a recombinant version ofthe biologically-derived PIV3 vaccine candidate cp45, the other is rcp45__, a version in which the only cp45 mutations present are the three amino acid substitutions in the L protein (published International Application No.
- rcp45-456 induced a moderate level of resistance to replication of PIV3 challenge virus.
- rcp45-456 was 5-fold more restricted in the respiratory tract than rcp45, and induced a comparable, moderate-to-high level of PI V3 -specific serum antibodies.
- rcp45 and rcp45- 456 viruses isolated from chimpanzees throughout a two week course of replication maintained the level of temperature sensitivity of their respective input viruses, illustrating their phenotypic stability.
- rPIV3 JS wt (referred to as rwt herein), rcp45 ⁇ _, and rcp45 viruses that are used as controls in this example were generated previously (published International Application No. 98/53078; Durbin et al., Virology 235:323-332 (1997); Skiadopoulos et al.. J. Virol. 72(3): 1762-8 (1998); Skiadopoulos et al.. J. Virol. 73(2 ⁇ :1374-1381 (1999), each inco ⁇ orated herein by reference).
- the rPIV3s were grown in simian LLC-MK2 cells (ATCC CCL 7.1) as described previously (Durbin et al., Virology 235:323-332. 1997; Hall et al. Virus Res. 22(3 ⁇ 1:173-184. 1992; Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998), inco ⁇ orated herein by reference).
- the modified vaccinia virus Ankara (MVA-T7) (Wyatt et al., Virology 210(1 ):202-205 (1995)), which expresses the T7 polymerase, was kindly provided by Linda Wyatt and Bernard Moss.
- HEp-2 ATCC CCL 23
- LLC-MK2 cells were maintained in OptiMEM I (Life Technologies,
- Gaithersburg, MD supplemented with 2% FBS and gentamicin sulfate (50ug/mL) or in EMEM supplemented with 10% FBS, gentamicin sulfate (50ug/ml), and 4mM glutamine.
- PIV3 JS wt previously used to recover infectious virus (Durbin et al., Virology 235:323- 332, 1997; Skiadopoulos et al., J. Virol. 72(31: 1762-8, 1998; Skiadopoulos et al., J. Virol. 73(2):1374-1381, 1999), encompassing PIV3 nt 7437 to 11312 (Xho I - Sph I), was cloned into a pUC19 vector modified to accept this fragment using standard molecular cloning techniques.
- the cDNA was modified by the introduction of two point mutations using the Transformer Mutagenesis kit (Clontech, CA) as described previously (Skiadopoulos et al., J. Virol. 72(3): 1762-8, 1998; Skiadopoulos et al, J. Virol. 73(2):1374-1381, 1999). These two changes were at positions 10011 (T to C) and 10013 (C to G) numbered according to the complete positive sense sequence of rPIV3 antigenomic RNA. This introduced the F456L codon change as well as an overlapping, silent Xmnl site as a marker ( Figure 1).
- restriction endonuclease fragments were sequenced completely and were cloned directly into the full-length clone, p3/7(131)2G+, or into derivatives bearing cp45 mutations, using standard molecular cloning techniques.
- Full-length antigenomic cDNA derivatives bearing the F456L mutation and the three support plasmids pTM(N), pTM(P no C) and pTM(L) were transfected into HEp-2 monolayers in 6-well plates (Costar, MA) using LipofectACE (Life Technologies, MD), and the monolayers were infected with MVA-T7 as described previously (Durbin et al., Virology 235:323-332 (1997); Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998).
- Plasmid pTM(P no C) is a version ofthe previously-described pTM(P) (Durbin et al., Virology 235:323-332 (1997)) plasmid in which the C ORF has been modified such that its translational initiation codon was changed from AUG to ACG (methionine to threonine). After incubation at 32°C for 4 days, the transfection harvest was passaged onto LLC-MK2 cells in T-25 flasks which were incubated at 32°C for four to eight days.
- the clarified medium supernatant was subjected to three rounds of plaque purification on LLC-MK2 cells as described previously (Durbin et al, Virology 235:323-332 (1997); Hall et al., Virus Res. 22(3):173- 184 (1992); Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998)).
- Each biologically-cloned recombinant virus was amplified twice in LLC-MK2 cells at 32°C to produce virus for further characterization.
- Virus was concentrated from clarified medium by polyethylene glycol precipitation (Mbiguino and Menezes, J. Virol.
- RNA was extracted with TRIzol Reagent (Life Technologies). Reverse transcription was performed on vRN A using the Superscript II Preamplification System (Life Technologies) with random hexamer primers.
- the Advantage cDNA PCR kit (Clontech, CA) and sense and antisense primers specific for various portions ofthe PIV3 genome were used to amplify fragments for restriction endonuclease digestion and/or sequence analysis.
- the PCR fragments were analyzed by sequencing and/or restriction enzyme analysis with each ofthe restriction enzymes whose recognition sites had been created or ablated during construction ofthe mutations.
- the level of temperature sensitivity of plaque formation in vitro of control and recombinant viruses was determined at 32°C and at a range of temperatures from 35°C to 41°C in LLC-MK2 cell monolayer cultures incubated for six days as previously described (Hall et al., Virus Res. 22(3):173-184, 1992).
- Plaques were enumerated by hemadso ⁇ tion with guinea pig erythrocytes following removal of the methylcellulose overlay, or alternatively the viral plaques present in the monolayer were identified by immunoperoxidase staining with a mixture of two PIV3 -specific anti-HN murine mAbs 101/1 and 454/11 diluted 1:250 (Mu ⁇ hy et al., Vaccine 8(5):497-502 (1990); Mu ⁇ hy et al. (1990); van Wyke Coelingh, Winter, and Mu ⁇ hy Virology 143 (2): 569-582, (1985), each inco ⁇ orated herein by reference).
- hamsters Three groups of five hamsters were inoculated intranasally with 0.1 ml of: (i) L15 medium (placebo), (ii) 10 6 0 TCID 50 of rcp45, or (iii) 10 6 0 TCID 50 of rcp45-456.
- the hamsters were bled before infection and 42 days after infection, and serum hemagglutination-inhibiting (HAI) antibody titers against PIV3 were determined as described previously (van Wyke Coelingh, Winter, and Mrnphy, 1985).
- HAI serum hemagglutination-inhibiting
- the hamsters were challenged by intranasal administration of 10 6 ° TCID 5 o rwt. Nasal turbinates and lungs were harvested four days later, and the titer of rwt in the tissue homogenates was determined as described above.
- nasopharyngeal swab and tracheal lavage samples were collected for quantification of virus shedding as described previously (Hall et al., 1993; Karron et al., 1997).
- Nasopharyngeal swab samples were collected on days 1 through 10 and on day 13, and tracheal lavage samples were collected on days 2, 4, 6, 8 and 10.
- the rcp45 and rcp45-456 viruses were evaluated in two separate experiments which followed the same protocol.
- experiment 1 two chimpanzees were inoculated with r 45 and four with rcp45-456, and in experiment 2 each virus was given to 2 animals. The second experiment was performed to confirm the growth difference between the two viruses observed in the first experiment. The two sets of data were indistinguishable with regard to virus growth and immunogenicity and were averaged together. Data from four animals that received 10 4 TCID 5 o ofthe wt JS strain of PIV3 by the IN and IT route were described previously (Hall et al., 1993) and are presented here for the pu ⁇ oses of comparison.
- the quantity of virus in nasopharyngeal swab and tracheal lavage samples was determined on LLC-MK2 monolayers at 32°C and expressed as log.o TCID 5 o/ml, as described previously (Crowe et al., 1994a; Hall et al., 1993). Virus present in chimpanzee nasopharyngeal and tracheal lavage samples was grown on LLC-MK2 monolayers in 24 well plates at 32°C until extensive cytopathic effect was detected. The level of temperature sensitivity of these rPIV3 isolates was estimated by determining the efficiency of plaque formation on LLC-MK2 monolayers as described above.
- RSV cpt.s530 is ts and attenuated for replication in the respiratory tract of mice (Crowe et al., 1994b).
- a single amino acid substitution at phenylalanine-521 in the L protein of RSV cpts530 is responsible for the temperature sensitivity (39°C shut-off temperature of plaque formation) and attenuation (10-fold reduction in replication in the upper respiratory tract of mice) (Crowe et al., 1994b; Juhasz et al., 1997).
- the phenylalanine at position 456 in rwt was mutagenized identically to leucine (F456L).
- the coding change was designed to involve two nucleotide substitutions in order to reduce the probability of reversion to wt.
- the mutation was marked by introduction of a silent Xmn I restriction endonuclease recognition site ( Figure 1, panel C).
- the mutations were introduced into the full-length infectious rwt cDNA plasmid, and recombinant virus was recovered as described previously (Durbin et al., Virology 235:323-332 (1997), Skiadopoulos et al, J. Virol. 72(3):1762-8 (1998) and Skiadopoulos et al.. J. Virol. 73(2V1374-1381 (1999)).
- the recovered r456__ mutant ( Figure 1, panel B) was confirmed to possess the Xmn I marker and the F456L mutation based on RT-PCR of purified vRNA and analysis by restriction enzyme digestion and sequencing.
- Table 5 Temperature sensitivity of control viruses and viruses bearing the F456L mutation in LLC-MK2 cells at permissive and non-permissive temperatures.
- Plaques were enumerated by immunoperoxidase staining after incubation for 6 days at the indicated temperature. The average of three or more experiments is presented. Values which are underlined and in bold type represent the lowest restrictive temperature at which there was a 100-fold reduction of plaquing efficiency, which is defined as the shut-off temperature of plaque formation. The reduction in titer was determined by subtracting the titer at the indicated temperature from that at permissive temperature (32°C).
- p45 possesses three specific amino acid substitutions in the L protein, which were shown previously to be major determinants of its ts and att phenotypes (Skiadopoulos et al, J. Virol. 72(3):1762-8 (1998). cp45 also contains 12 other mutations outside L which include ts and att mutations (Skiadopoulos et al., J. Virol. 73(2): 1374- 1381 (1999). The F456L mutation was introduced into rcp45 and also into a virus bearing only the three rcp45 L gene mutations (rcp45 ⁇ _).
- rcp45 ⁇ _-456 manifested a greatly enhanced level of temperature sensitivity (Table 5) with a shut-off temperature of 35°C compared with 39°C for rcp45_.
- the rcp45-456 mutant had an intermediate shut-off temperature of 37°C, compared with 38°C for rcp45.
- rcp45-456 containing a greater number of mutations was unexpectedly less ts than rcp45 _-456.
- Evidence of complex interactions amongst cp45 ts mutations has been previously observed for other rPIV3 viruses containing various combinations of cp45 mutations, although the basis for these effects is not understood (Skiadopoulos et al, J. Virol. 72(3): 1762-8 (1998) and Skiadopoulos et al. J. Virol. 73(21:1374-1381 (1999).
- Hamsters were inoculated IN with 10 60 TCID 5 o of rwt or with one of several mutant rPIV3's, including virus bearing the F456L mutation alone or in combination with cp45 specific mutations (Table 6). After 4 days, lungs and nasal turbinates were harvested and the level of replication of each virus was determined. The F456L mutation alone had a moderate effect on replication of ⁇ 456 L , resulting in approximately a 10-fold reduction in the nasal turbinates and no apparent restriction of replication in the lungs. This level of attenuation is similar to that of the RSV cpts530 mutant in the upper respiratory tract of mice (Crowe et al., Vaccine 12(8). 691-699 (1994a)).
- seronegative hamsters were administered 10 6 0 TCID 50 IN of rcp45-456, rcp45, or LI 5 medium. After 42 days, serum samples were collected, and the animals were challenged on day 44 with rwt. Immunization with rcp45-456 or rcp45 elicited moderate to high titers of serum HAI antibodies, respectively, and induced resistance to replication of rwt challenge virus (Table 7). The level of antibodies and resistance induced by infection with rcp45-456 was less than those induced by rcp45. The lower level ofthe immune response and protection conferred by rcp45-456 likely reflects its significantly lower level of replication in the respiratory tract ofthe hamsters.
- TCID 50 of virus per animal in a 0.1 mL inoculum. After 44 days, the animals were challenged with 10 60 TCID 50 of rwt, and lungs and nasal turbinates were harvested four days later.
- rcp45-456 mutant appeared over-attenuated in hamsters, we sought to determine its level of replication and immunogenicity in chimpanzees, the non- human primate that is the most closely-related to humans.
- Groups of chimpanzees in two separate confirmatory experiments were inoculated IN and IT with 10 6 0 TCID 50 per site of either rcp45-456 or rcp45.
- Tracheal lavage and nasopharyngeal swab samples were collected over a period of 10 and 13 days post infection, respectively, and the virus titer in each specimen was determined.
- rcp45-456 and rcp45 were highly restricted in replication in the upper and lower respiratory tracts in comparison to PIV3 wt (Table 8) indicating that each mutant virus is attenuated for replication in chimpanzees.
- Table 6 the effect of adding the F456L mutation to cp45 was to reduce replication more than 2500-fold in the upper respiratory tract of hamsters.
- the effect when evaluated in chimpanzees the effect was a reduction of only five-fold in both the upper and lower respiratory tracts (Table 8 and Figure 2). This difference was observed in two independent experiments, one in which two animals received rcp45 and four received rcp45-456, and a second in which each virus was administered to two animals.
- Table 8 rcp45-456 is more attenuated for replication in the upper and lower respiratory tract of chimpanzees than rcp45.
- a The indicated amount of virus was administered in the nose and trachea in a 1 ml inoculum at each site.
- b Mean peak virus titer (log 10 TCID 50 /ml). Virus titer was determined by TCID 50 on LLC-MK2 cells at 32°C.
- c Statistically significant difference between indicated values; p ⁇ 0.025 (Student's t-test).
- d Statistically significant difference between indicated values; p ⁇ 0.01 (Student's t-test).
- e Wt JS strain of PIV3 data from Hall et al., 1992).
- the level of temperature sensitivity of isolates obtained from chimpanzees infected with rcp45-456 and r ⁇ p45 was examined to determine whether the two recombinants retained their ts phenotype following replication in a highly permissive host. Isolates from the two studies were evaluated separately because ofthe large number of isolates obtained. Analysis of isolates from two individual animals from experiment 1 is shown in Table 9, and a summary of all the animals is shown in Table 10. The level of temperature-sensitivity of identical control virus suspensions differed in the two experiments by 1°C (Table 10), indicative of experimental variability in the assay.
- the temperature at which plaques were not observed for rcp45-456 versus rcp45 was 38°C and 39°C, respectively, in experiment 1 compared to 39°C and 40°C, respectively, in experiment 2 (Table 10).
- This level of experimental variability is sometimes observed.
- the difference in the shut-off temperature of plaque formation between rcp45-456 and rcp45 was consistent at 1°C. Because ofthe experimental variability between the two studies, they are summarized separately in Table 10.
- Each isolate retained the ts phenotype, and the level of temperature sensitivity ofthe isolates did not differ from that ofthe control input viruses throughout the course of replication in respiratory tract ofthe chimpanzee.
- Virus isolates or control Isolates 0 Virus titer d (logiopfu/ml) at the indicated temperature tissue dav 32°C 36°C 37°C 38°C 39°C 40°C rcp45-456 v ⁇ ruse!i NP 1 7.1 ⁇ 3.7 ⁇ 2.7 ⁇ 0.7 ⁇ 0.7 ⁇ 0.7
- Virus used to infect Percentage of isolates with viral ⁇ )laques detected at indicated temperature animal Total no. of 36°C 37°C 38°C 39°C 40°C
- a Total number includes 18 nasopharyngeal and 2 tracheal lavage isolates.
- b Total number includes 39 nasopharyngeal and 3 tracheal lavage isolates.
- Total number includes 20 nasopharyngeal and 5 tracheal lavage isolates.
- d Total number includes 21 nasopharyngeal and 1 tracheal lavage isolates.
- RSV cpts530 namely substitution ofthe parental phenylalanine at position 521 in the L protein, confers a similar level of temperature sensitivity and attenuation when introduced into the corresponding position (456) in the L protein of PIV3.
- RSV and PIV3 represent separate subfamilies within the paramyxovirus family, namely Pneumovirinae and
- Paramyxovirinae The two viruses share unambiguous, statistically significant sequence relatedness for their L proteins (Stec et al. Virology 183:273-287 (1991)), particularly in a region of approximately 540-570 amino acids which lies near the amino-terminus (aa 422-938 of RSV and 357-896 of PIV3) and which includes four highly-conserved polymerase motifs described by Poch et al. (J. Gen. Virol. 5:1153-62 (1990); and Stec et al. Virology 183:273-287 (1991)).
- the mutation described here at position 521 in RSV and 456 in PIV3, lies within this general region but is approximately 175 residues upstream ofthe first conserved motif identified by Poch et al. Notably, this residue is strictly conserved, as is a leucine residue located 12 residues C-terminal to its position ( Figure 1 , panel A), among thirteen heterologou s paramyxoviruses tested in the present study.
- the present findings provide novel PIV vaccine candidates and also enable transfer of attenuating mutations from RSV to other paramyxoviruses wherein the mutation maps to a conserved parental residue/position.
- the 521 L mutation of RSV is amenable to importation into recently developed chimeric PIV3 recombinants having the hemagglutinin-neuraminidase (HN) and F genes of JS wt PIV3 replaced by those of PIV1 (Tao et al., J. Virol. 72(4), 2955-2961 (1998), inco ⁇ orated herein by reference).
- This chimeric recombinant can be attenuated further by inco ⁇ oration of one or more additional mutations identified in the cp45 mutant, which mutations have now been inco ⁇ orated in their entirety (with the exception ofthe three mutations occurring in the F and HN genes) within an infectious, attenuated, chimeric PIV3-1 clone bearing the PIV1 HN and F genes substituted within a JS wt PIV3 background.
- the present example describes heterologous transfer of a known attenuating mutation in the C protein of Sendai virus (SeV), marked by a substitution of phenylalanine (F) to serine (S) at position 170 (Itoh et al., J. Gen. Virol. 78:3207-3215 (1997), inco ⁇ orated herein by reference), to a corresponding position in a recombinant HPIV3 clone.
- the F170 parental sequence element maps to an identically conserved sequence position/resid ⁇ . ⁇ F164 in the HPIV3 C protein, which element is also conserved in SeV and BPIV-3.
- the F170S mutation of SeV was transferred to a recombinant HPIV3 virus rF164S by introduction of a point mutation into the C ORF of HPIV3, changing amino acid position 164 from phenylalanine (F) to serine (S).
- the resulting rF164S recombinant was su ⁇ risingly, more attenuated in the upper than the lower respiratory tract. This pattern is the converse of that seen with temperature-sensitive attenuating mutations, whereby inclusion of this novel mutation in recombinant, live-attenuated vaccine viruses will prove useful in reducing residual virulence in the upper respiratory tract.
- the rF164S recombinant also conferred protection against challenge with wildtype HPIV3.
- the P and C proteins of HPIV3 are translated from separate, overlapping ORFs in the mRNA (Fig. 3). Whereas all paramyxoviruses encode a P protein, only members ofthe genera Respirovirus and Morbillivirus encode a C protein. Individual viruses vary in the number of proteins expressed from the C ORF and in its importance in replication ofthe virus in vitro and in vivo.
- Sendai virus (SeV) expresses four independently initiated proteins from the C ORF: C, C, Yl, and Y2, whose translational start sites appear in that order in the mRNA (Curran, et al., Enzyme 44:244-9 (1990); Lamb et al., p. 181-214, in D.
- HEp-2 and simian LLC-MK2 monolayer cell cultures were maintained in OptiMEM 1 (Life Technologies, Gaithersburg, MD) supplemented with 2% fetal bovine serum, gentamicin sulfate (50ug/mL), and 4mM glutamine.
- the modified vaccinia strain Ankara (MVA) recombinant virus that expresses bacteriophage T7 RNA polymerase was generously provided by Drs. L. Wyatt and B. Moss (Wyatt et al., Virology 210:202-205 (1995)).
- JS wildtype (wt) strain of PIV3 and its attenuated ts derivative, JS cp45, were propagated in LLC-MK2 cells as described previously (Hall et al, Virus Res. 22:173-184 (1992)).
- the Pmll to BamHI fragment of p3/7(131)2G was subcloned into the plasmid pUC 119 ⁇ pUC 119(PmlI-BamHI) ⁇ which had been modified to include a Pmll site in the multiple cloning region.
- Site-directed mutagenesis was then performed on pUCl 19(PmlI -BamHI) using Kunkel's method (Kunkel et al., Methods Enzymol. 154:367-382, 1987) to introduce mutations in the C ORF.
- Table 11 Nucleotide change introduced into rPIV3 to yield rF164S virus.
- nucleotide sequence ofthe mutated region is shown and compared with wildtype (wt) sequence.
- the first nucleotide in the sequence is numbered according to its position in the complete antigenome RNA. Sequences as blocked is the P open reading frame. Nucleotides underlined are the codon for the C ORF at amino acid position 164 for HP 103. Construction of Antigenomic cDNA Encoding Virus with the F164S Mutation in the C ORF (rF164S)
- a phenylalanine (F) to serine (S) change at amino acid position 164 ofthe C ORF was created using a mutagenic primer which introduced an A to G change at nt position 2284 ofthe full-length antigenome. This mutation was also silent in the P ORF.
- the Pmll to BamHI fragment ofthe full-length clone was sequenced in its entirety to confirm the presence ofthe introduced mutation and to confirm that other mutations had not been introduced incidently. The fragment was then separately cloned back into the full-length clone p3/7(131)2G as previously described (Durbin et al., Virology 235:323- 332 (1997)) to create the antigenomic cDNA clone.
- the full-length antigenomic cDNA bearing the C F164S mutation was transfected into HEp-2 cells on six-well plates (Costar, Cambridge, MA) together with the support plasmids ⁇ pTM(N), pTM (P no C), and pTM (L) ⁇ using LipofectACE (Life Technologies) and infected with MVA-T7 as previously described (Durbin et al., Virology 235:323-332, 1997).
- pTM(P no C) is identical to the pTM(P) plasmid described previously (Durbin et al., Virology 234:74-83 (1997)) with the exception that the C transcriptional start site had been mutated from ATG to ACG, changing the first amino acid in the C ORF from methionine to threonine.
- the transfection harvest was passaged onto a fresh LLC-MK2 cell monolayer in a T25 flask and incubated for 5 days at 32°C (referred to as passage 1).
- the amount of virus present in the F164S harvest was determined by plaque titration on LLC-MK2 monolayer cultures with plaques visualized by immunoperoxidase staining with PIV3 HN-specific monoclonal antibodies as described previously (Durbin et al., Virology 235:323-332 (1997)).
- the F164S recombinant virus present in the supernatant of passage 1 harvest was then plaque purified three times on LLC-MK2 cells as previously described (Hall et al., Virus Res. 22:173-184 (1992)).
- the biologically cloned recombinant virus from the third round of plaque purification was then amplified twice in LLC-MK2 cells at 32°C to produce virus for further characterization. Sequence Analysis of Recovered Recombinant Viruses
- Virus was concentrated from clarified medium from infected cell monolayers by polyethylene glycol precipitation as described previously (Durbin et al., Virology 235 :323-332 (1997)).
- the RNA was purified with TRIzol reagent (Life Technologies) following the manufacturer's recommended procedure.
- RT-PCR was performed with the Advantage RT-for-PCR kit (Clontech, Palo Alto, CA) following the recommended protocol. Control reactions were identical except that reverse transcriptase was omitted from the reaction to confirm that the PCR products were derived solely from viral RNA and not from possible contaminating cDNA plasmids.
- Primers were used to generate the PCR fragment spanning nucleotides 1595-3104 ofthe full-length antigenome. This fragment includes the entire C, D and V ORFs ofthe recombinant viruses.
- the resultant PCR products were then sequenced using cycle dideoxynucleotide sequence analysis (New England Biolabs, Beverly, MA).
- MAP multiple antigen peptide
- Repsearch Genetics HuntsviUe, AL
- the two peptides spanned amino acid regions 30-44 and 60-74 ofthe C protein.
- Eight copies of each C peptide were placed on a branched carrier core and injected separately into rabbits (two rabbits per peptide) with Freund's adjuvant.
- the rabbits were boosted with the designated MAP at 2 and 4 weeks and bled at 4, 8, and 10 weeks.
- Each antiserum recognized the C peptide used as an immunogen in high titer and precipitated C protein from HPIV3 infected cells in a radioimmunoprecipitation assay (RIPA).
- RIPA radioimmunoprecipitation assay
- T25 cell monolayers of LLC-MK2 cells were infected at a multiplicity of infection (MOI) of 5 with either rF164S, recombinant JS wt virus (rJS) or were mock infected and incubated at 32°C.
- MOI multiplicity of infection
- the monolayer was washed with methionine-minus DMEM (Life Technologies) and incubated in the presence of 10 uCi/w/ of 35 S methionine in methionine-minus DMEM for an additional 6 hours.
- the cells were then harvested, washed 3 times, and resuspended in 1 ml RIPA buffer ⁇ 1% (w/v) sodium deoxycholate, 1% (v/v) Triton X-100, 0.2% (w/v) SDS, 150mM NaCl, 50mM Tris-HCl, pH 7.4 ⁇ , freeze-thawed and pelleted at 6500XG.
- the cell extract was transferred to a fresh eppendorf tube and a mixture of both C antisera (5ul each) was added to each sample and incubated with constant mixing for 2 hours at 4°C.
- Monolayers of LLC-MK2 cells in T25 flasks were infected in duplicate with rF 164S or rJS at an MOI of 0.1 and incubated at 32°C in 5% CO 2 . 250ul samples were removed from each flask at 24 hour intervals for 5 consecutive days and were flash frozen. An equivalent volume of fresh media was replaced at each time point. Each sample was titered on LLC-MK2 cell monolayers in 96-well plates incubated for 7 days at 32°C. Virus was detected by hemadso ⁇ tion and reported as log.o TCIDso/ml.
- Virus present in the samples was titered on 96 well plates of LLC-MK2 cell monolayers incubated at 32°C for 7 days. Virus was detected by hemadso ⁇ tion and the mean log . o TCID 5 o/g was calculated for each day for each group of five hamsters. Sera were collected from the remaining 6 hamsters in each group on days 0 and 28 post-inoculation. Serum antibody responses to each virus was evaluated by hemagglutination-inhibition (HAI) assay as previously described (van Wyke Coelingh et al., Virology 143:569-582 (1985)).
- HAI hemagglutination-inhibition
- African Green monkeys in groups of 4 animals each were inoculated intranasally and intratracheally with 10 6 PFU of either rF164S, JSwt, or cp45 as previously described for earlier studies in rhesus monkeys (Durbin et al., Vaccine 16:1324-30 (1998)).
- Nasopharyngeal swab samples were collected daily for 12 consecutive days post-inoculation and tracheal lavage samples were collected on days 2, 4, 6, 8, and 10 post-inoculation. The specimens were flash frozen and stored at -70°C until all specimens had been collected.
- Virus present in the samples was titered on LLC- MK2 cell monolayers in 96 well plates that were incubated at 32°C for 7 days. Virus was detected by hemadso ⁇ tion and the mean log . o TCID 5 o/ml was calculated for each day. Serum was collected from each monkey on days 0 and 28, and the PIV3 HAI antibody response to experimental infection with the various mutants and the PIV3 wild type (JS) was determined. On day 28 post-inoculation, the AGMs were challenged with 10 6 PFU ofthe biologically-derived PIV3 wild type virus administered in a 1ml inoculum intranasally and intratracheally. Nasopharyngeal swab samples were collected on days 0,
- HPIV3 antigenomic cDNA was prepared to encode the mutant virus rF164S, in which the C protein aa residue 164 was changed from F to S.
- the mutation was translationally silent in the overlapping P ORF (Table 11).
- the antigenomic cDNA was transfected into HEp-2 cells along with the three PIV3 support plasmids ⁇ pTM(P no C), pTM(N), pTM(L) ⁇ and the cells were simultaneously infected with MVA expressing the T7 RNA polymerase.
- the efficiency of recovery of rPIV3 containing the mutation in the C ORF was compared with that of a similarly transfected-infected HEp-2 cell culture using the p3/7(131)2G, the plasmid expressing full-length PIN3 antigenome from which recombinant JSwt PIV3 (rJS) was previously recovered (Durbin et al., Virology 235:323-332 (1997)).
- the transfected cells were harvested, and supernatant was passaged onto a fresh monolayer of LLC-MK2 cells in a T25 flask and incubated for 5 days at 32°C (passage 1). After 5 days at 32°C, the LLC-MK2 cell monolayer of rJS and rF164S exhibited 3-4+ cytopathic effect (CPE). After three rounds of biological cloning by plaque isolation, the recombinant mutant was amplified twice in LLC-MK2 cells to produce a suspension of virus for further characterization.
- CPE cytopathic effect
- the cloned virus was analyzed by RT-PCR using a primer pair which amplified a fragment of D ⁇ A spanning nt 1595-3104 ofthe HPIV3 antigenome, which includes the portion ofthe P gene containing the C, D, and V ORFs.
- the generation of PCR product was dependent upon the inclusion of RT, indicating derivation from R ⁇ A and not from contaminating cD ⁇ A.
- Nucleotide sequencing was conducted on the RT-PCR product to confirm the presence ofthe introduced mutation. The introduced mutation was confirmed to be present in the RT-PCR fragment spanning nt 1595-3104 amplified from the cloned recombinant, and other incidental mutations were not found.
- Radioimmunoprecipitation assay was performed to compare the rF164S mutant virus with the rJS wt virus.
- Cells were infected, incubated in the presence of 35 S methionine from 24 to 30 h post-infection, and cell lysates were prepared. Equivalent amounts ofthe total protein were incubated with anti-C and anti-HN antibodies and the antibody was then bound to protein A sepharose beads.
- rJS and rF164S each encoded both HN and C proteins (Fig. 4).
- the C protein expressed by rF164S appeared to be of identical size as that expressed by the parent rJS and was expressed in similar quantity as well (Fig. 4).
- Duplicate cultures of LLC-MK2 cell monolayers were infected with rF164S or rJS at an MOI of 0.1 and incubated for 5 days at 32°C. Medium from each culture was sampled at 24 hour intervals and this material was subsequently titered to evaluate the replication of each virus in cell culture. Replication of rF164S was essentially indistinguishable from that ofthe parent rJS wt with regard to both the rate of virus production and the final titer (Fig. 5) as well as the ability to replicate at elevated temperature.
- the rF164S mutant virus was next compared with the rJS wt parent for the ability to replicate in the upper and lower respiratory tract of hamsters.
- Groups of hamsters were inoculated intranasally with 10 5 pfu per animal of rF164S or cp45, the biologically-derived vaccine candidate.
- replication of rF164S was reduced one hundred to five hundred-fold in upper respiratory tract and was reduced more than ten-fold in the lower respiratory tract ofthe hamsters (Table 12).
- the hamsters which were infected with rF164S and rJS had a significant antibody response to HPIV3 and exhibited a high level of restriction of replication of PIV3 challenge virus (Table 13).
- Table 12 The rF164s virus is attenuated in the upper and lower respiratory tracts of hamsters.
- Virus Nasal turb Lungs Nasal turb. Lungs Nasal turb. Lungs Nasal turb.
- cpAS is a biologically-derived virus
- Table 13 The rF164S virus is immunogenic and protective against challenge with PIV3 wt virus in hamsters.
- Virus 1 (reciprocal mean log 2 ⁇ S.E.) Nasal turb. Lungs rF 164S 10.8 ⁇ 0.2 ⁇ 1.5 ⁇ 0.0 ⁇ 1.2 ⁇ 0.0 cp45 11.8 ⁇ 0.3 ⁇ 1.5 ⁇ 0.0 ⁇ 1.2 ⁇ 0.0 rJS 12.1 ⁇ 0.2 ⁇ 1.5 ⁇ 0.0 ⁇ 1.2 ⁇ 0.0
- this recombinant mutant was administered to a group of four AGMs, and its replication in the upper and lower respiratory tracts was compared with that of cp45 and JS wt. Replication of rF 164S was 100-fold or more reduced in the upper respiratory tract ofthe AGMs. The attenuation observed for this virus in the upper respiratory tract was comparable to that of cp45 (Table 14). rF164S was moderately ( ⁇ 10-fold) restricted in the lower respiratory tract ofthe AGMs. The recombinant virus induced an HAI antibody response to HPIV3 (Table 14).
- the immunized AGMs were challenged on day 28 with 106 PFU biologically-derived JS wt virus given IN and IT.
- the animals which had received rF164S or the cp45 vaccine candidate virus were completely protected against replication of challenge virus in both the upper and lower respiratory tracts ofthe AGMs.
- Virus 1 Nasopharyn Tracheal Number (reciprocal mean NasopharynTracheal geal swab lavage of animals log 2 ⁇ S.E.) 3 geal swab lavage rF164S 4.3 ⁇ 0.3 (C) 5 5.8 ⁇ 0.2 (B) 5 4 12.5 ⁇ 0.3 ⁇ 0.5 ⁇ 0.0 ⁇ 0.5 ⁇ 0.0 cp45 5.1 ⁇ 0.4 (B) 5.3 ⁇ 0.1 (C) 4 12.0 ⁇ 0.6 ⁇ 0.5 ⁇ 0.0 ⁇ 0.5 ⁇ 0.0
- AGMs were inoculated intranasally and intratracheally with 10 6 PFU of indicated virus on day 0.
- the F170S mutation in SeV was generated biologically by adapting the virus to growth in LLC-MK2 simian cells (Garcin et al. Virology 238:424-431 (1997), and Itoh et al.. J. Gen. Virol. 78:3207-15 (1997)).
- recombinant SeV with the F170S mutation demonstrates enhanced replication in vitro, this mutant is highly restricted in replication in mice, being as impaired in replication as the SeV C7C mutant (Garcin et al., Virology 238:424-431 (1997) and Latorre et al., J Virol. 72:5984-93 (1998)). Since the C proteins of SeV and HPIV3 are only 38% homologous, it was su ⁇ rising to find that importation ofthe F170S mutation of SeV into HPIV3 caused attenuation in vivo.
- HPIV3 recombinant rF164S which bears the mutation at the amino acid residue of HPIV3 corresponding to position 170 of SeV, was not restricted in replication in vitro but was significantly attenuated in both the upper and lower respiratory tracts of hamsters and in the upper and lower respiratory tracts of AGMs. rF164S induced a serum antibody response comparable to that of wt PIV3 infection and completely protected both hamsters and AGMs against challenge with wt HPIV3. These results indicate that the F164S mutation will be useful in developing a live attenuated vaccine against HPIV3.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Virology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Immunology (AREA)
- Oncology (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Attenuated, recombinant negative stranded RNA viruses suitable for vaccine use are produced from one or more isolated polynucleotide molecules encoding the virus. A recombinant genome or antigenome of the subject virus is modified to encode a mutation within a recombinant protein of the virus at one or more amino acid positions(s) corresponding to a site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus. A similar attenuating mutation as identified in the heterologous negative stranded RNA virus is thus incorporated at a corresponding site within the recombinant virus to confer an attenuated phenotype on the recombinant virus. The attenuating mutation incorporated in the recombinant virus may be identical or conservative in relation to the attenuating mutation identified in the heterologous, mutant virus. By the transfer of mutations into recombinant negative stranded RNA viruses in this manner, candidate vaccine viruses are engineered to elicit a desired immune response against a subject virus in a host susceptible to infection thereby.
Description
PRODUCTION OF ATTENUATED NEGATIVE STRANDED RNA VIRUS VACCINES FROM CLONED NUCLEOTIDE SEQUENCES
BACKGROUND OF THE INVENTION
Negative stranded RNA viruses comprise a diverse order (Mononegavirales) of important and highly destructive pathogens. Human pathogens within this group include rabies virus (RaV), measles virus (MeV), mumps virus (MuN), respiratory syncytial virus (RSN) and parainfluenza viruses (PIN) of several genotypes. In the case of RSN, this pathogen outranks all other microbial pathogens as a cause of pneumonia and bronchiolitis in infants under one year of age. RSV is responsible for more than one in five pediatric hospital admissions due to respiratory tract disease and causes an estimated 91,000 hospitalizations and 4,500 deaths yearly in the United States alone. Human PIN viruses (e.g., HPIVl , HPIV2 and HPIV3) also exact a heavy toll among human populations, causing bronchiolitis, croup and pneumonia primarily in infants and children. Karron et al., J. Infect. Pis. 172: 1445-50 (1995); Collins et al. "Parainfluenza Viruses", p. 1205-1243. In B. Ν. Fields et al., eds., Fields Virology, 3rd ed, vol. 1. Lippincott-Raven Publ., Philadelphia (1996); Murphy et al., Virus Res. 11 :1-15 (1988). Infections by human PIV viruses are responsible for approximately 20% of hospitalizations among young infants and children for respiratory tract infections.
Despite decades of investigation to develop effective vaccine agents against RSV and PIV, no safe and effective vaccines have yet been approved to prevent the severe morbidity and significant mortality associated with these viruses. Other important members ofthe Mononegavirales similarly await effective vaccine development or would benefit from improved vaccines. One obstacle to development of live vaccines against negative stranded R A viruses is the difficulty in achieving an appropriate balance between attenuation and immunogenicity. Genetic stability of attenuated viruses also can be a problem. Vaccine development in the case of RSV is also impeded by the relatively poor growth of RSV in cell culture and the instability of the virus particle. Another feature of RSV infection is that the immunity which is induced is not fully protective against subsequent infection. A number of factors
probably contribute to this, including the relative inefficiency ofthe immune system in restricting virus infection on the luminal surface ofthe respiratory tract, the short-lived nature of local mucosal immunity, rapid and extensive virus replication, reduced immune responses in the young due to immunological immaturity, immunosuppression by transplacentally derived maternal serum antibodies, and certain features of the virus such as a high degree of glycosylation ofthe G protein. Also, as will be described below, RSV exists as two antigenic subgroups A and B, and immunity against one subgroup is of reduced effectiveness against the other.
Formalin-inactivated RSV has been tested as a vaccine against RSV in the mid- 1960s, but failed to protect against RSV infection or disease, and in fact exacerbated symptoms during subsequent infection by the virus. (Kim et al., Am. J. Epidemiol., 89:422-434 (1969), Chin et al., Am. J. Epidemiol, 89:449-463 (1969); Kapikian et al., Am. J. Epidemiol., 89:405-421 (1969)). More recently, vaccine development for RSV has focused on attenuated RSV mutants. Friedewald et al., J. Amer. Med. Assoc. 204:690-694 (1968) reported a cold passaged mutant of RSV (cpRSV) which appeared to be sufficiently attenuated to be a candidate vaccine. This mutant exhibited a slight increased efficiency of growth at 26°C compared to its wild-type (wt) parental virus, but its replication was neither temperature sensitive nor significantly cold-adapted. The cold- passaged mutant, however, was attenuated for adults. Although satisfactorily attenuated and immunogenic for infants and children who had been previously infected with RSV (i.e., seropositive individuals), the cpRSV mutant retained a low level virulence for the upper respiratory tract of seronegative infants.
Similarly, Gharpure et al., J. Virol. 3:414-421 (1969) reported the isolation of temperature sensitive RSV (tsRSV) mutant which are also promising vaccine candidates. One mutant, t.y-1 , was evaluated extensively in the laboratory and in volunteers. The mutant produced asymptomatic infection in adult volunteers and conferred resistance to challenge with wild-type virus 45 days after immunization. Again, while seropositive infants and children underwent asymptomatic infection, seronegative infants developed signs of rhinitis and other mild symptoms. Furthermore, instability ofthe ts phenotype was detected, although virus exhibiting a partial or complete loss of temperature sensitivity represented a small proportion of virus recoverable from vaccinees, and was not associated with signs of disease other than mild rhinitis.
These and other studies revealed that certain cold-passaged and temperature sensitive RSN strains were underattenuated and caused mild symptoms of disease in some vaccinees, particularly seronegative infants, while others were overattenuated and failed to replicate sufficiently to elicit a protective immune response, (Wright et al., Infect. Immun.. 37:397-400 (1982)). Moreover, genetic instability of candidate vaccine mutants has resulted in loss of their temperature-sensitive phenotype, further hindering development of effective RSV vaccines. See generally, Hodes et al., Proc. Soc. Exp. Biol. Med. 145:1158-1164 (1974), Mclntosh et al., Pediatr. Res. 8:689- 696 (1974), and Belshe et al., J. Med. Virol.. 3:101-110 (1978). Abandoning the approach of creating suitably attenuated RSV strains through poorly controlled biological methods such as cold-passaging, investigators tested subunit vaccine candidates using purified RSV envelope glycoproteins. The glycoproteins induced resistance to RSV infection in the lungs of cotton rats, Walsh et al., J. Infect. Pis. 155:1198—1204 (1987), but the antibodies had very weak neutralizing activity and immunization of rodents with purified subunit vaccine led to disease potentiation reminiscent of the formerly treated RSV vaccine (Murphy et al., Vaccine 8:497-502 (1990)).
Vaccinia virus recombinant-based vaccines which express the F or G envelope glycoprotein have also been explored. These recombinants express RSV glycoproteins which are indistinguishable from the authentic viral counterpart, and rodents infected intradermally with vaccinia-RSV F and G recombinants developed high levels of specific antibodies that neutralized viral infectivity. Indeed, infection of cotton rats with vaccinia-F recombinants stimulated almost complete resistance to replication of RSV in the lower respiratory tract and significant resistance in the upper tract (Olmsted et al., Proc. Νatl. Acad. Sci. USA 83:7462-7466 (1986)). However, immunization of chimpanzees with vaccinia-F and -G recombinant provided almost no protection against RSV challenge in the upper respiratory tract (Collins et al., Vaccine 8:164-168 (1990)) and inconsistent protection in the lower respiratory tract (Crowe et al., Vaccine 11 :1395- 1404 (1993)). The unfulfilled promises of biologically attenuated viral strains, subunit vaccines, and other strategies for vaccine development to treat RSV and other negative stranded RΝA viruses underscores a need for new methods to develop novel vaccines, particularly methods for manipulating recombinant vaccine candidates to incorporate genetic changes to yield new phenotypic properties in viable, attenuated recombinants.
However, manipulation ofthe genomic RNA of RSV and other negative-sense RNA viruses has heretofore proven difficult. Major obstacles in this regard include non- infectivity of naked genomic RNA of these viruses, poor viral growth in tissue culture, lengthy replication cycles, virion instability, a complex genome, and a refractory organization of gene products.
In the case of PIV3, two live attenuated vaccine candidates have received particular attention. One of these candidates is a bovine PIV3 (BPIV3) strain that is antigenically related to HPIV3, and which has been shown to protect animals against HPIV3. BPIV3 is attenuated, genetically stable and immunogenic in human infants and children (Karron et al., J. Inf. Pis. 171:1107-14 (1995a); Karron et al, J. Inf. Pis.
172:1445-1450, (1995b)). A second PIV3 vaccine candidate, JS cpAS is a cold-adapted mutant ofthe JS wildtype (wt) strain of HPIV3 (Karron et al., (1995b), supra; Belshe et al, J. Med. Virol. 10:235-42 (T982V). This live-attenuated, cold-passaged (cp) PIV3 vaccine candidate exhibits temperature-sensitive (ts), cold-adaptation (ca), and attenuation (att) phenotypes which are stable after viral replication in vivo. The cp45 virus is protective against human PIV3 challenge in experimental animals and is attenuated, genetically stable, and immunogenic in seronegative human infants and children (Hall et al, Virus Res. 22:173-184 (1992); Karron et al., J. Infect. Pis. 172(6): 1445- 1450 (1995b), supra). Recombinant PNA technology has made it possible to recover infectious negative-stranded RNA viruses from cPNA, to genetically manipulate viral clones to construct novel vaccine candidates, and to rapidly evaluate their level of attenuation and phenotypic stability (for reviews, see Conzelmann, J. Gen. Virol. 77:381-89 (1996); Palese et al., Proc. Natl. Acad. Sci. U.S.A. 93:11354-58, (1996)). In this context, recombinant rescue has been reported for infectious respiratory syncytial virus (RSV), human parainfluenza virus 3 (HPIV3), rabies virus (RaV), vesicular stomatitis virus (VSV), measles virus (MeV), Sendai virus (SeV) rinderpest virus, simian virus type S, and bovine RSV from cPN A-encoded antigenomic RNA in the presence of essential viral proteins (see, e.g., Garcin et al., EMBO J. 14:6087-6094 (1995); Lawson et al., Proc. Natl. Acad. Sci. U.S.A. 92:4477-81 (1995); Radecke et al., EMBO J. 14:5773-5784
(1995); Schnell et al., EMBO J. 13:4195-203 (1994); Whelan et al., Proc. Natl. Acad. Sci. U.S.A. 92:8388-92 (1995); Hoffman et al., J Virol. 71:4272-4277 (1997); Kato et al., Genes to Cells 1 :569-579 (1996), Roberts et al.. Virology 247(1), 1-6 (1998); Baron et al., J Virol. 71:1265-1271 (1997); International Publication No. WO 97/06270; Collins et al,
Proc. Natl. Acad. Sci. USA 92:11563-11567 (1995): Purbin et al.. Virology 235:323-332 (1997); U.S. Patent Application No. 08/892,403, filed July 15, 1997 (corresponding to published International Application No. WO 98/02530 and priority U.S. Provisional Application No.s 60/047,634, filed May 23, 1997, 60/046,141, filed May 9, 1997, and 60/021,773, filed July 15, 1996); Juhasz et al.. J. Virol. 71(8^:5814-5819 (1997V. He et al. Virology 237:249-260 (1997); Whitehead et al., Virology 247(2):232-9 (1998a); Whitehead et al., J. Virol. 72(5):4467-4471 (1998b); Jin et al. Virology 251 :206-214 (1998); Bucholz et al. J. Virol. 73:251-259 (1999); and Whitehead et al, J. Virol. 73:3438-3442 (1999), each incorporated herein by reference). Oespite the availability of reverse genetics methods to recover and modify recombinant, negative stranded RNA viruses, an urgent need remains in the art for additional tools and methods to engineer safe and effective vaccines to alleviate the serious health problems attributable to RSV, PIV and other pathogens within the Mononegavirales. Among the remaining challenges in this context is the difficulty of achieving suitably attenuated, immunogenic and genetically stable vaccine candidates. To achieve this goal, existing methods for identifying and incorporating attenuating mutations into recombinant viral strains must be expanded. Surprisingly, the present invention fulfills this goal and provides additional advantages as described hereinbelow.
SUMMARY OF THE INVENTION
The present invention provides novel methods and compositions for designing and producing attenuated, recombinant negative stranded RNA viruses suitable for vaccine use. According to the methods ofthe invention, recombinant negative stranded RNA viruses are produced from one or more isolated polynucleotide molecules encoding the virus. This is achieved by coexpressing in a cell or cell-free system one or more polynucleotide molecules encoding a recombinant genome or antigenome ofthe virus along with essential viral proteins necessary to produce an infectious virus or viral particle. The recombinant genome or antigenome ofthe subject virus is modified to encode a mutation within a recombinant protein ofthe virus at one or more amino acid position(s) corresponding to a site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus. The mutation which is thus "transferred" in this adoptive or iterative fashion surprisingly confers an attenuated phenotype on the recombinant
virus. In this manner, candidate vaccine viruses are recombinantly engineered to elicit an immune response against selected negative stranded RNA viruses in a host susceptible to infection by the subject virus.
In related aspects ofthe invention, isolated polynucleotide molecules and vectors are provided that encode an attenuated, recombinant negative stranded viral genome or antigenome. Consistent with the above aspects, the subject genome or antigenome encodes a mutation within a selected, recombinant protein ofthe virus at an amino acid position(s) corresponding to the site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus. Also provided within the invention are methods and compositions incorporating attenuated, recombinant negative stranded RNA virus mutated as above for prophylaxis and treatment of infection by the subject virus.
In preferred embodiments ofthe invention, the recombinant negative stranded RNA virus is either a respiratory syncytial virus (RSV), parainfluenza virus (PIV) or measles virus. In conjunction with each of these embodiments, the heterologous, mutant negative stranded RNA virus may be a heterologous RSV, human parainfluenza virus (HPIVl, HPIV2, HPIV3), bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NOV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CPV), rabies virus (RaV), or vesicular stomatitis virus (VSV). Various target proteins are amenable to introduction of attenuating mutations from one negative stranded RNA virus at a corresponding site within a heterologous protein, in accordance with the methods ofthe invention. Throughout the order Mononegavirales, five target proteins are strictly conserved and show moderate to high degrees of sequence identity for specific regions or domains. In particular, all known members ofthe order share a homologous constellation of five proteins: a nucleocapsid protein (N), a nucleocapsid phosphoprotein (P), a nonglycosylated matrix (M) protein, at least one surface glycoprotein (HN, H, or G) and a large polymerase (L) protein. These proteins all represent useful targets for incorporating attenuating mutations by altering one or more conserved residues in a protein ofthe recombinant virus at a site corresponding to the site of an attenuating mutation identified in the heterologous, mutant virus.
In more detailed aspects ofthe invention, additional proteins are targeted that may be shared only among particular families, subfamilies, genera or species within the Mononegavirales. For example, all members ofthe Paramyxovirus family have at
least two surface glycoproteins, HN (or H or G) and F. Almost all members ofthe Respirovirus, Rubulavirus and Morbillivirus genera have a cysteine-rich protein V. Respiroviruses and Morbilliviruses also encode homologous C proteins. Pneumoviruses and a subset of Rubulaviruses (Simian virus 5 (SV5) and mumps virus (MuV)) share homologous surface glycoproteins SH. Within the Pneumovirus genus (including bovine, ovine and caprine RSV and pneumonia virus of mice—alternatively referred to herein as murine RSV), several additional proteins, NS1, NS2, M2(ORFl) and M2(ORF2) are conserved. Avian pneumoviruses lack NS1 and NS2 but have M2(ORFl), M2(ORF2), and SH proteins. Each ofthe foregoing proteins provide useful targets for heterologous transfer of attenuating mutations between taxa sharing the target protein of interest.
In this context, the methods ofthe invention are based on identification of an attenuating mutation in a first negative stranded RNA virus. The mutation, identified in terms of mutant versus wild-type sequence at the subject amino acid position(s) marking the site ofthe mutation, provides an index for sequence comparison against a homologous protein in a different virus that is the target virus for recombinant attenuation. The attenuating mutation may be previously known or may be identified by mutagenic and reverse genetics techniques applied to generate and characterize biologically-derived mutant virus. Alternatively, attenuating mutations of interest may be generated and characterized de novo, eg., by site directed mutagenesis and conventional screening methods.
Each attenuating mutation identified in a negative stranded RNA virus provides an index for sequence comparison against a homologous protein in one or more heterologous negative stranded virus(es). In this context, existing sequence alignments may be analyzed, or conventional sequence alignment methods may be employed to yield sequence comparisons for analysis, to identify corresponding protein regions and amino acid positions between the protein bearing the attenuating mutation and a homologous protein of a different virus that is the target recombinant virus for attenuation. Where one or more residues marking the attenuating mutation have been altered from a "wild-type" identity that is conserved at the corresponding amino acid position(s) in the target virus protein, the genome or antigenome ofthe target virus is recombinantly modified to encode an amino acid deletion, substitution, or insertion to alter the conserved residue(s) in the target virus protein and thereby confer an analogous, attenuated phenotype on the recombinant virus.
Within this rational design method for constructing attenuated recombinant negative stranded viruses, the wild-type identity of residue(s) at amino acid positions marking an attenuating mutation in one negative stranded RNA virus may be conserved strictly, or by conservative substitution, at the corresponding amino acid position(s) in the target virus protein. Thus, the corresponding residue(s) in the target virus protein may be identical, or may be conservatively related in terms of amino acid side-group structure and function, to the wild-type residue(s) found to be altered by the attenuating mutation in the heterologous, mutant virus. In either case, analogous attenuation in the recombinant virus may be achieved according to the methods ofthe invention by modifying the recombinant genome or antigenome ofthe target virus to encode the amino acid deletion, substitution, or insertion to alter the conserved residue(s). In this context, it is preferable to modify the genome or antigenome to encode an alteration ofthe conserved residue(s) that corresponds conservatively to the alteration marking the attenuating mutation in the heterologous, mutant virus. For example, if an amino acid substitution marks a site of mutation in the mutant virus compared to the corresponding wild-type sequence, then a substitution should be engineered at the corresponding residue(s) in the recombinant virus. Preferably the substitution will be identical or conservative to the substitute residue present in the mutant viral protein. However, it is also possible to alter the native amino acid residue at the site of mutation non-conservatively with respect to the substitute residue in the mutant protein (e.g., by using any other amino acid to disrupt or impair the identity and function ofthe wild-type residue). In the case of mutations marked by deletions or insertions, these can transferred as corresponding deletions or insertions into the recombinant virus, however the particular size and amino acid sequence ofthe deleted or inserted protein fragment can vary. Within alternative aspects ofthe invention, mutations incorporated within recombinant negative stranded virus may confer a variety of phenotypes in addition to or associated with the desired, attenuated phenotype. Thus, exemplary mutations incorporated within recombinant proteins ofthe virus may confer temperature sensitive (ts), cold-adapted (ca), small plaque (sp), or host range restricted (hr) phenotypes, or a change in growth or immunogenicity, in addition to or associated with the attenuated phenotype.
In exemplary embodiments ofthe invention, a ts or non-te mutation is incorporated within the large polymerase L protein of a negative stranded virus, for example HPIV3. An attenuating mutation is identified in a heterologous, mutant negative
stranded RNA virus (e.g. RSV), which may be any virus sharing a conservative protein structural relationship with PIV3 spanning the mutation of interest. In more detailed embodiments, the attenuating mutation in the heterologous, mutant virus comprises an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV ςpte530 (ATCC VR 2452).
In other exemplary embodiments, a ts or non-ts attenuating mutation is incorporated within a recombinant protein of a parainfluenza virus (PIV), for example, human PIV1 (HPIVl), human PIV2 (HPIV2), human PIV3 (HPIV3), bovine PIV (BPIV), or murine PIV (MPIV or Sendai virus). The recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within a N, P, C, O, V, M, F, HN or L protein ofthe recombinant virus. The mutation may confer a ts or non- ts attenuation phenotype on the recombinant virus. In preferred aspects, the attenuating mutation in the heterologous, mutant negative stranded RNA virus corresponds to a mutation ofthe biologically-derived mutant HPIV3 strain JS cp45, and is preferably an amino acid substitution within the HPIV3 JS cp45 L protein. Exemplary mutations in this context include an amino acid substitution of tyrosine at position 942 ofthe L protein of HPIV3 JS cp45, an amino acid substitution of leucine at position 992 ofthe L protein of HPIV3 JS cp45, and/or an amino acid substitution of threonine at position 1558 ofthe L protein of HPIV3 JS cp45. Yet additional mutations identified in heterologous, mutant negative stranded RNA virus for use in constructing recombinant PIV ofthe invention comprise an amino acid substitution within the F protein of HPIV3 JS cp45. In one example, the attenuating mutation in the heterologous virus comprises an amino acid substitution of isoleucine at position 420 ofthe F protein of HPIV3 JS cp45. Alternatively, the attenuating mutation may comprise an amino acid substitution of alanine at position 450 ofthe F protein of HPIV3 JS cp45. Likewise, attenuation of recombinant PIV can be achieved by modifying the recombinant PIV genome or antigenome to encode an analogous mutation to an attenuating mutation identified in RSV. In one such example described below, the attenuating mutation identified in RSV comprises an amino acid substitution of phenylalanine at position 521 ofthe RSV L protein. The PIV genome or antigenome is modified to encode an alteration of a conserved residue that corresponds conservatively to the alteration marking the attenuating mutation in the heterologous RSV mutant. In one embodiment, the mutation is incoφorated within a recombinant HPIV3
protein and comprises an amino acid substitution of phenylalanine at a corresponding position 456 ofthe L protein of said HPIV3.
Yet additional PIV vaccine candidates within the invention can be achieved by modifying the recombinant PIV genome or antigenome to encode an analogous mutation to an attenuating mutation identified in Sendai virus (SeV). In one example described below, the attenuating mutation comprises an amino acid substitution of phenylalanine at position 170 ofthe C protein of SeV. The PIV genome or antigenome is modified to encode an alteration of a conserved residue that corresponds conservatively to the alteration marking the attenuating mutation in the heterologous, SeV mutant. In one embodiment, the mutation is incorporated within a recombinant HPIV3 protein and comprises an amino acid substitution of phenylalanine at position 164 ofthe C protein of HPIV3.
In additional exemplary embodiments, a ts or non-ts attenuating mutation is incorporated within a recombinant protein of a measles virus (MeV). The heterologous, mutant negative stranded RNA virus in which the attenuating mutation is identified may be a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CPV), rabies virus (RaV), or vesicular stomatitis virus (VSV). Preferably, the heterologous, mutant virus is HPIV3 JS cp45. In more detailed embodiments, the attenuating mutation identified in HPIV3 JS cp45 comprises an amino acid substitution of tyrosine at position 942 or leucine at position 992 ofthe L protein. Yet additional embodiments ofthe invention are provided in which the recombinant negative stranded RNA virus is a chimeric virus. In particular, the virus has a recombinant genome or antigenome comprising a partial or complete genome or antigenome of one species, subgroup, or strain of negative stranded RNA virus combined with a heterologous gene or gene segment of a different species, subgroup, or strain of negative stranded RNA virus. The attenuating mutation may optionally be incoφorated within a protein or protein region encoded by the heterologous gene or gene segment. In preferred aspects, the chimeric virus is a PIV having a complete genome or antigenome of one PIV species, subgroup, or strain combined with at least one gene or gene segment of the HN and F glycoprotein genes of a heterologous PIV species, subgroup, or strain. In other embodiments, the chimeric virus is a RSV in which the recombinant genome or antigenome incoφorates a gene or gene segment of a F, G or SH glycoprotein gene from
a heterologous RSV species, subgroup, or strain. Preferably, the F and G glycoprotein genes of human RSV subgroup A are substituted by the F and G glycoprotein genes of human RSV subgroup B in a RSV A background.
In other aspects ofthe invention, the recombinant negative stranded RNA virus is further modified or attenuated by additional changes to the recombinant genome or antigenome. In one embodiment, the genome or antigenome is further modified to encode one or more additional attenuating mutations adopted from a biologically-derived mutant negative strand RNA virus. For example in a recombinant RSV, the genome or antigenome is modified to encode at least one and up to a full complement of attenuating mutations present within a panel of biologically-derived mutant RSV strains, said panel comprising (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579). Alternatively, in a recombinant PIV the recombinant genome or antigenome encodes at least one and up to a full complement of attenuating mutations present within HPIV3 JS cp45. Preferably, at least one ofthe attenuating mutation(s) contemplated herein are stabilized by multiple nucleotide changes in a codon specifying the mutation.
In other aspects ofthe invention, the recombinant negative stranded RNA virus is further modified or attenuated by a nucleotide modification specifying a phenotypic change selected from a change in growth characteristics, attenuation, temperature-sensitivity, cold-adaptation, small plaque size, host range restriction, or a change in immunogenicity. For example, in RSV the recombinant genome or antigenome may incoφorate a modification ofthe SH, NS1, NS2 or G gene, such as a gene deletion or ablation of gene expression. Other nucleotide modifications in RSV and other negative stranded RNA viruses comprise a nucleotide deletion, insertion, addition or rearrangement within a cis-acting regulatory sequence or within the recombinant genome or antigenome.
In other related aspects the invention provides isolated, recombinant negative stranded RNA virus that are attenuated and elicit an immune response in a host susceptible to infection by the subject virus. The virus comprises a recombinant genome or antigenome and viral proteins necessary to produce an infectious viral particle ofthe RNA virus. The recombinant genome or antigenome is modified to encode a mutation within a recombinant protein ofthe virus at an amino acid position corresponding to an
amino acid position of an attenuating mutation identified in a heterologous, mutant negative stranded RNA virus. The mutation, by incoφoration within the recombinant protein, confers an attenuated phenotype on the recombinant virus.
Also provided are isolated polynucleotide molecules encoding a recombinant genome or antigenome of a recombinant negative stranded RNA virus. The recombinant genome or antigenome is likewise modified to encode a mutation within a recombinant protein ofthe virus at an amino acid position corresponding to an amino acid position of an attenuating mutation identified in a heterologous, mutant negative stranded RNA virus. The mutation, by incoφoration within the recombinant protein, confers an attenuated phenotype on the recombinant virus. In related aspects, expression vectors are provided which comprise an operably linked transcriptional promoter, a polynucleotide molecule encoding a recombinant genome or antigenome of a recombinant negative stranded RNA virus as set forth above, and a transcriptional terminator.
The invention also provides a method for stimulating the immune system of an individual to induce protection against a negative stranded RNA virus. The method includes administering to the individual an immunologically sufficient amount of an attenuated, recombinant negative stranded virus as described above combined with a physiologically acceptable carrier. In related aspects, an immunogenic composition is provided which elicits an immune response against a negative stranded RNA virus. The composition comprises an immunologically sufficient amount of an attenuated, recombinant negative stranded virus ofthe invention combined with a physiologically acceptable carrier. Preferably, the attenuated, recombinant negative stranded virus is a RSV, PIV or measles virus.
BRIEF OESCRIPTION OF THE ORA WINGS
Fig. 1, panel A provides an amino acid sequence alignment ofthe L polymerase proteins of RSV (SEQ IP NO. 44), PIV3 (SEQ IP NO. 45), measles (SEQ IP NO. 46) and Sendai (SEQ IP NO. 47) viruses spanning RSV Phe-521 (denoted by arrow). A consensus sequence (SEQ IP NO. 48) was generated from an exact match of at least three residues of each position. The numerical position ofthe first amino acid in the sequence presented is indicated. Residues conserved in all four viruses are in bold type. Underlined residues are also conserved in the PIV2, canine distemper virus, simian parainfluenza virus 41, simian parainfluenza virus 5, avian pneumovirus, Newcastle
disease virus, Hendra virus, and rindeφest virus L polymerase proteins (Accession numbers P26676, P24658, P35341, Q88434, Y09630, U65312, X05399, AF017149, P41357, respectively). The position ofthe phenylalanine 521 to leucine mutation in RSV cpts530 corresponds to aa 456 in the PIV3 L polymerase. Figure 1, panel B provides a schematic representation ofthe F456L mutation and cp45 mutations that were introduced into PIV3 rwt. Relative positions of the introduced cp45 mutations =(*) and the F456L mutation =(♦).
Figure 1 , panel C shows the nucleotide sequence (positive sense) encoding the F456L mutation (SEQ IP NO. 50) compared to wt sequence (SEQ IP NO. 49). The PIV3 nucleotide sequence numbered according to the complete rwt antigenome is shown for the wt virus and the mutant sequence is shown below. Nucleotide changes are underlined and the codon bearing the F456L mutation is in bold type. The introduced Xmnl restriction endonuclease recognition site in the mutant sequence is in italic type. Figure 2 depicts replication of rcp45 and rcp45-456 in the upper respiratory tract of chimpanzees. Mean virus titers in the nasopharyngeal swab specimens on the indicated date post-infection from animals infected with D, rcp45-456, n=6; or ■, rcp45 n=4. Statistically significant difference between indicated values: (a) PO.005; (b) p<0.05; (c) p<0.025; Student's t-test. (d) Limit of detection <0.5 log.o TCIO5o/ml. Figure 3 depicts organization ofthe HPIV3 P/C/D/V ORFs (not to scale).
The three reading frames ofthe P mRNA are shown (+1, +2 and +3) with the P, C, O and N ORFs represented by rectangles. Amino acid lengths are indicated. The position ofthe RΝA editing site is shown as a vertical line and its sequence motif is shown and numbered according to its nucleotide position in the complete HPIV3 antigenomic sequence.
Figure 3, panel A depicts organization ofthe unedited P mRΝA. The sequence containing the translational start sites ofthe P and C ORFs is shown (SEQ IP NO. 52) and is numbered according to the complete antigenomic sequence. The nucleotide positions ofthe P, C, O, and V ORFs in the complete antigenomic sequence are: P, 1784-3595; C, 1794-2393; 0, 2442-2903; V, 2792-3066. Relative to the P mRNA, the AUG that opens the P ORF is at positions 80-82.
Figure 3, panel B depicts organization of an edited version ofthe P mRNA that contains an insertion of two nontemplated G residues (GG) (SEQ IP NO. 53) in the editing site (SEQ IP NO. 51). This changes the reading register so that the upstream end
ofthe P ORF in frame +2 is fused to the O ORF in frame +3. The resulting chimeric protein contains the N-terminal 241 amino acids encoded by the P ORF fused to the C- terminal 131 amino acids encoded by the O ORF.
Figure 4 shows results of a radioimmunoprecipitation assay demonstrating expression ofthe C protein in rF164S. Lane (a) 35S-labeled cell lysates were immunoprecipitated with a polyclonal C-specific rabbit antiserum. A 22kO band corresponding to the C protein (open arrow) is clearly present in rJS and rF164S lysates.
Lane (b) cell lysates were immunoprecipitated by a mixture of two monoclonal antibodies specific to the HPIV3 HN protein. The 64kP band corresponding to the HN protein (closed arrow) is present in each virus lysate confirming they are indeed HPIV3 and express similar levels of proteins. Mock lane indicates tissue culture lysates harvested from uninfected cells.
Figure 5 shows the results of multicycle replication ofthe recombinant mutant virus rF164S compared with the parent virus rJS. The virus titers are shown as TCIP5o/ml and are the average of duplicate samples.
PESCRIPTION OF THE SPECIFIC EMBOOIMENTS
The methods ofthe invention provide attenuated, recombinant negative stranded RNA viruses suitable for vaccine use. The recombinant negative stranded RNA viruses are produced from one or more isolated polynucleotide molecules encoding the virus. Production of a recombinant virus is achieved by coexpressing in a cell or cell-free system one or more polynucleotide molecules that encode: (i) a recombinant genome or antigenome ofthe virus and (ii) essential viral proteins necessary to produce an infectious virus or subviral particle.
The recombinant genome or antigenome ofthe subject recombinant virus is modified to encode a mutation within a recombinant protein ofthe virus at one or more amino acid position(s) corresponding to a site of an attenuating mutation in a heterologous, mutant negative stranded RNA virus. The attenuating mutation identified in the heterologous negative stranded RNA virus is thus "transferred" to a corresponding site within the recombinant virus to confer an attenuated phenotype on the recombinant virus. The transferred mutation typically is identical or conservative to the attenuating mutation identified in the heterologous. mutant virus, although non-conservative substitutions also can be made. By incoφoration of transferred mutations into
recombinant negative stranded RNA viruses in this manner, candidate vaccine viruses are engineered to elicit a desired immune response against a subject virus in a host susceptible to infection thereby.
The instant invention embodies a novel paradigm for rationally designing attenuated vaccine viruses based on the identification of attenuating mutations in a heterologous negative stranded RNA virus. Attenuating mutations in the heterologous virus are mapped to one or more amino acid deletion(s), substitution(s), or insertion(s) in a protein of interest in the heterologous, mutant virus, eg., by conventional nucleotide or amino acid sequence comparison between the mutant virus and its non-attenuated parental virus. In this context, the parental virus is typically a biologically-derived strain that is wild-type, at least for the attenuated phenotype. However, partially attenuated mutant strains may also be used, wherein an additional attenuating mutation may arise through artificial mutagenesis or by natural polymoφhism, etc. In addition, parental virus in which attenuating mutations may be introduced and subsequently mapped include artificially produced virus such as are provided through cPNA viral clones in accordance with known reverse genetic methods.
Thus, the attenuating mutations identified in heterologous negative stranded RNA viruses may be previously known or may be generated and/or identified by conventional mutagenic and/or reverse genetics techniques. These techniques may be applied to generate and characterize biologically-derived mutant virus, or to generate and characterize attenuating mutations of interest de novo, eg., by site directed mutagenesis of a wild-type or non-attenuated mutant viral cPNA clone in conjunction with conventional screening methods to identify attenuated derivatives. Reverse genetic methods for recovery and genetic manipulation of infections viral clones are known for representative viral groups throughout the Mononegavirales (for reviews, see Conzelmann, J. Gen. Virol. 77:381-89 (1996V. Palese et al.. Proc. Natl. Acad. Sci. U.S.A. 93:11354-58. (1996)).
For example, rescue of infectious viral clones has been reported for rabies virus (RaV), vesicular stomatitis virus (VSV), measles virus (MeV), and Sendai virus (SeV) rindeφest (Baron et al, J. Virol. 71:1265-1271 (1997)) and simian virus S (He et al.. Virology 237:249-260 (1997), see page 5) from cPNA-encoded antigenomic RNA coexpressed with essential viral proteins for infectivity, namely the nucleocapsid N, phosphoprotein P, and large polymerase subunit L (see, eg., Garcin et al., EMBO J. 14:6087-6094 (1995); Lawson et al.. Proc. Natl. Acad. Sci. U.S.A. 92:4477-81 (1995);
Radecke et al., EMBO J. 14:5773-5784 (1995); Schnell et al., EMBO J. 13:4195-203 (1994); Whelan et al., Proc. Natl. Acad. Sci. U.S.A. 92:8388-92 (1995); and International Publication No. WO 97/06270, each incoφorated herein by reference).
Rescue of infectious respiratory syncytial virus (RSV) has also been achieved through development of a novel system using cONA-encoded antigenomic RNA coexpressed with the nucleocapsid N, phosphoprotein P, large polymerase subunit L, and a previously uncharacterized product of the M2 ORF1 gene (see, U.S. Patent Application No. 08/720,132, filed September 27, 1996, which is a continuation of U.S. Provisional Application No. 60/007,083, filed September 27, 1995, and U.S. Patent Application No. 08/892,403, filed July 15, 1997, which corresponds to published International Application No. WO 98/02530 and is a continuation-in-part of U.S. Provisional Application Nos. 60/047,634, filed May 23, 1997, 60/046,141, filed May 9, 1997, and 60/021,773, filed July 15, 1996, each incoφorated herein by reference). These disclosures include description of representative constructs for use in producing infectious, recombinant RSV, including recombinant RSV clones incoφorating attenuating mutations adopted from biologically-derived RSV mutants. One such construct is a recombinant viral clone incoφorating an attenuating mutation of the RSV mutant cpts530, designated O53-530- sites (). Further description of methods and compositions for recovery and recombinant manipulation of RSV clones is provided in Collins et al., Proc. Natl. Acad. Sci. USA 92:11563-7 (1995); Juhasz et al, Vaccine 17:1416-1424 (1999); Juhasz et al., J. Virol. 71(8):5814-5819 (1997); Whitehead et al, Virology 247(2):232-9 (1998a); Whitehead et al., J. Virol. 72(5):4467-4471 (1998b); and Whitehead et al., J. Virol. 73:(4)3438-3442 (1999), each incoφorated herein by reference.
In another important example, rescue of infectious parainfluenza virus (PIV) has also been achieved through using cPNA-encoded antigenomic RNA coexpressed with the N, P and L proteins (see, U.S. Patent Application No. 09/083,793 filed May 22, 1998, which corresponds to published International Application No. WO 98/53078 and is a continuation-in-part of U.S. Provisional Application No. s 60/047,575 filed May 23, 1997, and 60/059,385, each incoφorated herein by reference). These references include description ofthe following plasmids for use in producing infectious PIV clones: p3/7(131) (ATCC 97990); p3/7(131)2G (ATCC 97989); and p218(131) (ATCC 97991); each deposited under the terms ofthe Budapest Treaty with the American Type Culture Collection (ATCC) of 10801 University Boulevard, Manassas, Virginia 20110-2209.
Oevelopment of reverse genetics systems for recovery and manipulation of negative stranded RNA viruses allows for detailed analysis and mapping of attenuating mutations to develop useful recombinant vaccine candidates specific to the subject viral species. Heretofore, transfer of attenuating mutations by recombinant methods within the Order Mononegarirales has not been tested or achieved. Nonetheless, the wide range of attenuated mutant strains identified for such representative taxa as RSVs, PIVs, measles and other members ofthe Mononegavirales, combined with the powerful tools provided through reverse genetics, serves as a rich source for determining useful mutations for heterologous transfer within the methods ofthe invention. Attenuating mutations in heterologous negative stranded RNA viruses may be identified in biologically-derived mutant strains for incoφoration within a heterologous, recombinant virus ofthe invention. The subject mutations may occur naturally or may be introduced into wild-type or partially attenuated parental strains by well known mutagenesis procedures. For example, attenuated mutant viral strains can be produced by chemical mutagenesis during virus growth in cell cultures to which a chemical mutagen has been added, by selection of virus that has been subjected to passage at suboptimal temperatures in order to introduce growth restriction mutations, or by selection of a mutagenized virus that produces small plaques (sp) or temperature sensitive (ts) virus in cell culture (see, eg., U.S. Patent Application No. 08/327,263, incoφorated herein by reference).
By "biologically-derived" mutant is meant any mutant virus that is not produced by recombinant means. Thus, biologically-derived mutants include naturally occurring mutants having genomic variations from a reference wild-type sequence, eg., partially attenuated mutant PIV strains. Likewise, biologically-derived mutants include mutants derived from any parental viral strain without recombinant methods by, inter alia, artificial mutagenesis and selection procedures.
One well known procedure for generating biologically-derived negative stranded RNA virus involves subjecting a wild type or partially attenuated virus to passage in cell culture at progressively lower, attenuating temperatures. For example in the case of RSV, wild-type virus is typically cultivated at approximately 34-37°C.
Partially attenuated mutants are produced by passage in cell cultures (e.g., primary bovine kidney cells) at suboptimal temperatures, e.g., 20-26°C. Thus, the cp mutant or other partially attenuated strain, eg., ts-1 or spRSV, is adapted to efficient growth at a lower temperature by passage in MRC-5 or Vero cells, down to a temperature of about 20-24°C,
preferably 20-22°C. This selection of mutant RSV during cold-passage substantially eliminates any residual virulence in the derivative strains as compared to the partially attenuated parent.
Alternatively, specific mutations can be introduced into biologically- derived viruses by subjecting a wild type or partially attenuated parent virus to chemical mutagenesis, eg., to introduce ts mutations or, in the case of viruses which are already ts, additional ts mutations sufficient to confer increased attenuation and/or stability ofthe ts phenotype on the attenuated derivative. Means for the introduction of ts mutations into negative stranded RNA viruses include replication ofthe virus in the presence of a mutagen such as 5-fluorouridine or 5-fluorouracil in a concentration of about 10" to 10" M, preferably about 10"4 M, exposure of virus to nitrosoguanidine at a concentration of about 100 μg/ml, according to the general procedure described in, e.g., Ghaφure et al., J. Virol. 3:414-421 (1969) and Richardson et al.. J. Med. Virol. 3:91-100 (1978). Other chemical mutagens can also be used. Attenuation can result from a ts mutation in almost any viral gene, although a particularly amenable target for this puφose has been found to be the highly conserved polymerase (L) gene.
The level of temperature sensitivity of replication in exemplary attenuated virus for use within the invention is determined by comparing its replication at a permissive temperature with that at several restrictive temperatures. The lowest temperature at which the replication ofthe virus is reduced 100-fold or more in comparison with its replication at the permissive temperature is termed the shutoff temperature. In experimental animals and humans, both the replication and virulence of exemplary mutant RSV strains approximately correlate with the mutant's shutoff temperature. Replication of mutants with a shutoff temperature of 39°C is moderately restricted, whereas mutants with a shutoff of 38°C replicate less well and symptoms of illness are mainly restricted to the upper respiratory tract. A virus with a shutoff temperature of 35 to 37°C will typically be fully attenuated in humans. Thus, attenuated biologically-derived mutant RSV for use within the invention which are ts will have a shutoff temperature in the range of about 35 to 39°C, and preferably from 35 to 38°C. The addition of a ts mutation into a partially attenuated strain produces multiply attenuated virus useful within vaccine compositions ofthe invention.
A number of attenuated RSV strains as candidate vaccines have been developed using multiple rounds of chemical mutagenesis to introduce multiple mutations into a virus which had already been attenuated during cold-passage (e.g., Connors et al.,
Virology 208: 478-484 (1995); Crowe et al., Vaccine 12: 691-699 (1994a); and Crowe et al., Vaccine 12: 783-790 (1994b), incoφorated herein by reference). Evaluation of these biologically-derived mutants in accepted rodent and chimpanzee models, as well as in human adults and infants, indicates that certain of these candidate vaccine strains are genetically stable, highly immunogenic, and attenuated. Similar descriptions of attenuated mutant viruses are provided for PIV and other negative stranded RNA viral subjects of the invention (see, eg., U.S. Patent Application No. 08/892,403 and corresponding International Application No. WO 98/02530; U.S. Patent Application No. 09/083,793 and corresponding International Application No. WO 98/53078, each incoφorated herein by reference).
In accordance with the methods ofthe invention, nucleotide sequence analysis of attenuated mutant viruses involving comparison of mutant to parental, eg., wild-type or partially attenuating, ONA or amino acid sequences can be employed to map attenuating mutations to specific nucleotide and amino acid changes. Often these changes will involve individual amino acid substitutions, however other mutations subject to conservative transfer according to the methods ofthe invention involve multiple amino acid substitutions, amino acid insertions or deletions, as well as more extensive alterations of conserved regions or domains within a target protein.
By employing the above-noted reverse genetic methods, nucleotide and amino acid changes identified in an attenuated mutant virus can be introduced into a previously characterized, cONA-encoded virus, thereby allowing the artisan to distinguish between silent, incidental mutations and those responsible for the desired phenotypic changes. In this regard, subject mutations are introduced separately and in various combinations into the genome or antigenome of infectious RSV clones. This process, coupled with evaluation of phenotype characteristics of parental and derivative viruses, further identifies mutations responsible for such desired characteristics as attenuation, temperature sensitivity, cold-adaptation, small plaque size, host range restriction, etc.
Mutations thus identified and mapped provide a rich source of candidate mutations for designing recombinant negative stranded RNA viruses using the heterologous transfer methods described herein. Exemplary disclosures which identify and characterize such attenuating mutations in negative stranded RNA viruses are provided in U.S. Patent Application No. 08/892,403 and corresponding International Application No. WO 98/02530; and U.S. Patent Application No. 08/083,793 and
corresponding International Application No. WO 98/53078. These and other references incoφorated herein provide a "menu" of attenuating mutations that are candidates for transfer into heterologous viral clones according to the methods ofthe invention.
For example, U.S. Patent Application No. 08/892,403 and corresponding International Application No. WO 98/02530 describe cold passaged (cp) and temperature sensitive (ts) mutants of RSV (subfamily Pneumovirinae; genus Pneumovirus), including the exemplary mutants designated cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579. From these biologically-derived mutants an exemplary panel of attenuating mutations has been mapped and characterized, including specific nucleotide changes in the large polymerase gene L resulting in amino acid substitutions at parental residue/sequence positions Phe5 ι, Gln8 ι, Metn69, and Tyr_32i, as exemplified by the attenuating substitutions, Leu for Phe52ι, Leu for Gln83ι, Val for Metπ69, and Asn for Tyn32.. Each of these mutations occurs in the highly conserved L protein and confers a ts phenotype on the mutant virus. However, additional mutations have been identified in RSV and other negative stranded RNA viruses, as well as in other conserved proteins, which confer a range of attenuating phenotypes including ts and non-ts attenuating phenotypes eg., as present in cold passaged (cp) small plaque (sp), cold-adapted (ca) or host-range restricted (hr) mutant strains.
Thus, an additional menu of exemplary mutations for incoφoration within recombinant negative stranded viruses according to the methods ofthe invention has been identified for the distantly related paramyxovirus, human PIV3 (subfamily Paramyxovirinae; genus Respir ovirus). One such panel of mutations has been identified and characterized in the biologically-derived (cold-passaged) HPIV3 mutant virus strain JS cp45 (see, U.S. Patent Application No. 08/083,793 and corresponding International Application No. WO 98/53078, incoφorated herein by reference). Among the mutations mapped and characterized within this strain are nucleotide changes encoding ts attenuating amino acid substitutions in the polymerase L gene at parental residue/sequence positions Tyr 2, Leu 92, and/or Thrι558. In the exemplary JS cp45 mutant L protein, Tyr9 2 is replaced by His, Leu9 2 is replaced by Phe, and Thri558 is replaced by He. These mutations have been successfully incoφorated in various PIV recombinants, including the recombinants designated as r942, r992, rl558, r942/992,
r992/1558, r942/1558, and r942/992/1558 incoφorating the numerically indicated mutations singly and in combination.
Other exemplary mutations identified in HPIV3 JS cp45 have been mapped and characterized to encode attenuating amino acid substitutions in the F and C proteins of HPIV3. These include mutations encoding non-ts attenuating amino acid substitutions in the C protein ofthe P gene at the parental residue/position Ile of JS HPIV3, as exemplified by the substitution of Ile 6 to Thr. Further exemplary mutations identified in the F protein of HPIV3 encode amino acid substitutions at parental residue/positions Ile42o and Ala^o, as exemplified by the substitutions Ile42o to Val and Ala^o to Thr.
Also identifiable in this manner are attenuating mutations in non-coding portions of a negative stranded viral gene. For example, attenuating mutations may include single or multiple base changes in a gene start sequence, as exemplified by an attenuating base substitution in the RSV M2 gene start sequence at nucleotide 7605. Where such mutations map to conserved nucleotide positions within a heterologous negative stranded RNA virus, they also are amenable to transfer between heterologous taxa according to the methods ofthe invention.
Each attenuating mutation thus identified in a negative stranded RNA virus provides an index for sequence comparison against a homologous protein in one or more heterologous negative stranded virus. To practice this aspect ofthe invention, existing sequence alignments may be analyzed, or conventional sequence alignment methods may be employed to conduct sequence comparisons to identify corresponding protein regions and amino acid positions between a protein bearing an identified attenuating mutation in one negative stranded RNA virus and a homologous protein in a different virus that is the target virus for recombinant attenuation. The focus of this exercise is to identify one or more residues that are associated with the attenuating mutation in the first (heterologous) virus, i.e., which has been altered from a parental sequence where the parent lacks the mutant phenotype. By sequence alignment it is then determined whether the parental sequence ofthe mutant is conserved, by the presence of an identical or conservative amino acid residue at a corresponding amino acid position(s) in the target (recombinant) virus protein. Typically, the "wild-type" sequence element(s) thus conserved will occur in a conserved region or domain ofthe protein, however isolated residues and blocks of amino acid residues are also widely conserved among different taxa within the Mononegavirales and can provide equally useful targets for heterologous transfer of
attenuating mutations between heterologous RNA viruses (wherein all or part ofthe conserved sequence element(s) bearing the mutant change is copied or imported into the recombinant virus to yield a novel attenuated derivative).
Various conserved proteins among the Mononegavirales provide useful targets within the invention for introducing attenuating mutations found or generated in one, heterologous negative stranded RNA virus to a different, recombinant virus. This is attributable to the remarkable degree of structural and functional conservation among various taxa within the Mononegavirales. Throughout this order, five target proteins are universally conserved as accepted homologous proteins derived from a distant common ancestral virus. These proteins typically show moderate to high degrees of sequence identity, particularly within specific regions or domains that are postulated to share common functional attributes. Specifically, all known negative stranded RNA viruses share a homologous constellation of proteins comprising a nucleocapsid protein (N), a nucleocapsid phosphoprotein (P), a nonglycosylated matrix (M) protein, at least one surface attachment glycoprotein (HN, H, or G) and a large polymerase (L) protein. These proteins each exhibit conserved sequence elements that represent useful targets for transferring attenuating mutations by alteration of one or more conserved residues shared between a target virus and a heterologous parental virus for which mutant derivatives or constructs have been identified to exhibit an amino acid change that specifies an attenuated phenotype. Additional proteins are also targeted in this manner that are only shared among particular families, subfamilies, genera or species within the Mononegavirales.
The Order Mononegavirales embraces the families Filoviridae, Paramyxoviridae, Bornaviridae and Rhabdoviridae, which are all comprised of viruses with monopartite negative-stranded RNA genomes, Pringle, Arch Virol. 117:137-140 (1991). A summary ofthe taxonomy within this group, including identification of family/subfamily/generic and type specific groupings is provided by Pringle, Arch Virol. 142(11): 2321-2326 (1997). A representative classification ofthe Mononegavirales, and expanded classification ofthe Paramyxoviridae, is set forth herein in Table 1. Common features apparent in the genetic organization of these three families of viruses with linear negative stranded RNA genomes justify their grouping together as an order, particularly in view ofthe fact that genetic recombination occurs rarely, if at all, in these viruses and consequently phenotypic relationships are likely to reflect genetic continuity.
Table 1. Nonsegmented Negative Strand RNA Animal Viruses
Order Mononegavirales
-Family Rhabdoviridae Genus Vesiculovirus (vesicular stomatitis virus)
Genus Lyssavirus (rabies virus) Genus Ephemerovirus (bovine ephemeral fever virus) Other genera -Family Filoviridae (Ebola virus, Marburg virus) -Family Bornaviridae (Borna disease virus)
-Family Paramyxoviridae
Classification of Respiratory Syncytial Virus within
Family Paramyxoviridae and Members ofthe Indicated Taxa.
Subfamily Paramyxovirinae Genus Respir ovirus
-Sendai virus (murine parainfluenza virus type 1) -human parainfluenza virus type 1 -human parainfluenza virus type 3
-bovine parainfluenza virus type 3
Genus Morbϊllivirus
-measles virus -canine distemper virus
-rindeφest virus
-cetacean (dolphin) Morbϊllivirus
-phocine (seal) distemper virus
-pest-des-petits-ruminants virus -Hendra virus (newly identified Australian pathogen)
Genus Rubulavirus
-mumps virus
-simian virus 5 (canine parainfluenza virus type 2) -human parainfluenza virus type 2
-human parainfluenza virus type 4
-avian parainfluenza virus (including Newcastle disease virus)
-porcine Rubulavirus
-simian virus type 41 -Mapuera virus
Subfamily Pneumovirinae Genus Pneumovirus
-human respiratory syncytial virus (subgroups A and B) -bovine respiratory syncytial virus
-ovine and caprine respiratory syncytial virus -pneumonia virus of mice
Genus avian pneumovirus
-avian pneumovirus (formerly turkey rhinotracheitis virus)
1 Assignment as a separate genus, yet to be named, is planned.
The Families Bornaviridae and Filoviridae are represented by single genera. The Genus Bornavirus as yet contains only a single species (borna disease virus). Four species are recognized in the Genus Filovirus (type species Marburg virus) by virtue of nucleotide sequence and antigenic divergence and differential expression ofthe attachment (G) protein. The Family Rhabdoviridae includes five genera, Vesiculovirus, Lyssavirus, Ephemerovirus, Cytorhabdovirus, and Nucleorhabdovirus, which in addition to sequence and antigenic differences are distinguished by host range, presence of supplementary genes, and intracellular site of multiplication. The Family Paramyxoviridae is represented by two sub-families; the Paramyxovirinae with three genera, Respirovirus (type species HPIVl), Morbillivirus (type species MeV), and
Rubulavirus (type species MuV), and the Pneumovirinae (type species human RSV) and one planned additional genus which will include avian pneumovirus.
In all members ofthe order there are 5-10 genes and transcription is initiated from a single presumptive 3 '-terminal promoter by a viral RNA-dependent RNA polymerase. With the exception of some pneumoviruses there is strict conservation of gene order. In Fig. 1 of Pringle, Arch Virol. 142(11): 2321-2326 (1997) genes are compared for sixteen viruses representing different families, subfamilies, and genera within the Mononegavirales, which genes are classified and grouped as homologs between the various taxa described. Thus, VSV is shown to exhibit the minimal complement of five genes; nucleoprotein (N), phosphoprotein (P), matrix protein (M), attachment protein (G), and polymerase protein (L). Borna disease virus ofthe Bornaviridae, Ebola virus ofthe Filoviridae and eight members ofthe Rhabdoviridae exhibit a basic five gene pattern (N-P-M-G-L), augmented in the case of Ebola virus and four ofthe eight rhabdoviruses by insertion of one or more genes between G and L, or between P and M in the case of three ofthe remaining four rhabdoviruses.
Paramyxoviruses ofthe Subfamily Paramyxovirinae exhibit an increase in complexity; the basic 5 gene pattern is enhanced by multiple encoding of genetic information in the P gene and the insertion of an additional envelope protein gene (F) between M and the attachment protein (H or HN), and in addition by SH in certain ofthe Rubulaviruses. All
ofthe paramyxoviruses have at least two surface glycoproteins, HN (or H or G) and F. Almost all members ofthe Respirovirus, Rubulavirus and Morbillivirus genera have a cysteine-rich protein V. Respiroviruses and Morbilliviruses also encode homologous C proteins. Pneumoviruses and a subset of Rubulaviruses (Simian virus 5 (SV5) and mumps virus (MuV)) share homologous surface glycoproteins SH. Within the
Pneumovirus genus (including bovine, ovine and caprine RSV and pneumonia virus of mice— alternatively referred to herein as murine RSV) several additional proteins, NS 1 , NS2, M2(ORFl) and M2(ORF2) are conserved. The paramyxoviruses ofthe subfamily Pneumovirinae, exhibit unique deviations from the basic pattern, the most significant being possession of additional genes. In the avian, human and murine pneumoviruses the M2 gene encodes two proteins in different reading frames, both of which have significant effects on RNA synthesis in vitro. In the human and murine pneumoviruses two genes encoding non-structural proteins NS1 and NS2 of unknown function are located between the 3'-leader region and N. The avian pneumovirus is closest to the basic pattern, lacking the two unique 3' terminal NS genes and retaining the standard paramyxo virus gene order with the exception of insertion ofthe M2 gene. This conservative pattern of genome organization suggests evolution by expansion of intergenic regions and by gene duplication, rather than by introduction of genetic information from outside. Pringle, Semin. Virol. 8:49-57. 1997. As noted above, the methods ofthe invention are based on identification of an attenuating mutation in a first negative stranded RNA virus, which mutation is mapped by comparison of a mutant versus a wild-type sequence to yield identification of a subject amino acid position(s) marking the site ofthe mutation. Preferably, these mutations are incoφorated into a non-attenuated or partially attenuated, recombinant viral clone to verify that the subject change in fact specifies an attenuated phenotype. A host of exemplary attenuating mutations in this context are provided in the instant disclosure, and others are readily identifiable in accordance with known mutagenic and reverse genetics techniques in accordance with the description herein. Each attenuating mutation identified in one negative stranded RNA virus provides an index for sequence comparison against a homologous protein in one or more heterologous negative stranded virus(es). To practice the above aspects ofthe invention, existing sequence alignments may be analyzed, or conventional sequence alignment methods may be employed to yield sequence comparisons for analysis, to identify corresponding protein regions and amino acid positions between the protein bearing the attenuating mutation
and a homologous protein of a different virus that is the target recombinant virus for attenuation. Where one or more residues marking the attenuating mutation have been altered from a parental, eg., wild-type, identity that is conserved (i.e., identical or represented by a conservatively related amino acid residue) at the corresponding amino acid position(s) in the target virus protein, the genome or antigenome ofthe target virus is recombinantly modified to encode an identical or conservative amino acid deletion, substitution, or insertion to alter the conserved residue(s) in the target virus protein and thereby confer an analogous, attenuated phenotype on the recombinant virus.
Sequence alignments and analysis to practice this aspect ofthe invention focus on homologous, "counteφart" genes, gene segments, proteins and/or protein domains in which a polynucleotide or amino acid reference sequence is used as a defined sequence to provide a basis for statistical sequence comparison. For example, the reference sequence may be a defined segment of a cPNA or gene, a complete cPNA or gene sequence or a sequence of a protein or sub-portion thereof. Generally, a reference sequence, for use in defining counteφart genes or gene segments, is at least 20 nucleotides in length, frequently at least 25 nucleotides in length, and often at least 50 nucleotides in length and that for proteins and protein segments is at least 20 amino acids in length. Since two polynucleotides or amino acid sequences may each (1) comprise a sequence (i.e., a portion ofthe complete polynucleotide or protein sequence) that is similar between the two polynucleotides or proteins, and (2) may further comprise a sequence that is divergent between the two polynucleotides or proteins, sequence comparisons between two (or more) polynucleotides or proteins are typically performed by comparing sequences ofthe two subject sequences over a "comparison window" to identify and compare local regions of sequence identity or similarity. A "comparison window", as used herein, refers to a conceptual segment of at least 20 contiguous nucleotide or amino acid positions wherein a sequence may be compared to a reference sequence of at least 20 contiguous nucleotides or amino acids, and wherein the portion ofthe polynucleotide or amino acid sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment ofthe two sequences.
Optimal alignment of sequences for aligning a comparison window may be conducted by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol.
Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988) (each of which is incoφorated by reference), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package Release 7.0, Genetics Computer Group, 575 Science Or., Madison, Wl, incoφorated herein by reference), or by inspection, and the best alignment (i.e., resulting in the highest percentage of sequence similarity over the comparison window) generated by the various methods is selected.
The term "sequence identity" as used herein means that two polynucleotide or protein sequences are identical (i.e., on a nucleotide-by-nucleotide or residue-by- residue basis) over the window of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I) or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
The term "substantial identity" as used herein denotes a characteristic of two polynucleotide or amino acid sequences which share at least 85 percent sequence identity, preferably at least 90 to 95 percent sequence identity, and sometimes at 99 percent or greater sequence identity over a comparison window of at least 20 nucleotide or amino acid positions, frequently over a window of at least 25-50 nucleotides or amino acids, wherein the percentage of sequence identity is calculated by comparing the reference sequence to a comparison sequence which may include deletions or additions which total 20 percent or less ofthe reference sequence over the window of comparison. The reference sequence may be a subset of a larger sequence.
As applied to proteins and structural elements within proteins, the term "sequence identity" means that the sequences share one or more identical amino acids at corresponding positions. The term "sequence similarity" means that two sequences are share one or more conservatively related amino acids at corresponding positions, eg., attributable to conservative substitutions. The term "substantial sequence identity" means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 85 percent sequence identity, preferably at least 90 percent sequence identity, more preferably at least 95 percent sequence identity or more (e.g., 99 percent sequence identity). The term "substantial
similarity" means that two peptide sequences share corresponding percentages of sequence similarity.
Conservative sequence relationships exist even when amino acid residues at corresponding positions between two sequences are not identical but differ by a conservative amino acid structural relationship. In this context, conservative amino acid substitutions refer to the general interchangeability of amino acid residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine- valine, and asparagine-glutamine. Stereoisomers (e.g., O-amino acids) ofthe twenty conventional amino acids, unnatural amino acids such as α, α-disubstituted amino acids, N-alkyl amino acids, lactic acid, and other unconventional amino acids may also be suitable components for polypeptides ofthe present invention. Examples of unconventional amino acids include: 4-hydroxyproline, γ-carboxyglutamate, ε-N,N,N- trimethyllysine, ε -N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5 -hydroxy lysine, ω-N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline). Moreover, amino acids may be modified by glycosylation, phosphorylation and the like.
To facilitate practice ofthe above aspects ofthe invention, reference is made to the known molecular phylogeny of conserved viral proteins within the order
Mononegavirales. In this regard, extensive studies have provided detailed assessments of protein relatedness on a precise, molecular level. These studies include detailed sequence comparisons for conserved proteins among the Mononegavirales, yielding widely accepted maps of conserved structural domains, sequence elements and constrained, isolated residues within these proteins. Each of these conserved protein domains, sequence elements and constrained residues facilitate practice ofthe invention by providing useful targets for conservative transfer of attenuating mutations from a heterologous, attenuated mutant virus to a different, recombinant virus according to the methods ofthe invention.
For example, Poch et al., J. Gen. Virol. 5:1153-62, (1990) (incoφorated herein by reference) provide a detailed comparison ofthe deduced amino acid sequences for five L proteins within the Mononegavirales, including L proteins of rhabdoviruses (VSV and RaV) and paramyxoviruses (SeV, NOV and MeV). Conventional alignment methods (incoφorated herein by reference) reveal that these L proteins from diverse virus families exhibit a high degree of homology along most of their length— with strongly invariant amino acids embedded in conserved blocks separated by regions which are relatively all well conserved. Thus, these different L proteins from heterologous negative stranded RNA viruses possess a conservative structure of concatenated functional domains. For example, the L protein includes a highly conserved central region which is thought to contain the active site for RNA synthesis. Other conserved structural domains, motifs and sequence elements, including stringently conserved, isolated residues are also identified, some of which are distributed around the conserved central core and are thought to be important for polymerase activity. These conserved sequence elements identified in the L protein (see, Poch et al., J. Gen. Virol. 5 : 1153-62,(1990) and Poch et al. EMBO J. 8(12)3867-3874, (1989), particularly Fig. 1, incoφorated herein by reference), provide detailed information to compare with L protein sequences of heterologous, parental strains from which attenuating mutations have been generated and mapped. Thus, using these and other sequence methods and data, including the sequence methods and data presented in the publications incoφorated herein, it can be readily determined whether a residue(s) marking an attenuating mutation has been altered from a parental, eg., wild-type, identity that is conserved (i.e., identical or represented by a conservatively related amino acid residue) at the corresponding amino acid position(s) in a target virus L protein — which determination indicates a high probability for successful incoφoration ofthe attenuating mutation identified in the heterologous virus into the antigenome or genome ofthe recombinant, target virus.
Further detail concerning structural conservation among different L protein homologs throughout the Mononegavirales is provided in Stec et al., Virology 183:273- 287 (1991), incoφorated herein by reference. This sequence analysis is based on published sequences of L genes and proteins for three paramyxoviruses, two from the genus Respirovirus (PIV3 and SeV), and one from the genus Rubulavirus (NOV), one paramyxovirus from the genus Morbillivirus (MeV), and two viruses from the family Rhabdoviridae (RaV and VSV) (see eg., Schubert et al., 1985; Shioda et al., 1986; Yusoff et al., 1987; Blumberg et al, 1988; Galinski et al., 1988; and Teart et al., 1988, each
incoφorated herein by reference), and provides additional sequence information and alignment results for RSV. These results confirm the teachings of Poch et al., supra, regarding the highly significant sequence conservation within the paramyxovirus and rhabdovirus families, and identify yet additional conserved structural domains, motifs and sequence elements.
Briefly, the disclosure of Stec et al. relies on conventional alignment methods which, among other similar methods, are useful within the instant invention. In particular, Stec et al. aligned heterologous negative stranded RNA viral sequences using the accepted methods of Wilbur and Lipman Proc. Natl. Acad. Sci. USA 80:726-730 (1983), using deletion and gap penalties of 12 and 6, respectively, and the similarity scoring matrix of Dayhoff et al., in "Atlas of Protein Sequence and Structure" (M.O. Dayhoff, Ed.), Vol. 5, Suppl. 3, pp. 345-352 Natl. Biomed. Res. Found., Silver Spring, MD (1978), each incoφorated herein by reference. The similarity scoring system was used to construct pairwise global dot matrix alignments between RSV and other negative- strand RNA virus L proteins listed in Table 1. By these methods, regions of unambiguous sequence relatedness were detected between the RSV L protein and the L proteins of distantly related paramyxoviruses and rhabdoviruses. As illustrated in Fig. 3, the regions of sequence relatedness between the RSV L protein and each ofthe others are colinear and concentrated in the amino-proximal region, representing approximately one- fifth of each molecule. The same pattern of sequence similarity was noted in previous alignments ofthe other paramyxovirus and rhabdovirus L proteins (Blumberg et al., 1988, Galinski et al., 1988; Teart et al., 1988, each incoφorated herein by reference), including the five-way alignment of SeV, MeV, NDV, RaV, and VSV L proteins conducted by Poch et al. (1989), supra. In the seven-way alignment of Stec et al., supra, the RSV L protein was determined to contain an amino-terminal extension of about 70 amino acids and a carboxy-terminal truncation of about 100 amino acids relative to other negative stranded RNA viruses. However, this change does not affect the reliability of alignment methods to identify conservative structural elements, and is thought to be attributable to the fact that the RSV L protein is encoded, in part, by the overlap ofthe L gene with its upstream neighbor, the M2 gene (previously called 22K) (Collins et al., 1987, incoφorated herein by reference).
The disclosure of Stec et al., supra, confirms the presence of a number of short segments in the L proteins of heterologous negative stranded RNA viruses that are
almost exactly conserved between different taxa. These nearly identical segments are also shown to be conserved in the RSV L protein, and reside within the highly conserved region shown in Fig. 4 of Stec et al. (incoφorated herein by reference, see boxed sequences). The amino acid identity within these six segments varies from 30 to 80% among the seven proteins. Numerous residues within the identified segments are invariant among the seven different negative stranded RNA viruses for which the alignment was conducted. Moreover, it is noteworthy that where substitutions have occurred in these conserved segments, many are marked by conservative substitutions. As noted previously, the high degree of identity of these segments among each member of two virus families suggests that they are important for L protein functions.
In more specific detail, the most highly conserved region ofthe L proteins aligned between divergent taxa within the Mononegavirales in Fig. 4 of Stec et al., also contains four distinct polymerase motifs (underlined and designated A-D) consistent with the motifs identified by Poch et al., (1989), supra. These regions homologous to the four polymerase motifs were identified in the RSV L protein between amino acids 696 to 887. Three ofthe four elements (A-C) coincide with the highly conserved segments ofthe paramyxovirus and rhabdovirus L proteins described above. The D segment was less well conserved among these viruses but does contain a single invariant lysine and a conserved glycine (in RSV, K-886 and G-877, respectively) that typifies this element. Similarly detailed sequence alignments and analyses have been published for other proteins shared among the negative stranded RNA viruses and useful as target proteins within the instant invention. In this regard, Barr et al., J. Gen. Virol. 72:677-685 (1991), incoφorated herein by reference, analyzed sequence conservation in the N protein among heterologous members ofthe Mononegavirales. In particular, this study showed a high level of amino acid identity (60%) between the predicted amino acid sequences of RSV and PVM N proteins (see Fig. 7, incoφorated herein by reference). Amino acid residues 1 to 150 and 150 to 393 contain 38% and 74% identity respectively, whereas residues 245 to 315 contain 68 identical amino acids out of 71 (96% identity). This high degree of conservation of these proteins is consistent with observations that the N proteins of RSV and PVM are serologically related (Gimenez et al., 1984; Ling & Pringle, 1989).
Computer matrix comparisons ofthe amino acid sequences ofthe N proteins of PVM and more divergent members ofthe Mononegavirales also reveal regions of conservation (Barr et al., supra, Fig. 5). Sequence conservation in this context
extends as far as between the N proteins of PVM and Ebola virus. Furthermore, hydropathy profiles of N proteins from members of widely diverse groups of non- segmented negative-strand viruses resemble each other in the region of greatest sequence similarity between paramyxovirus and Morbilliviruses (Galinski et al., 1985, incoφorated herein by reference). Approximately 180 amino acids, commencing 130 to 170 residues from the amino terminus of each protein form alternating hydrophobic and hydrophilic regions. Secondary structure predictions for these amino acid sequencers (Gamier et al., 1978, incoφorated herein by reference) suggest that this region of conserved hydropathy may commence with a high proportion of α -helix but that it terminates with a high proportion of β-sheet and reverse turn. These data suggest that these conserved proteins may have a similar folded structure over the region of similar hydropathy.
Further alignment studies of representative N proteins focusing on the region of conserved hydropathy using the well known program CLUSTAL (Higging & Shaφ, Gene 33:237-244 (1988), incoφorated herein by reference) point to yet additional conserved protein domains, structural motifs and isolated, conserved amino acid residues (see, Barr et al., Fig. 7, boxes A, B, and C). From this study, it was found that conservation among the SeV, VSV and PVM N proteins is particularly high in a defined region within the carboxy -terminal half of the PVM sequence (Fig. 7, box C). This region was also identified in DIAGON comparisons between Ebola virus and PVM with a window smaller than 99. Two short regions of similarity were also been detected within the sequences, each composed of hydrophobic regions interrupted by a single, conserved, basic amino acid (K or R: boxes A and B in Fig. 7). Corresponding regions are similarly spaced in other paramyxovirus and rhabdovirus N proteins. The levels of identity in these regions are described in Table 1 of Barr et al. Although the highest proportions of identities are seen within a virus family, high levels of similarity are demonstrable in these regions between virus families, particularly when conservative substitutions are taken into account.
Also facilitating practice ofthe invention are independent published alignments confirming the high degree of molecular conservation of N proteins between heterologous members ofthe Mononegavirales. For example, Parks et al., Virus Res. 22:259-279, (1992), incoφorated herein by reference, describe computer-assisted alignment of amino acid sequences of N proteins from 10 different paramyxoviruses. As shown in Fig. 3 ofthe reference, a distinct region near the middle of the N protein (SV5 residues 323-340) contains a large stretch of sequence conservation among N proteins of
different taxa, including an invariant hydrophobic motif F-X^Y -S-Y-A-M-G (where X is any residue). A second highly conserved domain, which is enriched in the negatively charged amino acids glutamate and aspartate, was identified in the C-terminal region ofthe N proteins (SN5 residues 455-469). In another study of Ν protein molecular conservation, Miyahara et al.,
Arch. Virol. 124:255-268 (1992), incoφorated herein by reference, compared the amino acid sequence ofthe HPIV-1 Ν protein with corresponding sequences of 12 other paramyxoviruses, HPIV-2 (Yuasa et al., Virology 179:777-784 (1990)); HPIV3 (Galinski et al., Virology 149:139-151 (1986)), HPIV-4A and -4B (Kondo et al.. Virology 174:1-8 (1990)), SV5 and SV41 (Tsurudome et al., J. Gen. Virol. 72:2289-2292 (1991)), MuV (Elango, Virus Res. 12:77-86 (1989)), SeV (Morgan et al., Virology 135:279-287 (1984)), PIV-3 (Sakai et al., Nucleic Acids Res. &:2927-2944 (1987)), NDV (Ishida et al., Nucleic Acids Res. 14:6551-6564 (1986)), MeV, and (CDV) (Rozenblatt et al., J. Virol. 53:684-690 (1985)) (each ofthe foregoing references incoφorated herein by reference.
As shown in Fig. 3 of Miyahara et al., the N gene of HPIVl shows extensive homology with SeV; the nucleotide and amino acid identities were 70.8% and 87.8%o, respectively. The N protein of HPIV-1 also showed high amino acid identities with HPIV-3 (63.1%) and BPIV-3 (63.3%), and lesser identities to NDV (20.9%), MeV (20.5%), CDV (19.6%), SV41 (18.6%), SV5 (17.9%), HPIV-4A (17.9%), HPIV-4B
(17.5%), HPIV-2 (17.5%) and MuV (17.1%). A protease-sensitive "binge" was found at the junction of two defined domains ofthe SeV K protein; (1) an amino-terminal domain which interacts directly with the RNA, and (2) a carboxyl-terminal domain which lies on the surface ofthe assembled nucleocapsid (Heggeness et al.. Virology 114:555-562 (1981), incoφorated herein by reference)
As further described in Miyahara et al., twenty-six amino acids were conserved in all the paramyxovirus N proteins, and a conserved N domain was identified in the N protein between amino acids 260-360. In addition, thirty-seven out of 40 glycines and 13 out of 13 prolines were conserved in the N proteins of HPIV-1 and SV, suggesting that these proteins SeV maintain a common tertiary structure.
Miyahara also compared M protein sequences between the HPIV-1 M protein and 13 other paramyxoviruses (see, eg., Fig. 4 of Miyahara et al.). These heterologous viruses also exhibited a high degree of structural conservation of M protein sequence elements. For example, HPIV-1 and SeV showed levels of nucleotide and
amino acid identity for M of 72.6% and 88.4%, respectively. HPIV-1 also showed high levels of conservation with HPIV-3 (65.7%) and BPIV-3 (65.4%), and moderate conservation with MeV (36.4%), CDV (34.6%) and RPV (36.7%). All of 5 cysteines, 20 and 22 prolines and 24 of 25 glycines of HPIV-1 were conserved in SeV, almost all of which were also conserved in PIV-3. These finding indicate that a tertiary structure of M protein may be conserved in HPIV-1, SeV, HPIV-3 and BPIV-3. In addition, fourteen amino acids were conserved in all the paramyxovirus M proteins compared.
Additional sequence alignments and analyses have been published for the P protein that is also universally conserved among the Mononegavirales and is thus a particularly useful target for heterologous transfer of mutations within the invention. See, eg., Kondo et al., Virology 178:321-326 (1990), incoφorated herein by reference. In this context, it is noted that the P proteins of SeV (Giorgi et al., CeU 35:82-836 (1983); Neubert, Nucleic Acids Res. 17: 10-101 (1989), incoφorated herein by reference) and PIV3 (Luk et al., Virology 153:318-325 (1986), incoφorated herein by reference) are closely similar in size, composed of 568 and 603 amino acids, respectively. Among different taxa, eg., MuV, SV5, PIV-2 and NDV, the P gene encodes proteins containing 391, 392, 395 and 395 amino acids, respectively (Takeuchi et al., J. Gen. Virol. 69:2043- 2049 (1988); Thomas et al., CeU 54:891-902 (1988); and Sato et al., Virus Res. 7:241-255 (1987)). The P proteins of MeV and CDV are intermediate in size (Barret et al., Virus Res. 3:367-372 (1985; Bellini et al, J. Virol. 53:908-919 (1985).
The P-specific regions of all the heterologous viruses compared by Kondo et al., Virology 178:321-326 (1990) could be aligned according to the conventional methods employed (incoφorated herein by reference). Distinct conservative structural elements were identified between PIV-4A, PIV-4B, SV5, PIV-2, MuV, NDV, MeV, CDV, PIV-3 and SeV (see Fig. 2 ofthe Kondo paper, incoφorated herein by reference). Thus, this study and other published studies of P protein molecular phylogeny identify yet additional conserved protein domains, structural motifs, amino acid segments and isolated residues for alignment with sites of mutation to evaluate targets for incoφoration of attenuating mutations from heterologous, mutant viruses into recombinant vaccine strains. Further sequence alignments and analyses are also provided which facilitate practice ofthe invention applied to the full range of proteins represented within the Mononegavirales. Briefly, Yuasa et al., Virology 179:777-784, (1990), incoφorated herein by reference, identifies conserved structural elements in the 3 ' gene end and N gene of human and non-human parainfluenza viruses, PIV-4A, PIV-4B, MuV, NDV,
MeV, PIV-3, BPIV-3, SeV, and RSV (see, eg., Figs. 2 and 4). Kawano et al., Virology 174:308-313 (1990) provides an exemplary alignment and molecular analysis of HN proteins for eight heterologous paramyxoviruses (see, eg., Fig. 2). tsurudome et al., J. Gen. Virol. 72:2289-2292 (1991) provides an exemplary alignment and analysis for the N protein of HPIV-2, SV5, and SV41 (see, eg., Fig. 3). Spriggs et al., 1986, Virology 152:241-251 (1986) identifies structurally conserved elements in the F protein among heterologous paramyxoviruses, including RSV. Higuchi et al., J. Gen. Virol. 73:1005- 1010 (1992) (see, eg., Fig. 4), Kawano et al. Nuc. Acids. Res. 19(10V2739-2746 (1991) (see, eg., Figs. 2 and 6), Muhlberger et al. Virology 187:534-547 (1992) (see, eg., Figs. 4 and 6), and Ogawa et al., J. Gen. Virol. 73:2743-2750 (1992) (see, eg., Fig. 3) for the L proteins and 3' and 5' non-coding genome ends among a large assemblage of taxa within the Mononegavirales. A more comprehensive review, which includes additional citations of references detailing molecular conservation among the N, P, C, L, M, HN, F, SH, V, D and additional ORFs and gene products within the Mononegavirales is provided by Collins et al, Fields Virology. Fields et al. eds., 3rd edition, Chapter 41:1205-1241,
Lippincott-Raven, Philadelphia (1996). Each of these studies are incoφorated herein by reference, specifically including their alignments and figures identifying conserved structural elements at defined positions representing target sites for incoφoration of attenuating mutations within recombinant vaccine viruses according to the teachings of the invention.
In more detailed aspects ofthe invention, recombinant negative stranded RNA virus that has been attenuated by transfer of a mutation identified in a heterologous virus is engineered as a chimeric virus, for example a chimeric RSV or PIV virus. Chimeric negative stranded viruses ofthe invention are recombinantly engineered to incoφorate nucleotide sequences from more than one viral strain or subgroup to produce an infectious, chimeric virus or subviral particle. In this manner, candidate vaccine viruses are recombinantly engineered to elicit an immune response in a mammalian host, including humans and non-human primates. Chimeric viruses according to the invention may elicit an immune response to a specific viral subgroup or strain, or they may elicit a polyspecific response against multiple viral subgroups or strains.
In exemplary embodiments, chimeric virus incoφorating an attenuating mutation as described above may also have heterologous genes or gene segments of a heterologous virus added to or incoφorated within the recombinant genome or antigenome ofthe subject virus, for example by substituting counteφart sequence(s) from
a heterologous RSV to produce a chimeric RSV genome or antigenome. A chimeric virus ofthe invention thus includes a partial or complete "recipient" viral genome or antigenome from one viral strain or subgroup virus combined with an additional or replacement "donor" gene or gene segment of a different viral strain or subgroup. In preferred aspects ofthe invention, the chimeric attenuated virus is an
RSV comprised of a partial or complete human RSV A or B subgroup genome or antigenome combined with a heterologous gene or gene segment from a different human RSV A or B subgroup virus. To generate this recombinant virus, heterologous donor genes or gene segments from one RSV strain or subgroup is/are combined with or substituted within a recipient genome or antigenome that serves as a backbone for insertion or addition ofthe donor gene or gene segment. Thus, the recipient genome or antigenome acts as a vector to import and express heterologous genes or gene segments to yield chimeric RSV that exhibit novel structural and/or phenotypic characteristics. Preferably, addition or substitution of a heterologous gene or gene segment within a selected recipient RSV strain yields novel phenotypic effects, for example attenuation, growth changes, altered immunogenicity, or other desired phenotypic changes, as compared with corresponding phenotypes ofthe unmodified recipient and/or donor.
Exemplary, attenuated chimeric RSV have been developed and characterized which incoφorate both human RSV B subgroup glycoprotein genes F and G substituted to replace counteφart F and G glycoprotein genes within an RSV A genome. This exemplary chimera has been further modified to incoφorate attenuating point mutations selected from (i) a panel of mutations specifying temperature-sensitive amino acid substitutions Gln83ι to Leu, and Tyr.3 ι to Asn; (ii) a temperature-sensitive nucleotide substitution in the gene-start sequence of gene M2; and (iii) an attenuating panel of mutations adopted from cold-passaged RSV specifying amino acid substitutions Val267 He in the RSV N gene, and Cys319 to Tyr and His.69o Tyr in the RSV polymerase gene L; or (iv) a deletion ofthe SH gene (see, e.g., U.S. Patent Application 09/291,894). Preferably, these and other examples of chimeric viruses incoφorate at least two attenuating mutations which may be derived from the same or different mutant viruses. Exemplary, attenuated chimeric PIV have also been developed and characterized which incorporate heterologous sequences from HPIV-1 and HPIV-3, as well as attenuating mutations adopted from the PIV3 mutant, cp45, as described in U.S. Serial No. 09/083,793, filed May 22, 1998 (corresponding to International Publication No. WO 98/53078) and its priority, provisional application filed May 23, 1997, Serial No.
60/047,575, each incoφorated herein by reference. More recently, all ofthe attenuating mutations identified in cp45, with the exception of those in the F protein, have been successfully incoφorated in an attenuated, recombinant HPIV3-1 chimera.
The introduction of heterologous immunogenic proteins, domains and epitopes to produce chimeric negative stranded RNA viruses is particularly useful to generate novel immune responses in an immunized host. Addition or substitution of an immunogenic gene or gene segment from one donor virus subgroup or strain within a recipient genome or antigenome of a different viral subgroup or strain can generate an immune response directed against the donor subgroup or strain, the recipient subgroup or strain, or against both the donor and recipient subgroup or strain. To achieve this puφose, chimeric viruses may also be constructed that express a chimeric protein, e.g., an immunogenic protein having a cytoplasmic tail and/or transmembrane domain specific to one viral strain or subgroup fused to an ectodomain of a different virus. Other exemplary recombinants of this type may express duplicate protein regions, such as duplicate immunogenic regions.
Although it is often useful to add or substitute entire genes (including cis- acting elements and coding regions) within a chimeric genome or antigenome, it is also useful to transfer only a portion of a donor gene of interest. Quite commonly, non-coding nucleotides such as cis-acting regulatory elements and intergenic sequences need not be transferred with the donor gene coding region. In addition, a variety of gene segments provide useful donor polynucleotides for inclusion within a chimeric genome or antigenome to express chimeric virus having novel and useful properties. Thus, heterologous gene segments may beneficially encode a cytoplasmic tail, transmembrane domain or ectodomain, an epitopic site or region, a binding site or region, an active site or region containing an active site, etc., of a selected protein from one virus. These and other gene segments can be added or substituted for a counteφart gene segment(s) in another virus to yield novel chimeric recombinants, for example recombinants expressing a chimeric protein having a cytoplasmic tail and/or transmembrane domain of one virus glycoprotein fused to an ectodomain of a glycoprotein of another virus. Useful genome segments in this regard range from about 15-35 nucleotides in the case of gene segments encoding small functional domains of proteins, e.g., epitopic sites, to about 50, 75, 100, 200-500, and 500-1,500 or more nucleotides for gene segments encoding larger domains or protein regions.
To construct chimeric virus bearing a transferred attenuating mutation, heterologous genes may be added or substituted in whole or in part to a background genome or antigenome to form a chimeric genome or antigenome. The mutation may be present, along with one or more additional mutations, in the heterologous gene (i.e., donor gene) or gene segment or may be introduced within the partial or complete, recipient antigenome or genome "background." In the case of chimeras generated by substitution, a selected protein or protein region (e.g., a cytoplasmic tail, transmembrane domain or ectodomain, an epitopic site or region, a binding site or region, an active site or region containing an active site, etc.) from one virus is substituted for a counteφart gene or gene segment in a different viral genome or antigenome to yield novel recombinants having desired phenotypic changes compared to wild-type or parent strains. As used herein, "counteφart" genes, gene segments, proteins or protein regions refer to two counteφart polynucleotides from a heterologous source, including different genes in a single species or strain, or different variants ofthe same gene, including species and allelic variants among different viral subgroups or strains.
Counteφart genes and gene segments typically share at least moderate structural similarity. For example counteφart gene segments may encode a common structural domain of a protein of interest, such as a cytoplasmic domain, transmembrane domain, ectodomain, binding site or region, epitopic site or region, etc. Typically, they will share a common biological function as well. For example, protein domains encoded by counteφart gene segments may provide a common membrane spanning function, a specific binding activity, an immunological recognition site, etc. Counteφart genes and gene segments for use in constructing attenuated chimeric viruses within the invention embrace an assemblage of alternate species having a range of size and sequence variation. However, selection of counteφart genes and gene segments relies on substantial sequence identity between the subject counteφarts, as defined hereinabove. In this context, a selected polynucleotide reference sequence is as a sequence or portion of a sequence present in either the donor or recipient genome or antigenome. This reference sequence is used as a defined sequence to provide a basis for sequence comparison. For example, the reference sequence may be a defined segment of a cDNA or gene, or a complete cDNA or gene sequence.
Well known cDNA-based methods are useful to construct a large panel of recombinant, chimeric viruses and subviral particles incoφorating attenuating mutations identified in a heterologous virus. These recombinant constructs offer improved
characteristics of attenuation and immunogenicity for use as vaccine agents. Among desired phenotypic changes in this context are resistance to reversion from an attenuated phenotype, improvements in attenuation in culture or in a selected host environment, immunogenic characteristics (e.g., as determined by enhancement, or diminution, of an elicited immune response), upregulation or downregulation of transcription and/or translation of selected viral products, etc.
In additional aspects ofthe invention, attenuated recombinant viruses incoφorating an attenuating mutation identified in a heterologous virus are further modified by introducing one or more additional attenuating mutations that specify an altered attenuating phenotype. These mutations may be generated de novo and tested for attenuating effects according to a rational design mutagenesis strategy. Alternatively, the attenuating point mutations are identified in biologically-derived mutants, e.g., an RSV or PIV ts or cp mutant, and thereafter incoφorated into an attenuated recombinant virus of the invention. The recombinant thus further attenuated may be a chimeric virus. Further attenuating mutations in biologically-derived RSV for incoφoration within a vaccine strain may occur naturally or may be introduced into wild- type strains by well known mutagenesis procedures as described above and in USSN 08/327,263, incoφorated herein by reference.
By "biologically-derived" mutant virus is meant any mutant virus not produced by recombinant means. Thus, biologically-derived mutant viruses may be of any negative stranded RNA viral species, subgroup or strain, e.g., naturally occurring RSV or PIV having a mutant genomic sequence or RSV or PIV having genomic variations from a reference wild-type sequence, e.g., having a mutation specifying an attenuated phenotype. Likewise, biologically-derived viruses include mutants derived from a parental strain by, inter alia, artificial mutagenesis and selection procedures.
Further attenuating mutations identified as described above are compiled into a "menu" and are then introduced as desired, singly or in combination, to adjust a candidate vaccine virus to an appropriate level of attenuation, immunogenicity, genetic resistance to reversion from an attenuated phenotype, etc., as desired. Preferably, recombinant mutant viruses ofthe invention are attenuated by incoφoration of at least one, and, more preferably, two or more attenuating point mutations identified from such a menu, for example a panel of RSV mutants such as cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC
VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579). Additional mutations may be incoφorated from conspecific or heterologous viruses, including viruses having ts, cp, or non-ts or non-ςp attenuating mutations as identified, e.g., in small plaque (sp), cold-adapted (ca) or host-range restricted (hr) mutant strains. Attenuating mutations may be selected in coding portions of genes or in non-coding regions such as a cis-regulatory sequence. For example, attenuating mutations may include single or multiple base changes in a gene start sequence, as exemplified by a single base substitution in the RSV M2 gene start sequence at nucleotide 7605. In this manner, attenuation of recombinant vaccine candidates can be finely calibrated for use in one or more classes of patients, including seronegative infants. The capability of producing virus from cDNA allows for routine incoφoration of these mutations, individually or in various selected combinations, into a full-length cDNA clone, whereafter the phenotypes of rescued recombinant viruses containing the introduced mutations can be readily determined. By identifying and incoφorating specific attenuating mutations associated with desired phenotypes, e.g., a cp or ts phenotype, into infectious recombinant viral clones, the invention provides for other, site-specific modifications at, or within close proximity to, the identified mutation. Whereas most attenuating mutations produced in biologically-derived viruses are single amino acid substitutions, other "site specific" mutations can also be incoφorated by recombinant techniques into recombinant viruses ofthe invention. As used herein, site-specific mutations include insertions, substitutions, deletions or rearrangements of from 1 to 3, up to about 5-15 or more altered nucleotides (e.g., altered from a wild-type sequence, from a sequence of a selected mutant strain, or from a parent recombinant clone subjected to mutagenesis). Such site-specific mutations may be incoφorated at, or within the region of, a selected attenuating mutation.
Alternatively, the mutations can be introduced in various other contexts within a viral clone, for example at or near a cis-acting regulatory sequence or nucleotide sequence encoding a protein active site, binding site, immunogenic epitope, etc. Site-specific viral mutants typically retain a desired attenuating phenotype, but may exhibit substantially altered phenotypic characteristics unrelated to attenuation, e.g., enhanced or broadened immunogenicity, or improved growth. Further examples of desired, site-specific mutants include recombinant viruses that incoφorate additional, stabilizing nucleotide mutations in a codon specifying an attenuating mutation. Where possible, two or more nucleotide substitutions are introduced at codons that specify attenuating amino acid changes in a
parent mutant or recombinant clone, yielding a recombinant having genetic resistance to reversion from an attenuated phenotype. In other embodiments, site-specific nucleotide substitutions, additions, deletions or rearrangements are introduced upstream (N-terminal direction with regard to the encoded viral proteins) or downstream (C-terminal direction), e.g, from 1 to 3, 5-10 and up to 15 nucleotides or more 5' or 3', relative to a targeted nucleotide position, e.g., to construct or ablate an existing cis-acting regulatory element.
In addition to single and multiple point mutations and site-specific mutations, changes to attenuated recombinant viruses ofthe invention include deletions, insertions, substitutions or rearrangements of whole genes or gene segments. These mutations may alter small numbers of bases (e.g., from 15-30 bases, up to 35-50 bases or more), or large blocks of nucleotides (e.g., 50-100, 100-300, 300-500, 500-1,000 bases) in the donor or recipient genome or antigenome, depending upon the nature ofthe change (i.e., a small number of bases may be changed to insert or ablate an immunogenic epitope or change a small gene segment, whereas large block(s) of bases are involved when genes or large gene segments are added, substituted, deleted or rearranged.
In additional aspects, the invention provides for supplementation of mutations adopted into a recombinant negative stranded viral CDNA from heterologous viruses, e.g., cp and ts mutations, with additional types of mutations involving the same or different genes in a further modified recombinant virus. In this regard, viral proteins can be selectively altered in terms of expression levels, or can be added, deleted, substituted or rearranged, in whole or in part, alone or in combination with other desired modifications, to yield a recombinant, attenuated virus with additional novel vaccine characteristics.
Thus, in addition to, or in combination with, attenuating mutations adopted from a heterologous viral mutant, the present invention also provides a range of additional methods for attenuating and otherwise modifying recombinant vaccine candidates based on recombinant engineering. In accordance with this aspect ofthe invention, a variety of alterations can be produced in an isolated polynucleotide sequence encoding the recombinant genome or antigenome. More specifically, to achieve desired structural and phenotypic changes in recombinant PIV, the invention allows for introduction of modifications which delete, substitute, introduce, or rearrange a selected nucleotide or plurality of nucleotides from a parent genome or antigenome, as well as mutations which delete, substitute, introduce or rearrange whole gene(s) or gene segment(s), within a parent genome or antigenome.
Desired modifications of attenuated recombinant virues are typically selected to specify a desired phenotypic change, e.g., a change in viral growth, temperature sensitivity, ability to elicit a host immune response, attenuation, etc. These changes can be brought about either in a donor or recipient genome or antigenome by, e.g., mutagenesis of a parent clone to ablate, introduce or rearrange a specific gene(s) or gene region(s) (e.g., a gene segment that encodes a protein structural domain, such as a cytoplasmic, transmembrane or extracellular domain, an immunogenic epitope, binding region, active site, etc.). Genes of interest in this regard include any viral gene, e.g., 3'- NS1-NS2-N-P-M-SH-G-F-M2-L-5' in the case of RSV, as well as heterologous genes from other viruses.
Also provided are modifications in a recombinant vaccine candidate which alter or ablate expression of a selected gene, e.g., by introducing a termination codon within a selected RSV coding sequence, changing the position of a gene relative to an operably linked promoter, introducing an upstream start codon to alter rates of expression, modifying (e.g., by changing position, altering an existing sequence, or substituting an existing sequence with a heterologous sequence) transcription signals to alter phenotype (e.g., growth, temperature restrictions on transcription, etc.), and various other deletions, substitutions, additions and rearrangements that specify quantitative or qualitative changes in viral replication, transcription of selected gene(s), or translation of selected protein(s).
The ability to analyze and incoφorate other types of attenuating mutations into recombinant vaccine candidates extends to a broad assemblage of targeted changes in recombinant clones. For example, deletion ofthe SH gene in RSV yields a recombinant RSV having novel phenotypic characteristics, including enhanced growth. Thus, in recombinant RSV ofthe invention an SH gene deletion (or any other non-essential gene or gene segment deletion), is combined in a recombinant virus with one or more additional mutations specifying an attenuated phenotype, e.g., one or more point mutation(s) adopted from a heterologous virus optionally supplemented by one or more further attenuating mutations adopted from a biologically-derived attenuated mutant. In certain embodiments, the SH gene or NS2 gene of RSV is deleted in combination with one or more cp and/or ts mutations adopted from cpts248/404, cpts530/1009, cpts530/1030, or another selected mutant RSV strain, to yield a recombinant RSV having increased yield of virus, enhanced attenuation, and resistance to phenotypic reversion, due to the combined effects ofthe different mutations.
In the case of one exemplary SH-minus RSV clone, the modified viral genome is 14,825 nt long, 398 nucleotides less than wild-type. By engineering similar mutations that decrease genome size, e.g., in other coding or noncoding regions elsewhere in the RSV genome, such as in the P, M, F and M2 genes, the invention provides several readily obtainable methods and materials for improving chimeric RSV growth.
In addition, a variety of other genetic alterations can be produced in a recombinant genome or antigenome for incoφoration into infectious viruses attenuated in accordance with the methods ofthe invention. Additional heterologous genes or gene segments (e.g. from different viral genes, or different viral strains or types) may be inserted in whole or in part, the order of genes changed, gene overlap removed, a genome promoter replaced with its antigenome counteφart, portions of genes removed or substituted, and even entire genes deleted. Different or additional modifications in the sequence can be made to facilitate manipulations, such as the insertion of unique restriction sites in various intergenic regions or elsewhere. Nontranslated gene sequences can be removed to increase capacity for inserting foreign sequences.
Also provided within the invention are genetic modifications in an attenuated recombinant vaccine candidate virus which alter or ablate the expression of a selected gene or gene segment without removing the gene or gene segment from the recombinant clone. For example, this can be achieved by introducing a termination codon within a selected coding sequence, changing the position of a gene or introducing an upstream start codon to alter its rate of expression, or changing transcription signals to alter phenotype (e.g., growth, temperature restrictions on transcription, etc.).
Preferred mutations in this context include mutations directed toward cis- acting signals, which can be identified, e.g., by mutational analysis of viral minigenomes. For example, insertional and deletional analysis ofthe leader and trailer and flanking sequences identified viral promoters and transcription signals and provided a series of mutations associated with varying degrees of reduction of RNA replication or transcription. Saturation mutagenesis (whereby each position in turn is modified to each ofthe nucleotide alternatives) of these cis-acting signals also has identified many mutations which reduced (or in two cases increased) RNA replication or transcription. Any of these mutations can be inserted into a recombinant antigenome or genome as described herein.
Evaluation and manipulation of trans-acting proteins and cis-acting RNA sequences using the complete antigenome cDNA is assisted by the use of viral
minigenomes (see, e.g., Grosfeld et al., J. Virol. 69: 5677-5686 (1995), incoφorated herein by reference), whose helper-dependent status is useful in the characterization of those mutants which are too inhibitory to be recovered in replication-independent infectious virus. Other mutations within recombinant viruses ofthe present invention involve replacement ofthe 3' end ofthe genome with its counteφart from the antigenome, which is associated with changes in RNA replication and transcription. In addition, the intergenic regions (Collins et al., Proc. Natl. Acad. Sci. USA 83:4594-4598 (1986), incoφorated herein by reference) can be shortened or lengthened or changed in sequence content, and the naturally-occurring gene overlap (Collins et al., Proc. Natl.
Acad. Sci. USA 84:5134-5138 (1987), incoφorated herein by reference) can be removed or changed to a different intergenic region by the methods described herein.
In one exemplary embodiment, the level of expression of specific proteins, such as the RSN protective F and G antigens, can be increased by substituting the natural codon usage with one which has been designed to be consistent with efficient translation and assembled into synthetic CDΝA. In this context, it has been shown that codon usage can be a major factor in the level of translation of mammalian viral proteins (Haas et al., Current Biol. 6:315-324 (1996)). Examination ofthe codon usage ofthe mRΝAs encoding the F and G proteins of RSV, which are the major protective antigens, shows that the usage is consistent with poor expression. Thus, codon usage can be improved by the recombinant methods ofthe invention to achieve improved expression for selected genes.
In another exemplary embodiment, a sequence surrounding a translational start site (preferably including a nucleotide in the -3 position) of a selected viral gene is modified, alone or in combination with introduction of an upstream start codon, to modulate gene expression ofthe attenuated recombinant virus by specifying up- or down- regulation of translation.
In more specific embodiments, attenuated RSV gene expression can be modulated by altering a transcriptional GS signal of a selected gene(s) ofthe virus. In one exemplary embodiment, the GS signal of ΝS2 is modified to include a defined mutation (e.g., the 404(M2) mutation described hereinbelow) to superimpose a ts restriction on viral replication. Yet additional attenuated RSV clones can incoφorate modifications to a transcriptional GE signal. For example, RSV clones may be generated which have a substituted or mutated GE signal ofthe NS1 and NS2 genes for that ofthe
N gene, resulting in decreased levels of readthrough mRNAs and increased expression of proteins from downstream genes. The resulting recombinant virus will exhibit increased growth kinetics and increased plaque size, providing but one example of alteration of RSV growth properties by modification of a cis-acting regulatory element in the RSV genome.
In another example, specific expression ofthe G protein of an attenuated recombinant RSV is increased by modification ofthe G mRNA. The G protein is expressed as both a membrane bound and a secreted form, the latter form being expressed by translational initiation at a start site within the G translational open reading frame. The secreted form can account for as much as one-half of the expressed G protein. Ablation ofthe internal start site (e.g., by sequence alteration, deletion, etc.), alone or together with altering the sequence context ofthe upstream start site yields desired changes in G protein expression. Ablation ofthe secreted form of G also will improve the quality ofthe host immune response to exemplary, chimeric RSV, because the soluble form of G is thought to act as a "decoy" to trap neutralizing antibodies. Also, soluble G protein has been implicated in enhanced immunopathology due to its preferential stimulation of a Th2- biased response.
In alternative embodiments, levels of attenuated recombinant viral gene expression are modified at the level of transcription. In one aspect, the position of a selected gene in the RSV gene map can be changed to a more promoter-proximal or promotor-distal position, whereby the gene will be expressed more or less efficiently, respectively. According to this aspect, modulation of expression for specific genes can be achieved yielding reductions or increases of gene expression from two-fold, more typically four-fold, up to ten-fold or more compared to wild-type levels. In one example, the NS2 gene of RSV (second in order in the RSV gene map) is substituted in position for the SH gene (sixth in order), yielding a predicted decrease in expression of NS2. Increased expression of selected RSV genes due to positional changes can be achieved up to 10-fold or more, often attended by a commensurate decrease in expression levels for reciprocally, positionally substituted genes. In other exemplary embodiments, viral genes may be transpositioned singly or together to a more promoter-proximal or promoter-distal site within the recombinant viral gene map to achieve higher or lower levels of gene expression, respectively. These and other transpositioning changes yield novel clones having
attenuated phenotypes, for example due to decreased expression of selected viral proteins involved in RNA replication.
In more detailed aspects ofthe invention, attenuated recombinant viruses are further modified by ablating expression of a viral gene, for example the NS2 gene of RSV, at the translational level without deletion ofthe gene or of a segment thereof, by, e.g., introducing two tandem translational termination codons into a translational open reading frame (ORF). This yields viable virus in which a selected gene has been silenced at the level of translation, without deleting its gene. These forms of "knock-out" virus can exhibit reduced growth rates and small plaque sizes in tissue culture. Thus, the methods and compositions ofthe invention provide yet additional, novel types of attenuating mutations which ablate expression of a viral gene that is not one ofthe major viral protective antigens or essential for viral growth. In this context "knockout" virus phenotypes produced without deletion of a gene or gene segment can be alternatively produced by deletion mutagenesis, as described herein, to effectively preclude correcting mutations that may restore synthesis of a target protein. Methods for producing these and other knock-outs are well known in the art (as described, for example, in Kretzschmar et al.. Virology 216:309-316 (1996); Radecke et al.. Virology 217:418-412 (1996); and Kato et al.. EMBO J. 16:178-587 (1987); and Schneider et al., Virology 277:314-322 (1996), each incoφorated herein by reference). Infectious recombinant viral clones ofthe invention can also be engineered according to the methods and compositions disclosed herein to enhance immunogenicity and induce a level of protection greater than that provided by infection with a wild-type or parent recombinant virus. For example, an immunogenic epitope from a heterologous viral strain or type, e.g., PIV, can be added to a recombinant clone, e.g., RSV, by appropriate nucleotide changes in the polynucleotide sequence encoding the chimeric genome or antigenome. Alternatively, viruses can be engineered to add or ablate (e.g., by amino acid insertion, substitution or deletion) immunogenic epitopes associated with desirable or undesirable immunological reactions.
Within the methods ofthe invention, additional genes or gene segments may be inserted into or proximate to a recipient genome or antigenome. These genes may be under common control with recipient genes, or may be under the control of an independent set of transcription signals. Genes of interest include those encoding cytokines (e.g., IL-2 through IL-15, especially IL-2, IL-6 and IL-12, etc.), gamma- interferon, and proteins rich in T helper cell epitopes. These additional proteins can be
expressed either as a separate protein, or as a chimera engineered from a second copy of one ofthe viral proteins, such as SH. This provides the ability to modify and improve the immune responses against the virus both quantitatively and qualitatively.
In exemplary embodiments ofthe invention, insertion of foreign genes or gene segments, and in some cases of noncoding nucleotide sequences, within a recombinant viral genome results in a desired increase in genome length causing yet additional, desired phenotypic effects. Increased genome length results in attenuation of the resultant virus, dependent in part upon the length ofthe insert. In addition, the expression of certain proteins, e.g. a cytokine, from a heterologous source into recombinant attenuated viruses ofthe invention will result in further attenuation ofthe virus due to the action ofthe protein. This has been described for IL-2 expressed in vaccinia virus (e.g. Flexner et al., Nature 33:-259-62 (1987)) and is also expected for gamma interferon.
Deletions, insertions, substitutions and other mutations involving changes of whole viral genes or gene segments within recombinant viruses ofthe invention yield highly stable vaccine candidates, which are particularly important in the case of immunosuppressed individuals. Many of these changes will result in attenuation of resultant vaccine strains, whereas others will specify different types of desired phenotypic changes. For example, certain viral genes are known which encode proteins that specifically interfere with host immunity (see, e.g., Kato et al., EMBO. J. 16:578-87
(1997), incoφorated herein by reference). Ablation of such genes in recombinant vaccine viruses is expected to reduce virulence and pathogenesis and/or improve immunogenicity.
Additional mutations to further attenuate recombinant viruses ofthe invention include introduction of heterologous genes or cis-acting elements that confer host range restriction and other desired phenotypes favorable for vaccine use. In exemplary embodiments, bovine RSV sequences are selected for introduction into human RSV based on known aspects of bovine RSV structure and function, as provided in, e.g., Pastey et al., J. Gen. Virol. 76:193-197 (1993); Pastey et al., Virus Res. 29:195-202 (1993); Zamora et al, J. Gen. Virol. 73:737-741 (1992); Mallipeddi et al, J. Gen. Virol. 74:2001-2004 (1993); Mallipeddi et al., J. Gen. Virol. 73:2441-2444 (1992); and Zamora et al., Virus Res. 24:115-121 (1992), each incoφorated herein by reference, and in accordance with the teachings disclosed herein. In other embodiments ofthe invention, mutations of interest for introduction within chimeric RSV are modeled after a tissue culture-adapted nonpathogenic strain of pneumonia virus of mice (the murine counteφart
of human RSV) which lacks a cytoplasmic tail ofthe G protein (Randhawa et al., Virology 207:240-245 (1995)). Accordingly, in one aspect ofthe invention the cytoplasmic and/or transmembrane domains of one or more ofthe human RSV glycoproteins, F, G and SH, are added, deleted, modified, or substituted within an attenuated recombinant RSV using a heterologous counteφart sequence (e.g., a sequence from a cytoplasmic, or transmembrane domain of a F, G, or SH protein of murine pneumonia virus) to achieve a desired attenuation. As another example, a nucleotide sequence at or near the cleavage site ofthe F protein, or the putative attachment domain ofthe G protein, can be modified by point mutations, site-specific changes, or by alterations involving entire genes or gene segments to achieve novel effects on viral growth in tissue culture and/or infection and pathogenesis.
In addition to the above described modifications to recombinant vaccine viruses, different or additional modifications in viral clones can be made to facilitate manipulations, such as the insertion of unique restriction sites in various intergenic regions or elsewhere. Nontranslated gene sequences can be removed to increase capacity for inserting foreign sequences.
In another aspect ofthe invention, compositions (e.g., isolated polynucleotides and vectors comprising a recombinant negative stranded RNA viral genome incoφorating a mutation identified in a heterologous virus) are provided for producing an isolated attenuated infectious virus. Using these compositions and methods, infectious viruses and subviral particles are generated from a recombinant genome or antigenome and selected viral proteins, e.g., a nucleocapsid (N) protein, a nucleocapsid phosphoprotein (P), a large (L) polymerase protein, and an RNA polymerase elongation factor in the case of RSV. In related aspects ofthe invention, compositions and methods are provided for introducing the aforementioned structural and phenotypic changes into a recombinant virus to yield infectious, attenuated vaccine viruses.
Introduction ofthe foregoing defined mutations into an infectious, recombinant virus are achieved by a variety of well known methods as referenced above. By "infectious clone" is meant cDNA or its product, synthetic or otherwise, which can be transcribed into genomic or antigenomic RNA capable of serving as template to produce an infectious virus or subviral particle. Thus, defined mutations can be introduced by conventional techniques (e.g., site-directed mutagenesis) into a cPNA copy ofthe genome or antigenome. The use of antigenome or genome cPNA subfragments to assemble a complete antigenome or genome cPNA as described herein has the advantage
that each region can be manipulated separately (smaller cPNAs are easier to manipulate than large ones) and then readily assembled into a complete cPNA. Thus, the complete antigenome or genome cPNA, or any subfragment thereof, can be used as template for oligonucleotide-directed mutagenesis. This can be through the intermediate of a single- stranded phagemid form, such as using the Muta-gene® kit of Bio-Rad Laboratories (Richmond, CA) or a method using a double-stranded plasmid directly as template such as the Chameleon mutagenesis kit of Stratagene (La Jolla, CA), or by the polymerase chain reaction employing either an oligonucleotide primer or template which contains the mutation(s) of interest. A mutated subfragment can then be assembled into the complete antigenome or genome cPNA. A variety of other mutagenesis techniques are known and available for use in producing the mutations of interest in the antigenome or genome cPNA. Mutations can vary from single nucleotide changes to replacement of large cPNA pieces containing one or more genes or genome regions.
Thus, in one illustrative embodiment mutations are introduced by using the Muta-gene phagemid in vitro mutagenesis kit available from Bio-Rad. cPNA encoding a portion of an RSV genome or antigenome is cloned into the plasmid pTZl 8U, and used to transform CJ236 cells (Life Technologies). Phagemid preparations are prepared as recommended by the manufacturer. Oligonucleotides are designed for mutagenesis by introduction of an altered nucleotide at the desired position ofthe genome or antigenome. The plasmid containing the genetically altered genome or antigenome fragment is then amplified and the mutated piece is then reintroduced into the full-length genome or antigenome clone.
The invention also provides methods for producing an attenuated infectious recombinant virus incoφorating a mutation identified in a heterologous virus from one or more isolated polynucleotides, e.g., one or more cPNAs. A cPNA encoding a subject viral genome or antigenome is constructed for intracellular or in vitro coexpression with the necessary viral proteins to form, for example, infectious RSV. By "antigenome" is meant an isolated positive-sense polynucleotide molecule which serves as the template for the synthesis of progeny viral genome. Preferably a cPNA is constructed which is a template for synthesis of a positive-sense version ofthe genome, corresponding to the replicative intermediate RNA, or antigenome, so as to minimize the possibility of hybridizing with positive-sense transcripts ofthe complementing sequences that encode proteins that facilitate generation of a transcribing, replicating nucleocapsid. For puφoses ofthe present invention, the genome or antigenome ofthe recombinant virus
need only contain those genes or portions thereof necessary to render the viral or subviral particles encoded thereby infectious. Further, the genes or portions thereof may be provided by more than one polynucleotide molecule, i.e., a gene may be provided by complementation or the like from a separate nucleotide molecule. By recombinant virus is meant a complete virus or virus-like subviral particle derived directly or indirectly from a recombinant expression system or propagated from virus or subviral particles produced therefrom. The recombinant expression system will employ a recombinant expression vector which comprises an operably linked transcriptional unit comprising an assembly of at least a genetic element or elements having a regulatory role in viral gene expression, for example, a promoter, a structural or coding sequence which is transcribed into viral RNA, and appropriate transcription initiation and termination sequences.
To produce infectious virus from cPNA-expressed genome or antigenome, the genome or antigenome is expressed according to known methods to (i) produce a nucleocapsid capable of RNA replication, and (ii) render progeny nucleocapsids competent for both RNA replication and transcription. Transcription by the genome nucleocapsid provides the other proteins and initiates a productive infection. Alternatively, additional viral proteins essential for a productive infection can be supplied by coexpression. A viral antigenome may be constructed for use in the present invention by, e.g., assembling cloned cPNA segments, representing in aggregate the complete antigenome, by polymerase chain reaction (PCR; described in, e.g., U.S. Patent Nos. 4,683,195 and 4,683,202, and PCR Protocols: A Guide to Methods and Applications. Innis et al., eds., Academic Press, San Piego (1990), incoφorated herein by reference) of reverse-transcribed copies of viral mRNA or genome RNA. For example, cPNAs containing the antigenome or portions thereof are assembled in an appropriate expression vector, such as a plasmid or various available cosmid, phage, or PNA virus vectors. The vector may be modified by mutagenesis and/or insertion of synthetic polylinker containing unique restriction sites designed to facilitate assembly. In some cases, such as RSV, use of a particular vector (pBR322) stabilizes the viral sequence which may otherwise sustain nucleotide deletions or insertions. Likewise, propagation of plasmid may be facilitated by selection of a particular bacterial strain (e.g., PHI 0B) to avoid an artifactual duplication and insertion which otherwise occurs (e.g., in the vicinity of nt 4499 for RSV).
In certain embodiments ofthe invention, complementing sequences encoding proteins necessary to generate a transcribing, replicating viral nucleocapsid are provided by one or more helper viruses. Such helper viruses can be wild-type or mutant. Preferably, the helper virus can be distinguished phenotypically from the virus encoded by the cPNA. For example, it is desirable to provide monoclonal antibodies which react immunologically with the helper virus but not the virus encoded by the cPNA. Such antibodies can be neutralizing antibodies. In some embodiments, the antibodies can be used in affinity chromatography to separate the helper virus from the recombinant virus. To aid the procurement of such antibodies, mutations can be introduced into the cPN A to provide antigenic diversity from the helper virus, such as in the RSV HN or F glycoprotein genes.
A variety of nucleotide insertions and deletions can be made in the viral genome or antigenome to generate a modified, attenuated viral clone. Members ofthe Paramyxovirus and Morbillivirus genera typically abide by a "rule of six," i.e., genomes (or minigenomes) replicate efficiently only when their nucleotide length is a multiple of six (thought to be a requirement for precise spacing of nucleotide residues relative to encapsidating N protein).
Alternative means to construct cPNA encoding a recombinant negative stranded RNA viruses incoφorating a mutation identified in a heterologous virus include by reverse transcription-PCR using improved PCR conditions (e.g., as described in Cheng et al., Proc. Natl. Acad. Sci. USA 91:5695-5699 (1994), incoφorated herein by reference) to reduce the number of subunit cPNA components to as few as one or two pieces. In other embodiments different promoters can be used (e.g., T3, SP6) or different ribozymes (e.g., that of hepatitis delta virus. Pifferent PNA vectors (e.g., cosmids) can be used for propagation to better accommodate the large size genome or antigenome.
Isolated polynucleotides (e.g., cPNA) encoding the viral genome or antigenome and, separately or in cis, the necessary viral proteins, are inserted by transfection, electroporation, mechanical insertion, transduction or the like, into cells which are capable of supporting a productive viral infection, e.g., HEp-2, FRhL-PBS2, MRC, and Vero cells. Transfection of isolated polynucleotide sequences may be introduced into cultured cells by, for example, calcium phosphate-mediated transfection (Wigler et al., C l j_4:725 (1978); Corsaro and Pearson, Somatic Cell Genetics 7:603 (1981); Graham and Van der Eb, Virology 52:456 (1973)), electroporation (Neumann et al., EMBO J. 1:841-845 (1982)), OEAE-dextran mediated transfection (Ausubel et al.,
(ed.) Current Protocols in Molecular Biology, John Wiley and Sons, Inc., NY (1987), cationic lipid-mediated transfection (Hawley-Nelson et al, Focus 15:73-79 (1993)) or a commercially available transfection regent, e.g., LipofectACE® (Life Technologies) (each ofthe foregoing references are incoφorated herein by reference). The viral proteins are encoded by one or more expression vectors which can be the same or separate from that which encodes the genome or antigenome, and various combinations thereof. Additional proteins may be included as desired, encoded by its own vector or by a vector encoding essential viral proteins. Expression ofthe genome or antigenome and proteins from transfected plasmids can be achieved, for example, by each cPNA being under the control of a promoter for T7 RNA polymerase, which in turn is supplied by infection, transfection or transduction with an expression system for the T7 RNA polymerase, e.g., a vaccinia virus MVA strain recombinant which expresses the T7 RNA polymerase (Wyatt et al., Virology, 210:202-205 (1995), incoφorated herein by reference). The viral proteins, and/or T7 RNA polymerase, can also be provided from transformed mammalian cells, or by transfection of preformed mRNA or protein.
Alternatively, synthesis of antigenome or genome can be conducted in vitro (cell-free) in a combined transcription-translation reaction, followed by transfection into cells. Or, antigenome or genome RNA can be synthesized in vitro and transfected into cells expressing viral proteins.
To select candidate vaccine viruses according to the invention, the criteria of viability, attenuation and immunogenicity are determined according to well known methods. Viruses which will be most desired in vaccines ofthe invention must maintain viability, have a stable attenuation phenotype, exhibit replication in an immunized host (albeit at lower levels), and effectively elicit production of an immune response in a vaccinee sufficient to confer protection against serious disease caused by subsequent infection from wild-type virus. In this context, viruses ofthe invention are not only viable and more attenuated then previous mutants, but are more stable genetically in vivo than those previously studied mutants— retaining the ability to stimulate a protective immune response and in some instances to expand the protection afforded by multiple modifications, e.g., induce protection against different viral strains or subgroups, or protection by a different immunologic basis, e.g., secretory versus serum immunoglobulins, cellular immunity, and the like.
To propagate recombinant negative stranded RNA viruses incoφorating a mutation identified in a heterologous virus, a number of cell lines which allow for viral growth may be used. Preferred cell lines for propagating attenuated viruses for vaccine use include OBS-FRhL-2, MRC-5, and Vero cells. Highest RSV yields are usually achieved with epithelial cell lines such as Vero cells. Cells are typically inoculated with virus at a multiplicity of infection ranging from about 0.001 to 1.0 or more, and are cultivated under conditions permissive for replication ofthe virus, e.g., at about 30-37°C and for about 3-5 days, or as long as necessary for virus to reach an adequate titer. Virus is removed from cell culture and separated from cellular components, typically by well known clarification procedures, e.g., centrifugation, and may be further purified as desired using procedures well known to those skilled in the art.
Recombinant virus which has been attenuated as described herein can be tested in various well known and generally accepted in vitro and in vivo models to confirm adequate attenuation, resistance to phenotypic reversion, and immunogenicity for vaccine use. In in vitro assays, the modified virus (e.g., a multiply attenuated, biologically-derived or recombinant virus) is tested for temperature sensitivity of virus replication, i.e. ts phenotype, and for the small plaque phenotype. Modified viruses are further tested in animal models of viral infection. A variety of animal models for RSV have been described and are summarized in Meignier et al., eds., Animal Models of Respiratory Syncytial Virus Infection. Merieux Foundation Publication, (1991), which is incoφorated herein by reference. A cotton rat model of RSV infection is described in U.S. 4,800,078 and Prince et al., Virus Res. 3:193-206 (1985), which are incoφorated herein by reference, and is considered reasonable predictive of attenuation and efficacy in humans and non-human primates. In addition, a primate model of RSV infection using the chimpanzee is reasonably predictive of attenuation and efficacy in humans, as is described in detail in Richardson et al., J. Med. Virol. 3:91-100 (1978); Wright et al., Infect. Immun. 37:397-400 (1982); Crowe et al., Vaccine U:1395-1404 (1993), each incoφorated herein by reference. Other models are known for a wide range of negative stranded RNA viruses. The correlation of data derived from these animal models relating to the level of attenuation and immunogenicity of recombinant negative stranded RNA viruses is generally accepted. For example, the therapeutic effect of RSV neutralizing antibodies in infected cotton rats has been shown to be highly relevant to subsequent experience with immunotherapy of monkeys and humans infected with RSV. Indeed, the cotton rat appears to be a reasonably reliable experimental surrogate for the response of
infected monkeys, chimpanzees and humans to immunotherapy with RSV neutralizing antibodies. For example, the amount of RSV neutralizing antibodies associated with a therapeutic effect in cotton rats as measured by the level of such antibodies in the serum of treated animals (i.e., serum RSV neutralization titer of 1 :302 to 1 :518) is in the same range as that demonstrated for monkeys (i.e., titer of 1 :539) or human infants or small children (i.e., 1 :877). A therapeutic effect in cotton rats was manifest by a one hundred fold or greater reduction in virus titer in the lung (Prince et al., J. Virol. 61 :1851-1854) while in monkeys a therapeutic effect was observed to be a 50-fold reduction in pulmonary virus titer. (Hemming et al., J. Infect. Pis. 152:1083-1087 (1985)). Finally, a therapeutic effect in infants and young children who were hospitalized for serious RSV bronchiolitis or pneumonia was manifest by a significant increase in oxygenation in the treated group and a significant decrease in amount of RSV recoverable from the upper respiratory tract of treated patients. (Hemming et al., Antimicrob. Agents Chemother. 31:1882-1886 (1987)). Therefore, based on these studies, the cotton rat constitutes a relevant model for predicting success of chimeric and non-chimeric RSV vaccines in infants and small children. Other rodents, including mice, will also be similarly useful because these animals are moderately permissive for RSV replication and have a core temperature more like that of humans (Wright et al., J. Infect. Pis. 122:501-512 (1970) and Anderson et al., J. Gen. Virol. 71:(1990)). Like models are available and widely known for other negative stranded RNA viruses.
In accordance with the foregoing description and based on the examples below, the invention also provides isolated, infectious attenuated viral compositions for vaccine use. The attenuated virus which is a component of a vaccine is in an isolated and typically purified form. By isolated is meant to refer to RSV which is in other than a native environment of a wild-type virus, such as the nasopharynx of an infected individual. More generally, isolated is meant to include the attenuated virus as a component of a cell culture or other artificial medium. For example, attenuated RSV of the invention may be produced by an infected cell culture, separated from the cell culture and added to a stabilizer. Vaccines ofthe invention contain as an active ingredient an immunogenically effective amount of a recombinant negative stranded RNA virus bearing a mutation identified in a heterologous virus as described herein. Recombinant virus can be used directly in vaccine formulations, or lyophilized. Lyophilized virus will typically be maintained at about 4°C. When ready for use the lyophilized virus is
reconstituted in a stabilizing solution, e.g., saline or comprising SPG, Mg^ and HEPES, with or without adjuvant, as further described below. The biologically-derived or recombinantly modified virus may be introduced into a host with a physiologically acceptable carrier and/or adjuvant. Useful carriers are well known in the art, and include, e.g., water, buffered water, 0.4%) saline, 0.3% glycine, hyaluronic acid and the like. The resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration, as mentioned above. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, and the like. Acceptable adjuvants include incomplete Freund's adjuvant, aluminum phosphate, aluminum hydroxide, or alum, which are materials well known in the art. Preferred adjuvants also include Stimulon™ QS-21 (Aquila Biopharmaceuticals, Inc., Worchester, MA), MPL™ (3-0-deacylated monophosphoryl lipid A; RIBI ImmunoChem Research, Inc., Hamilton, MT), and interleukin-12 (Genetics Institute, Cambridge, MA).
Upon immunization with an attenuated viral vaccine composition as described herein, via aerosol, droplet, oral, topical or other route, the immune system of the host responds to the vaccine by producing antibodies specific for one or more viral proteins, e.g., RSV F and/or G glycoproteins. As a result ofthe vaccination, the host becomes at least partially or completely immune to infection by the subject virus, or resistant to developing moderate or severe disease related thereto.
Vaccines ofthe invention may comprise attenuated virus that elicits an immune response against a single viral strain or antigenic subgroup, e.g. RSV A or B, or against multiple strains or subgroups. In this context, a chimeric vaccine virus can elicit a monospecific immune response or a polyspecific immune response against multiple strains or subgroups. Alternatively, chimeric viruses having different immunogenic characteristics can be combined in a vaccine mixture or administered separately in a coordinated treatment protocol to elicit more effective protection against one RSV strain, or against multiple RSV strains or subgroups.
The host to which the vaccine is administered can be any mammal susceptible to infection by the subject virus or a closely related virus and capable of
generating a protective immune response to antigens ofthe vaccinating virus. Thus, suitable hosts include humans, non-human primates, bovine, equine, swine, ovine, caprine, lagamoφh, rodents, etc. Accordingly, the invention provides methods for creating vaccines for a variety of human and veterinary uses. The vaccine compositions containing the attenuated recombinant virus of the invention are administered to a patient susceptible to or otherwise at risk of infection by the subject virus in an "immunogenically effective dose" which is sufficient to induce or enhance the individual's immune response capabilities against the subject virus. In the case of humans, the attenuated virus ofthe invention is administered according to well established human vaccine protocols, e.g., as described for RSV in, Wright et al., Infect Immun. 37:397-400 (1982), Kim et al., Pediatrics 52:56-63 (1973), and Wright et al, J. Pediatr. 88:931-936 (1976), which are each incoφorated herein by reference. Briefly, adults or children are inoculated intranasally via droplet with an immunogenically effective dose of RSV vaccine, typically in a volume of 0.5 ml of a physiologically acceptable diluent or carrier. This has the advantage of simplicity and safety compared to parenteral immunization with a non-replicating vaccine. It also provides direct stimulation of local respiratory tract immunity, which plays a major role in resistance to RSV. Further, this mode of vaccination effectively bypasses the immunosuppressive effects of RS V-specific maternally-derived serum antibodies, which typically are found in the very young. Also, while the parenteral administration of RSV antigens can sometimes be associated with immunopathologic complications, this has never been observed with a live virus.
In all subjects, the precise amount of attenuated viral vaccine administered and the timing and repetition of administration will be determined based on the patient's state of health and weight, the mode of administration, the nature ofthe formulation, etc. Posages will generally range from about 10 to about 10 plaque forming units (PFU) or more of virus per patient, more commonly from about 104 to 105 PFU virus per patient. In any event, the vaccine formulations should provide a quantity of attenuated virus ofthe invention sufficient to effectively stimulate or induce an anti-viral immune response, e.g., as can be determined by complement fixation, plaque neutralization, and/or enzyme- linked immunosorbent assay, among other methods. In this regard, individuals are also monitored for signs and symptoms of upper respiratory illness. As with administration to chimpanzees, the attenuated virus ofthe vaccine grows in the nasopharynx of vaccinees at
levels approximately 10-fold or more lower than wild-type virus, or approximately 10- fold or more lower when compared to levels of incompletely attenuated virus.
In neonates and infants, multiple administration may be required to elicit sufficient levels of immunity. For RSV infection, administration should begin within the first month of life, and at intervals throughout childhood, such as at two months, six months, one year and two years, as necessary to maintain sufficient levels of protection against native (wild-type) RSV infection. Similarly, adults who are particularly susceptible to repeated or serious RSV infection, such as, for example, health care workers, day care workers, family members of young children, the elderly, individuals with compromised cardiopulmonary function, may require multiple immunizations to establish and/or maintain protective immune responses. Levels of induced immunity can be monitored by measuring amounts of neutralizing secretory and serum antibodies, and dosages adjusted or vaccinations repeated as necessary to maintain desired levels of protection. Further, different vaccine viruses may be indicated for administration to different recipient groups. For example, an engineered recombinant expressing a cytokine or an additional protein rich in T cell epitopes may be particularly advantageous for adults rather than for infants. Vaccines produced in accordance with the present invention can be combined with viruses expressing antigens of another subgroup or strain of virus to achieve protection against multiple subgroups or strains. Alternatively, the vaccine virus may incoφorate protective epitopes of multiple viral strains or subgroups engineered into one clone as described herein.
Typically when different vaccine viruses are used they will be administered in an admixture simultaneously, but they may also be administered separately. For example, as the F glycoproteins ofthe two RSV subgroups differ by only about 11% in amino acid sequence, this similarity is the basis for a cross-protective immune response as observed in animals immunized with RSV or F antigen and challenged with a heterologous strain. Thus, immunization with one strain may protect against different strains ofthe same or different subgroup. However, it is likely that it would be preferable to have the G and F glycoproteins of RSV antigenic subgroup A or B present in a vaccine .
Attenuated recombinant vaccines ofthe invention elicit production of an immune response that is protective against serious disease, such as pneumonia and bronchiolitis, when the individual is subsequently infected with wild-type virus. While the naturally circulating virus may still be capable of causing infection, there is a very
greatly reduced possibility of disease symptoms as a result ofthe vaccination and possible boosting of resistance by subsequent infection by wild-type virus. Following vaccination, there are detectable levels of host engendered serum and secretory antibodies which are capable of neutralizing homologous (ofthe same subgroup) wild-type virus in vitro and in vivo. In many instances the host antibodies will also neutralize wild-type virus of a different, non-vaccine subgroup.
Preferred attenuated viruses ofthe present invention exhibit a very substantial diminution of virulence when compared to wild-type virus that is circulating naturally in humans. The chimeric virus is sufficiently attenuated so that symptoms of infection will not occur in most immunized individuals. In some instances the attenuated virus may still be capable of dissemination to unvaccinated individuals. However, its virulence is sufficiently abrogated such that severe lower respiratory tract infections in the vaccinated or incidental host do not occur.
The level of attenuation of vaccine viruses of the invention may be determined by, for example, quantifying the amount of virus present, e.g., in the respiratory tract, in an immunized host and comparing the amount to that produced by wild-type or other attenuated viruses which have been evaluated as candidate vaccine strains. For example, attenuated RSV ofthe invention will have a greater degree of restriction of replication in the upper respiratory tract of a highly susceptible host, such as a chimpanzee, compared to the levels of replication of wild-type virus, e.g., 10- to 1000- fold less. Also, the level of replication of attenuated RSV vaccine strains in the upper respiratory tract ofthe chimpanzee should be less than that ofthe RSV A2 ts-1 mutant, which was demonstrated previously to be incompletely attenuated in seronegative human infants. In order to further reduce the development of rhinorrhea, which is associated with the replication of virus in the upper respiratory tract, an ideal vaccine candidate virus should exhibit a restricted level of replication in both the upper and lower respiratory tract. However ,the attenuated viruses ofthe invention must be sufficiently infectious and immunogenic in humans to confer protection in vaccinated individuals. Methods for determining levels of RSV in the nasopharynx of an infected host are well known in the literature. Specimens are obtained by aspiration or washing out of nasopharyngeal secretions and virus quantified in tissue culture or other by laboratory procedure. See, for example, Belshe et al., J. Med. Virology 1:157-162 (1977), Friedewald et al, J. Amer. Med. Assoc. 204:690-694 (1968); Ghaφure et al, J. Virol. 3:414-421 (1969); and Wright et al., Arch. Ges. Virusforsch. 41:238-247 (1973), each incoφorated herein by reference.
The virus can conveniently be measured in the nasopharynx of host animals, such as chimpanzees. Other methods for determining levels and virulence of additional negative stranded RNA viruses are widely known and readily practiced.
The invention disclosed herein is further clarified by the following examples which are offered by way of illustration not limitation. For the puφoses ofthe present description, all publications and patent documents cited herein are incoφorated by reference in their entirety for all puφoses.
EXAMPLE I
Mapping Attenuating Mutations Identified in HPIV3 JS cg>45 and RSV cp530 and Sendai Virus to Conserved Sequence Elements Among Heterologous Negative Stranded RNA Viruses The present example demonstrates that mutations identified in one mutant negative stranded RNA virus can be readily mapped to corresponding, conserved amino acid sequence elements in heterologous viruses within the order Mononegavirales. These mutations that are characterized by a structural change compared to a parental sequence, which parental sequence is conserved (identically or conservatively) among one or more heterologous negative stranded RNA viruses, provide likely candidate mutations for incoφoration within recombinant viruses sharing the parental protein sequence elements.
To exemplify this aspect ofthe invention, a panel of known mutations within the HPIV3 mutant strain JS 45 was analyzed. This panel of mutations includes ts attenuating amino acid substitutions in the polymerase L gene at parental residue/sequence positions Tyr942, Leu 92, and/or Thri558. More specifically, the JS cp45 mutant L protein exhibits attenuating mutations where the parental Tyr 42 is replaced by His, Leu992 is replaced by Phe, and/or Thr_558 is replaced by He (see, U.S. Patent Application No. 08/083,793 and corresponding International Application No. WO 98/53078, incoφorated herein by reference). In accordance with preferred aspects ofthe invention, these mutations were not only mapped against parental sequences to identify the changes, but were also successfully incoφorated in PIV recombinants (r942, r992, rl558, r942/992, r992/1558, r942/1558, and r942/992/1558), singly and in combination, to confirm their attenuating effects and recoverability into cloned, infectious virus.
Additional exemplary mutations were evaluated in the HPIV3 JS cp45 mutant which were mapped and characterized to encode attenuating amino acid substitutions in the F and C proteins of HPIV3. These mutations include non-ts attenuating amino acid substitutions in the C protein at the parental residue/position Ile96 of JS HPIV3, as exemplified by the substitution of Ile 6 to Thr. Further exemplary mutations identified in the F protein of HPIV3 encode amino acid substitutions at parental residue/positions Ile42o and Ala^o, as exemplified by the substitutions Ile42o to Val and Ala^o to Thr.
Each attenuating mutation thus identified in HPIV3 provided an index for sequence comparison against a homologous protein in other negative stranded viruses. To illustrate this aspect ofthe invention, conventional sequence alignments were undertaken in accordance with the methods outlined above to map the mutations identified in the HPIV3 L and F proteins to corresponding sites among a panel of heterologous negative stranded RNA viruses (HPIVl, Sendai virus, HPIV2, BPIV3, MeV and RSV). As shown in Table 2, this exercise revealed, quite remarkably, a high degree of conservation between parental sequence elements ofthe selected mutants and the wild- type sequences ofthe heterologous viruses to which they were compared. Such results were suφrising, because evolutionarily conserved sequence elements are imputed to have important functional significance that would be predicted to yield more severe phenotypic effects, eg., loss of viability or infectivity, upon mutation than mere attenuation.
Table 2: Sequence alignment ofthe region around the attenuating mutations identified in the F and L proteins HPIV3 cp45
HPIV3 cp45 F ORF I420V and A450T
HPIV3 4071 QGVKIITHKECSTIGINGMLFNTNKEGTLAFYTPNDITLNNSVALDPIDISIE (SEQ ID NO. 1)
BPIV3 407 QGIKIITHKECQVIGINGMLFNTNREGTLATYTFDDIILNNSVALNPIDISME (SEQ ID NO. 2)
HPIVl 410 RGVTFLTYTNCGLIGINGIELYANKRGRDTTWGNQIIKVGPAVSIRPVDISLN (SEQ ID NO. 3)
HPIV2 404 QGISIIDIKRCSEMMLDTFSFRITSTFNATYVTDFSMINANIVHLSPLDLSNQ (SEQ ID NO. 4)
RSV 437 NGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFD (SEQ ID NO. 7)
MEASLES 410 KILTYIAADHCPVVEVNGVTIQVGSRRYPDAVYLHRIDLGPPISLERLDVGTN (SEQ ID NO. 8)
HPIV3 cp45 L ORF Y942H
HPIV3 923 NPN MQYASL... IPASVGGFNYMAMSRCFVRNIGDPSVAALAD (SEQ ID NO. 9)
BPIV3 923 NIHWMQYASL... IPASVGGFNYMAMSRCFVRNIGDPTVAALAD (SEQ ID NO. 10)
SENDAI 923 GKNWLRCAVL... IPANVGGFNYMSTSRCFVRNIGDPAVAALAD (SEQ ID NO. 11)
HPIV2 927 HPRLISRIVL... LPSQLGGLNYLACSRLFNRNIGDPLGTAVAD (SEQ ID NO. 12)
MEASLES 923 NNDLLIRMAL... LPAPIGGMNYLNMSRLFVRNIGDPVTSSIAD (SEQ ID NO. 13)
RSV 968 LDNIDTALTLYMNLPMLFGGGDPNLLYRSFYRRTPDFLTEAIVH (SEQ ID NO. 14)
HPIV3 cp45 L ORF L992F
HPIV3 973 LDRSVLYRIMNQEPGESSFLDWASDPYSCNLPQSQNITTMIKNITA (SEQ ID NO. 15)
BPIV3 973 LDRGVLYRIMNQEPGESSFLDWASDPYSCNLPQSQNITTMIKNITA (SEQ ID NO. 16)
SENDAI 973 LDKQVLYRVMNQEPGDSSFLDWASDPYSCNLPHSQSITTIIKNITA (SEQ ID NO. 17)
HPIV2 977 LES ILYNLLARKPGKGSWATLAADPYSLNQEYLYPPTTILKRHTQ (SEQ ID NO. 18)
MEASLES 973 MPEETLHQVMTQQPGDSSFLDWASDPYSANLVCVQSITRLLKNITA (SEQ ID NO. 19)
RSV 1036 LNKFLTCIITFDKNPNAEFVTLMRDPQALGSERQAKITSEINRLAV (SEQ ID NO. 20)
HPIV3 1537 HPKVFKRFWDCGVLNPIYGPNTASQDQIKLALSICEYSLDLFMREWL (SEQ ID NO. 21)
BPIV3 1537 HPKVFKRF DCGVLNPIYGPNTASQDQVKLALSICEYSLDLFMRE L (SEQ ID NO. 22)
SENDAI 1537 HPKIFKRF NAGVVEPVYGPNLSNQDKILLALSVCEYSVDLFMHD Q (SEQ ID NO. 23)
HPIV2 1543 HPKLLRRAMNLDIITPIHAPYLASLDYVKLSIDAIQ GVKQVLADLS (SEQ ID NO. 24)
MEASLES 1535 HPKIYKKFWHCGIIEPIHGPSLDAQNLHTTVCNMVYTCYMTYLDLLL (SEQ ID NO. 25)
RSV 1584 EQKVIKYILSQDASLHRVEGCHSFKL FLKRLNVAEFTVCP VVNID (SEQ ID NO. 26)
* Indicates mutated amino acid in HPIV3 cp45. Underlining indicates amino acid residues shared between different viruses. 1 Position ofthe first amino acid ofthe sequence shown in the full length protein.
Reviewing the exemplary alignment shown in Table 2, it is notable that each ofthe L and F mutations analyzed changed a parental sequence element that was substantially conserved, marked either by the presence of identical or conservative amino acid residues, at corresponding positions among the viral taxa shown. For example, the cp45 L protein mutation changing the parental residue Tyr94 to His mapped highly conservatively, as indicated by retention of identical tyrosine residues at corresponding wild-type positions in each ofthe Sendai, HPIV2, HPIV3, BPIV3 and MeV L proteins (Table 2). Similarly, the cp45 L mutation featuring Leu992 replaced by Phe maps to a parental residue/position that is identically conserved between the Sendai, HPIV3, BPIV3 and MeV L proteins. The two identified mutations in the cp45 F protein, substituting Ile4 o to Val and Ala^o to Thr, also exhibit identically conserved residue/positions between HPIV3 and BPIV3, while the Ile42o to Val mutant parental residue is further identically conserved in HPIVl. Additional conserved sequence elements corresponding to sites of attenuating mutations identified in HPIV3 JS cp45 are also shown in Table 2.
Another heterologous sequence alignment was conducted to evaluate conservation ofthe exemplary RSV attenuating mutation identified in the mutant strain RSV cp530. This mutation is marked by a substitution of phenylalanine to leucine at position 521 in the L polymerase of cp530, which mutation occurs within a larger conserved structural domain ofthe protein. As is shown in Table 3, the mutation at Phe52ι also mapped highly conservatively, as indicated by retention of identical phenylalanine residues at corresponding wild-type positions in each of thirteen subject taxa (Table 3; Fig. 1, panel A).
Table 3: Alignment of L Polymerase Sequence Around PIV3 PHE-456(*) In Various Paramyxovirus Virus Species
Position of Position of Gene bank
First aa in conserved Accession
Virus sequence phenylanine No.
PIV3 431 NAYGSNSAISYENAVDYYQSFIGIKFNKFIEPQLDEDLTIY (SEQ ID NO. 27) 456 Z11575
RSV 496 YYKLNTYPSLLELTERDLIVLSGLRFYREFRLPKKVDLEMI (SEQ ID NO. 28) 521 P28887
MEASLES 423 NAQASGEGLTHEQCVDN KSFAGVKFGCFMPLSLDSDLTMY (SEQ ID NO. 29) 448 P35975
SENDAI 431 NAQGSNTAISYECAVDNYTSFIGFKFRKFIEPQLDEDLTIY (SEQ ID NO. 30) 456 Q06996
PIV2 434 EFQHDNAEISYEYTLKHWKEISLIEFRKCFDFDPGEELSIF (SEQ ID NO. 31) 459 P26676
CDV 423 NAHASGEGITYSQCIEN KSFAGIRFKCFMPLSLDSDLTMY (SEQ ID NO. 32) 448 P24658
SV41 435 ELHHDNSEISYEYTLRH KELSLIEFKKCFDFDPGEELSIF (SEQ ID NO. 33) 460 P35341
PDV 423 NACVSGEGITYSQCVEN KSFAGIKFRCFMPLSLDSDLTMY (SEQ ID NO. 34) 448 Y09630
HENDRA 430 RLKNSGESLTVDDCVKNWESFCGIQFDCFMELKLDSDLSMY (SEQ ID NO. 35) 455 AF017149 σ
4≥» SV5 433 ELMNDNTEISYEFTLKH KEVSLIKFKKCFDADAGEELSIF (SEQ ID NO. 36) 458 Q88434
RINDERPEST 423 NAQASGEGLTYEQCVDNWKSFAGIRFGCFMPLSLDSDLTMY (SEQ ID NO. 37) 448 P41357
APV 431 YMNAKTYPSNLELCVEDFLELAG1SFCQEFYVPSQTSLEMV (SEQ ID NO. 38) 456 U65312
NDV 427 QLHADSAEISHDIMLREYKSLSALEFEPCIEYDPVTNLSMF (SEQ ID NO. 39) 452 X05399
Amino acids in bold type are conserved in all virus species analyzed
Yet another heterologous sequence alignment was conducted to demonstrate the ability to identify conserved structural elements corresponding to sites of known attenuating mutations. In this example, an attenuating mutation identified at position 170 in the C protein of Sendai virus was mapped against corresponding sequences in the C proteins ofthe heterologous viruses HPIV-1, HPIV-3 and BPIV-3 (see, Table 4; positions of first residues in corresponding sequences are numbered). Once again, this mutation was marked by an amino acid change at a parental residue/sequence position that was identically conserved among diverse taxa.
Table 4
164
HPIV3 144 MKLERWIRTLLRGKCDNLQMFQARYQEVMTYLQQNKVETVIMEEANLSVHLIQDQ* (SEQ ID NO. 40)
BPIV3 144 MKLER IRTLLRGKCDNLKMFQSRYQEVMPFLQQNKMETVMMEEANLSVHLIQDIPA* (SEQ ID NO. 41)
SeV 150 MKTERWLRTLIRGEKTKLKDFQKRYEEVHPYLMKEKVEQIIMEEA SLAAHIVQE* (SEQ ID NO. 42)
HPIV-1 150 MKTERWLRTLIRGKKTKLRDFQKRYEEVHPYLMMERVEQIIMEEA KLAAHIVQE* (SEQ ID NO. 43)
170
These collective findings illustrate suφrising conservation of sequence elements that correspond to sites of attenuating mutations. On this basis, the rational design methods ofthe invention were initiated to import attenuating sequence changes identified in one heterologous virus to a different recombinant virus, eg., by identical or conservative alteration of a recombinant genome or antigenome, to yield an attenuated, recombinant clone. Practical development of these methods is directly evinced by the following examples.
EXAMPLE II
Heterologous Transfer of an Attenuating Mutation from RSV cptsS30 L into a Recombinant HPIV3 Vaccine Candidate
Having thus identified attenuating mutations at sites that correspond to conserved structural elements between heterologous taxa within the Mononegavirales, the concept of heterologous transfer of attenuating mutations across phylogenetic boundaries was tested using the important disease virus RSV as a model. In this context, the present example demonstrates that an attenuating (att) mutation identified in RSV, a virus in the pneumovirus genus ofthe Paramyxoviridae family, can be transferred to PIV3, a member ofthe distantly-related Respirovirus genus. These viruses represent two different subfamilies within the Paramyxoviridae Family, Pneumovirinae and Paramyxovirinae, respectively.
More specifically, an attenuating mutation in a first, heterologous virus (RSV cpt_?530), which altered the parental RSV sequence at a defined site of mutation (Phe52ι ofthe RSV L protein) to specify the attenuated phenotype mapped to an identically conserved residue at the corresponding position (F456L) in the L protein of a selected target virus, HPIV3 (Table 3). The wild-type HPIV3 sequence element thus conserved was therefore tested as a potential target for heterologous transfer ofthe attenuating mutation between RSV and HPIV3. To achieve this transfer, all or part ofthe conserved sequence element(s) bearing the mutant alteration is preferably copied or imported into the recombinant virus to yield a novel attenuated derivative. While it is preferred to identically copy the mutant alteration into the recombinant virus, this level of fidelity is not required. On the contrary, the parental or wild-type residue thus identified as a target may be deleted or
replaced by an amino acid insertion at the site of mutation comprising one or more residues that may be unrelated to the residue(s) marking the mutation. Preferably, where the subject mutation is marked by one or more amino acid substitution(s), the residue(s) in the parent clone ofthe recombinant virus corresponding in position to the site ofthe mutation is/are replaced by one or more residues that are conservatively related to the substitute residue(s) identified in the mutant sequence. More preferably, the residue(s) in the parent clone ofthe recombinant virus corresponding to the site ofthe mutation is/are replaced by one or more identical residue(s) to those present in the mutant sequence.
Thus, in the present example, the phenylalanine to leucine mutation at aa position 521 in the L polymerase of cpts530 was characterized to specify ts and attenuation (αtt) phenotypes. Sequence alignment of this region in the L proteins of several distantly-related paramyxoviruses (Table 3) revealed that this phenylalanine is broadly conserved. Using reverse genetics, the analogous phenylalanine at position 456 in the L protein of wild type PIV3 was mutagenized to leucine (F456L). The resulting virus, designated r456__, was ts (40°C shut-off temperature of plaque formation), and its replication in the upper, but not the lower, respiratory tract of hamsters was 10-fold reduced compared to that ofthe recombinant wild type (rwt) PIV3. These results indicate that the transferred, phenylalanine to leucine mutation specified a similar level of temperature sensitivity and attenuation in two distantly-related paramyxoviruses. Also within the present example, it is demonstrated that introduction ofthe
F456L mutation into two rPIV3 candidate vaccine viruses, one bearing three cp45 ts missense mutations in the L protein (rcp45_.) and the other bearing all 15 cp45 mutations (rcp45) further attenuated the viruses in vivo. More specifically, the F456L mutation was introduced into two recently-developed recombinant PIV3 vaccine candidates. One is rcp45, a recombinant version ofthe biologically-derived PIV3 vaccine candidate cp45, the other is rcp45__, a version in which the only cp45 mutations present are the three amino acid substitutions in the L protein (published International Application No. 98/53078; Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998); Skiadopoulos et al, J. Virol. 73(2^:1374-1381- (1999), each incoφorated herein by reference). The addition ofthe F456L mutation to rcp45 or rcp45ι. increased its level of temperature sensitivity and attenuation in vivo, and rcp45-456 was immunogenic and phenotypically stable. The rcp45__-456 and rcp45-456 viruses were 100 to 1000-fold more restricted in replication in hamsters than their rcp45 and rcp45 parents. Immunization with rcp45-456 induced a moderate level of resistance to replication of PIV3 challenge virus. In chimpanzees,
rcp45-456 was 5-fold more restricted in the respiratory tract than rcp45, and induced a comparable, moderate-to-high level of PI V3 -specific serum antibodies. rcp45 and rcp45- 456 viruses isolated from chimpanzees throughout a two week course of replication maintained the level of temperature sensitivity of their respective input viruses, illustrating their phenotypic stability.
Therefore, the transfer ofthe F456L mutation corresponding to the RSVF521L mutation into cp45 recombinant virus resulted in an incremental increase in attenuation ofthe recombinant virus, demonstrating the usefulness of this transferred mutation for fine tuning attenuation in PIV vaccine candidates. The ability to transfer mutations identified in heterologous paramyxoviruses, which in this case represent different subfamilies, greatly enhances the ability to develop novel parainfluenza virus vaccines.
Viruses and Cells The rPIV3 JS wt (referred to as rwt herein), rcp45\_, and rcp45 viruses that are used as controls in this example were generated previously (published International Application No. 98/53078; Durbin et al., Virology 235:323-332 (1997); Skiadopoulos et al.. J. Virol. 72(3): 1762-8 (1998); Skiadopoulos et al.. J. Virol. 73(2^:1374-1381 (1999), each incoφorated herein by reference). The rPIV3s were grown in simian LLC-MK2 cells (ATCC CCL 7.1) as described previously (Durbin et al., Virology 235:323-332. 1997; Hall et al. Virus Res. 22(3^1:173-184. 1992; Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998), incoφorated herein by reference). The modified vaccinia virus Ankara (MVA-T7) (Wyatt et al., Virology 210(1 ):202-205 (1995)), which expresses the T7 polymerase, was kindly provided by Linda Wyatt and Bernard Moss. HEp-2 (ATCC CCL 23) and LLC-MK2 cells were maintained in OptiMEM I (Life Technologies,
Gaithersburg, MD) supplemented with 2% FBS and gentamicin sulfate (50ug/mL) or in EMEM supplemented with 10% FBS, gentamicin sulfate (50ug/ml), and 4mM glutamine.
Construction of Point Mutations in rwt A subgenomic fragment of p3/7(131)2G+, the antigenomic cDNA clone of
PIV3 JS wt previously used to recover infectious virus (Durbin et al., Virology 235:323- 332, 1997; Skiadopoulos et al., J. Virol. 72(31: 1762-8, 1998; Skiadopoulos et al., J. Virol. 73(2):1374-1381, 1999), encompassing PIV3 nt 7437 to 11312 (Xho I - Sph I), was cloned into a pUC19 vector modified to accept this fragment using standard molecular
cloning techniques. The cDNA was modified by the introduction of two point mutations using the Transformer Mutagenesis kit (Clontech, CA) as described previously (Skiadopoulos et al., J. Virol. 72(3): 1762-8, 1998; Skiadopoulos et al, J. Virol. 73(2):1374-1381, 1999). These two changes were at positions 10011 (T to C) and 10013 (C to G) numbered according to the complete positive sense sequence of rPIV3 antigenomic RNA. This introduced the F456L codon change as well as an overlapping, silent Xmnl site as a marker (Figure 1). After mutagenesis, restriction endonuclease fragments were sequenced completely and were cloned directly into the full-length clone, p3/7(131)2G+, or into derivatives bearing cp45 mutations, using standard molecular cloning techniques.
Recovery of Recombinant PIV3s Bearing the F456L Mutation.
Full-length antigenomic cDNA derivatives bearing the F456L mutation and the three support plasmids pTM(N), pTM(P no C) and pTM(L) (Durbin et al., Virology 235:323-332. 1997) were transfected into HEp-2 monolayers in 6-well plates (Costar, MA) using LipofectACE (Life Technologies, MD), and the monolayers were infected with MVA-T7 as described previously (Durbin et al., Virology 235:323-332 (1997); Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998). Plasmid pTM(P no C) is a version ofthe previously-described pTM(P) (Durbin et al., Virology 235:323-332 (1997)) plasmid in which the C ORF has been modified such that its translational initiation codon was changed from AUG to ACG (methionine to threonine). After incubation at 32°C for 4 days, the transfection harvest was passaged onto LLC-MK2 cells in T-25 flasks which were incubated at 32°C for four to eight days. The clarified medium supernatant was subjected to three rounds of plaque purification on LLC-MK2 cells as described previously (Durbin et al, Virology 235:323-332 (1997); Hall et al., Virus Res. 22(3):173- 184 (1992); Skiadopoulos et al., J. Virol. 72(3):1762-8 (1998)). Each biologically-cloned recombinant virus was amplified twice in LLC-MK2 cells at 32°C to produce virus for further characterization. Virus was concentrated from clarified medium by polyethylene glycol precipitation (Mbiguino and Menezes, J. Virol. Methods 31 :161-170 (1991)), and viral RNA (vRNA) was extracted with TRIzol Reagent (Life Technologies). Reverse transcription was performed on vRN A using the Superscript II Preamplification System (Life Technologies) with random hexamer primers. The Advantage cDNA PCR kit (Clontech, CA) and sense and antisense primers specific for various portions ofthe PIV3 genome were used to amplify fragments for restriction endonuclease digestion and/or
sequence analysis. The PCR fragments were analyzed by sequencing and/or restriction enzyme analysis with each ofthe restriction enzymes whose recognition sites had been created or ablated during construction ofthe mutations.
Efficiency of Plaque Formation (EOP) of rPIV3s Bearing the F456L Mutation at Permissive and Restrictive Temperatures
The level of temperature sensitivity of plaque formation in vitro of control and recombinant viruses was determined at 32°C and at a range of temperatures from 35°C to 41°C in LLC-MK2 cell monolayer cultures incubated for six days as previously described (Hall et al., Virus Res. 22(3):173-184, 1992). Plaques were enumerated by hemadsoφtion with guinea pig erythrocytes following removal of the methylcellulose overlay, or alternatively the viral plaques present in the monolayer were identified by immunoperoxidase staining with a mixture of two PIV3 -specific anti-HN murine mAbs 101/1 and 454/11 diluted 1:250 (Muφhy et al., Vaccine 8(5):497-502 (1990); Muφhy et al. (1990); van Wyke Coelingh, Winter, and Muφhy Virology 143 (2): 569-582, (1985), each incoφorated herein by reference).
Evaluation of rPIV3 Mutant Viruses for the att Phenotype in Hamsters
4 week-old Golden Syrian hamsters (Charles River Laboratories, NY) which were seronegative for PIV3 were inoculated intranasally with 0.1 ml LI 5 medium containing 106 ° TCID5o of rwt or one ofthe mutant rPIV3s. On day 4 post-infection, the hamsters were sacrificed, the lungs and nasal turbinates were harvested, and the virus was quantified as previously described (Durbin et al., Virology 235:323-332, 1997;
Skiadopoulos et al., J. Virol. 72(3): 1762-8, 1998). The mean log.o TCID50/gram at 32°C was calculated for each group of hamsters.
Immunogenicity and efficacy of rcg>45-456 in hamsters
Three groups of five hamsters were inoculated intranasally with 0.1 ml of: (i) L15 medium (placebo), (ii) 106 0 TCID50 of rcp45, or (iii) 106 0 TCID50 of rcp45-456. The hamsters were bled before infection and 42 days after infection, and serum
hemagglutination-inhibiting (HAI) antibody titers against PIV3 were determined as described previously (van Wyke Coelingh, Winter, and Mrnphy, 1985). On day 44, the hamsters were challenged by intranasal administration of 106 ° TCID5o rwt. Nasal turbinates and lungs were harvested four days later, and the titer of rwt in the tissue homogenates was determined as described above.
Evaluation of rPIV3 Mutant Viruses for the att Phenotype in Chimpanzees
Young male and female chimpanzees, which were seronegative for RSV and PIV3 and weighed 6.6 to 10.0 kg, were pair-housed in large glass isolator suites and maintained as described previously (Crowe et al., 1994a; Hall et al., J. Infect. Dis. 167:958-962 (1993)). Groups of chimpanzees were infected by the intranasal (IN) and intratracheal (IT) routes with a 1 ml inoculum containing 106 0 TCID5o of rcp45 or rcp45- 456 at each site. Following inoculation with the virus, nasopharyngeal swab and tracheal lavage samples were collected for quantification of virus shedding as described previously (Hall et al., 1993; Karron et al., 1997). Nasopharyngeal swab samples were collected on days 1 through 10 and on day 13, and tracheal lavage samples were collected on days 2, 4, 6, 8 and 10. The extent of rhinorrhea was estimated daily and assigned a score of 0-4 (0 = no rhinorrhea; 1= trace; 2 = mild; 3 = moderate; 4 = severe). The rcp45 and rcp45-456 viruses were evaluated in two separate experiments which followed the same protocol. In experiment 1, two chimpanzees were inoculated with r 45 and four with rcp45-456, and in experiment 2 each virus was given to 2 animals. The second experiment was performed to confirm the growth difference between the two viruses observed in the first experiment. The two sets of data were indistinguishable with regard to virus growth and immunogenicity and were averaged together. Data from four animals that received 104 TCID5o ofthe wt JS strain of PIV3 by the IN and IT route were described previously (Hall et al., 1993) and are presented here for the puφoses of comparison.
Characterization of Replication of rPIVs in Chimpanzees
The quantity of virus in nasopharyngeal swab and tracheal lavage samples was determined on LLC-MK2 monolayers at 32°C and expressed as log.o TCID5o/ml, as described previously (Crowe et al., 1994a; Hall et al., 1993). Virus present in
chimpanzee nasopharyngeal and tracheal lavage samples was grown on LLC-MK2 monolayers in 24 well plates at 32°C until extensive cytopathic effect was detected. The level of temperature sensitivity of these rPIV3 isolates was estimated by determining the efficiency of plaque formation on LLC-MK2 monolayers as described above. All studies with chimpanzee specimens or isolates included a cocktail of antibiotics consisting of clindamycin (lOOug/ml), ciprofloxacin (lOOug/ml), gentamicin (lOOug/ml), and amphotericin B (2.5 ug/ml).
RESULTS
Introduction of F456L Mutation into a rwt Confers the ts Phenotype
As noted above, RSV cpt.s530 is ts and attenuated for replication in the respiratory tract of mice (Crowe et al., 1994b). A single amino acid substitution at phenylalanine-521 in the L protein of RSV cpts530 is responsible for the temperature sensitivity (39°C shut-off temperature of plaque formation) and attenuation (10-fold reduction in replication in the upper respiratory tract of mice) (Crowe et al., 1994b; Juhasz et al., 1997). Sequence alignment ofthe L proteins of 13 different paramyxoviruses, including RSV and PIV3, revealed that the phenylalanine at position 521 in RSV L is highly conserved (Table 3; Figure 1, panel A). In the case of HPIV3, the corresponding amino acid occurs at position 456 in the PIV3 L polymerase. The difference in the position number for this residue in RSV (521) versus PIV3 (456) is consistent with previous observations that the L protein of RSV has an amino-terminal extension of about 70 amino acids compared with that of paramyxoviruses from other genera (Stec et al., Virology 183:273-287 (1991)). To determine whether a mutation at the 456 position in the L protein of PIV3 would confer ts and att phenotypes similar to those ofthe heterologous, RSV cpts530 mutant, the phenylalanine at position 456 in rwt was mutagenized identically to leucine (F456L). The coding change was designed to involve two nucleotide substitutions in order to reduce the probability of reversion to wt. Also, the mutation was marked by introduction of a silent Xmn I restriction endonuclease recognition site (Figure 1, panel C). The mutations were introduced into the full-length infectious rwt cDNA plasmid, and recombinant virus was recovered as described previously (Durbin et al., Virology 235:323-332 (1997), Skiadopoulos et al, J. Virol. 72(3):1762-8 (1998) and Skiadopoulos et al.. J. Virol. 73(2V1374-1381 (1999)). The
recovered r456__ mutant (Figure 1, panel B) was confirmed to possess the Xmn I marker and the F456L mutation based on RT-PCR of purified vRNA and analysis by restriction enzyme digestion and sequencing. Introduction ofthe F456L mutation into rwt conferred a shut-off temperature of 40°C (Table 5), one degree higher than that of RSV cpts530, demonstrating that a ts mutation identified in a pneumovirus can be transferred to a distantly-related Respirovirus to confer a similar, although not identical, ts phenotype.
Table 5: Temperature sensitivity of control viruses and viruses bearing the F456L mutation in LLC-MK2 cells at permissive and non-permissive temperatures.
Mean log10pfu/ml reduction at the indicated temperature3
Mean Titer at 35°C 36°C 37°C 38°C 39°C 40°C 41°C
Virus 32°C rwt 7.5 -0.2 0.0 0.0 -0.1 0.1 0.3 0.8 r456L 7.3 - - 0.3 0.2 0.6 2.5 >5.5
rcp45 L 7.3 - - 0.5 1.9 4.3 >6.0 - rcp45 L -456 6.5 2.5 4.5 >5.2 >5.2 >5.2 >5.2 -
rcp45 7.8 0.6 1.0 1.4 2.4 >5.6 >6.8 - rcp45-456 7.7 0.2 1.0 2.2 >4.9 >7.3 >6.9 -
a Plaques were enumerated by immunoperoxidase staining after incubation for 6 days at the indicated temperature. The average of three or more experiments is presented. Values which are underlined and in bold type represent the lowest restrictive temperature at which there was a 100-fold reduction of plaquing efficiency, which is defined as the shut-off temperature of plaque formation. The reduction in titer was determined by subtracting the titer at the indicated temperature from that at permissive temperature (32°C).
Introduction ofthe F456L Mutation Into Recombinant rcp45 Based Attenuated Viruses Increases Temperature Sensitivity
p45 possesses three specific amino acid substitutions in the L protein, which were shown previously to be major determinants of its ts and att phenotypes (Skiadopoulos et al, J. Virol. 72(3):1762-8 (1998). cp45 also contains 12 other mutations outside L which include ts and att mutations (Skiadopoulos et al., J. Virol. 73(2): 1374- 1381 (1999). The F456L mutation was introduced into rcp45 and also into a virus
bearing only the three rcp45 L gene mutations (rcp45ι_). This was done in order to determine if the temperature sensitivity specified by the F456L mutation would be additive with that specified by the three cp45 L mutations or by the full set of 15 cp45 mutations. Remarkably, rcp45τ_-456 manifested a greatly enhanced level of temperature sensitivity (Table 5) with a shut-off temperature of 35°C compared with 39°C for rcp45_.. The rcp45-456 mutant had an intermediate shut-off temperature of 37°C, compared with 38°C for rcp45. Although the temperature sensitivity specified by the F456L mutation is additive to that specified by the mutations in rcp45_, and rcp45, the magnitude ofthe effect was clearly different for the two viruses. Thus, the rcp45-456 containing a greater number of mutations was unexpectedly less ts than rcp45 _-456. Evidence of complex interactions amongst cp45 ts mutations has been previously observed for other rPIV3 viruses containing various combinations of cp45 mutations, although the basis for these effects is not understood (Skiadopoulos et al, J. Virol. 72(3): 1762-8 (1998) and Skiadopoulos et al. J. Virol. 73(21:1374-1381 (1999).
Replication and Immunogenicity of Mutant rPIV3s in Hamsters.
Hamsters were inoculated IN with 1060 TCID5o of rwt or with one of several mutant rPIV3's, including virus bearing the F456L mutation alone or in combination with cp45 specific mutations (Table 6). After 4 days, lungs and nasal turbinates were harvested and the level of replication of each virus was determined. The F456L mutation alone had a moderate effect on replication of Γ456L, resulting in approximately a 10-fold reduction in the nasal turbinates and no apparent restriction of replication in the lungs. This level of attenuation is similar to that of the RSV cpts530 mutant in the upper respiratory tract of mice (Crowe et al., Vaccine 12(8). 691-699 (1994a)). Suφrisingly, the addition of the F456L mutation to either rcp45__ or rcp45 resulted in recombinants whose replication was significantly more restricted in the upper respiratory tract. This indicates that the F456L mutation can greatly enhance the attenuation of replication of both of these mutant viruses in the upper respiratory tract of hamsters.
Table 6: Replication in the respiratory tract of hamsters of rwt and rcp45 derivatives containing the F456L mutation3
Mean virus titer (log10TCID50/g ± S.E.b in indicated
Number of tissue)
Virus Hamsters Nasal turbinates Lungs rwt 10 6.9 ± 0.1 6.3 ± 0.4 r456L 10 6.0 ± 0.1 5.7 ± 0.5
rcp45L 10 3.8 ± 0.2 1.9 ± 0.2 rcp45 -456 5 <1.5 ± 0 <1.5 ± 0
rcp45 10 4.9 ± 0.2 2.1 ± 0.2 rcp45-456 5 <1.5 ± 0 l .δ ± O.l
a Hamsters were administered 1060 TCID50 of virus intranasally in a 0.1 mL inoculum. Lungs and nasal turbinates were harvested four days later and virus titer was determined at 32°C. Mean of two experiments. b S.E: Standard error
To determine whether the rcp45-456 transfer mutant elicits an immune response, seronegative hamsters were administered 106 0 TCID50 IN of rcp45-456, rcp45, or LI 5 medium. After 42 days, serum samples were collected, and the animals were challenged on day 44 with rwt. Immunization with rcp45-456 or rcp45 elicited moderate to high titers of serum HAI antibodies, respectively, and induced resistance to replication of rwt challenge virus (Table 7). The level of antibodies and resistance induced by infection with rcp45-456 was less than those induced by rcp45. The lower level ofthe immune response and protection conferred by rcp45-456 likely reflects its significantly lower level of replication in the respiratory tract ofthe hamsters.
Table 7: Infection of hamsters with rcp45 and rcp45-456 induced resistance to challenge with rwta
Mean challenge rwt titerb (log10TCID50/g ± S.E.) in:
Nasal turbinates Lungs
Virus HAI titerc log2 ± S.E)
L15 control 5.6 ± 0.1 4.8 ± 0.2 <2.0 ± 0 rcp45 <1.5 ± 0 <1.5 ± 0 10.4 ± 0.2 rcp45-456 3.1 ± 0.6 2.1 ± 0.6 4.8 ± 0.9
a Groups of 5 hamsters were intranasally administered 10 TCID50 of virus per animal in a 0.1 mL inoculum. After 44 days, the animals were challenged with 1060 TCID50 of rwt, and lungs and nasal turbinates were harvested four days later. b The quantity of virus present in each tissue sample was determined on LLC-MK2 cells at 32°C. c Serum hemagglutination inhibition antibody titer against PIV3 on day 42; i.e., two days before challenge.
S.E., Standard error. The HAI reciprocal mean log2 titer in preinfection serum was < 2.
The rcp45-456 Mutant is More Attenuated Than rcp45 in Chimpanzees
Because the rcp45-456 mutant appeared over-attenuated in hamsters, we sought to determine its level of replication and immunogenicity in chimpanzees, the non- human primate that is the most closely-related to humans. Groups of chimpanzees in two separate confirmatory experiments were inoculated IN and IT with 106 0 TCID50 per site of either rcp45-456 or rcp45. Tracheal lavage and nasopharyngeal swab samples were collected over a period of 10 and 13 days post infection, respectively, and the virus titer in each specimen was determined. rcp45-456 and rcp45 were highly restricted in replication in the upper and lower respiratory tracts in comparison to PIV3 wt (Table 8) indicating that each mutant virus is attenuated for replication in chimpanzees. As described above (Table 6), the effect of adding the F456L mutation to cp45 was to reduce replication more than 2500-fold in the upper respiratory tract of hamsters. In contrast, when evaluated in chimpanzees the effect was a reduction of only five-fold in both the upper and lower respiratory tracts (Table 8 and Figure 2). This difference was observed in two independent experiments, one in which two animals received rcp45 and four received rcp45-456, and a second in which each virus was administered to two animals.
Table 8: rcp45-456 is more attenuated for replication in the upper and lower respiratory tract of chimpanzees than rcp45.
Virus Replication
Dosea Nasopharyngeal swab fluid Tracheal lavage fluid
No. of (loglO No. with Titer0 No. with Titer" Mean days Mean Peak rhinorrhea
Virus used to animals TCID50/ml virus virus of shedding score infect animal rcp45-456 6.0 3.4±0.1C 1.2±0.4 0.7±0.3 0.2±0.1°
rcp45 6.0 4.1±0.3C 1.9±0.5 1.8±0.6 1.0±0.3d
PIV3e 6.0 6.3±0.5 5.2±0.8 3.8±0.5 3.3±0.5
a The indicated amount of virus was administered in the nose and trachea in a 1 ml inoculum at each site. b Mean peak virus titer (log10TCID50/ml). Virus titer was determined by TCID50 on LLC-MK2 cells at 32°C. c Statistically significant difference between indicated values; p< 0.025 (Student's t-test). d Statistically significant difference between indicated values; p< 0.01 (Student's t-test). e Wt JS strain of PIV3 (data from Hall et al., 1992).
Comparison ofthe pattern of daily virus shedding in the upper respiratory tract showed that the rcp45-456 virus reached lower peak titers relative to rcp45, but that its shedding diminished more slowly (Figure 2). This pattern was previously shown to be characteristic of an increased level of attenuation for RSV mutants in non-human primates (Prince et al., Infect. Immun. 26(3): 1009-13, 1979). This increased level of attenuation was also reflected in a significantly lower mean peak rhinorrhea score (Table 8). Thus, the introduction ofthe F456L mutation into rcp45 resulted in an incremental increase in attenuation for the respiratory tract of chimpanzees.
The ts Phenotype of rcp45 and rcp45-456 is Maintained After Replication in Chimpanzees
The level of temperature sensitivity of isolates obtained from chimpanzees infected with rcp45-456 and rςp45 was examined to determine whether the two recombinants retained their ts phenotype following replication in a highly permissive host. Isolates from the two studies were evaluated separately because ofthe large number of isolates obtained. Analysis of isolates from two individual animals from experiment 1 is shown in Table 9, and a summary of all the animals is shown in Table 10. The level of temperature-sensitivity of identical control virus suspensions differed in the two experiments by 1°C (Table 10), indicative of experimental variability in the assay. For example, the temperature at which plaques were not observed for rcp45-456 versus rcp45 was 38°C and 39°C, respectively, in experiment 1 compared to 39°C and 40°C, respectively, in experiment 2 (Table 10). This level of experimental variability is sometimes observed. Importantly, in all experiments the difference in the shut-off temperature of plaque formation between rcp45-456 and rcp45 was consistent at 1°C. Because ofthe experimental variability between the two studies, they are summarized separately in Table 10. Each isolate retained the ts phenotype, and the level of temperature sensitivity ofthe isolates did not differ from that ofthe control input viruses throughout the course of replication in respiratory tract ofthe chimpanzee. Significantly, the percentage of rcp45-456 isolates plaquing at 38°C and 39°C was lower than that ofthe rcp45 isolates indicating that the greater level of temperature sensitivity of rcp45-456 observed in vitro is maintained following replication in vivo.
Table 9: Both rcp45 and rcp45-456 maintain their ts phenotype following replication in seronegative chimpanzees: analysis of samples from two individual animals ; from expei ment 1 and comparison of contr ols from tw Ό experiments
Virus isolates or control Isolates0 Virus titerd (logiopfu/ml) at the indicated temperature tissue dav 32°C 36°C 37°C 38°C 39°C 40°C rcp45-456vιruse!i NP 1 7.1 <3.7 <2.7 <0.7 <0.7 <0.7
(Animal #1614) NP 2 7.3 <3.7 <2.7 <0.7 <0.7 <0.7
NP 3 7.7 <3.7 <2.7 <0.7 <0.7 <0.7
NP 4 8.0 4.4 4.2 <0.7 <0.7 <0.7
NP 5 7.8 4.3 4.2 <0.7 <0.7 <0.7
NP 6 7.3 4.2 4.0 <0.7 <0.7 <0.7
NP 7 6.9 3.7 3.0 <0.7 <0.7 <0.7
NP 8 7.7 <3.7 3.0 <0.7 <0.7 <0.7
NP 9 7.5 5.3 4.8 <0.7 <0.7 <0.7
NP 10 7.8 5.4 4.2 <0.7 <0.7 <0.7
TL 2 7.8 4.7 2.7 <0.7 <0.7 <0.7
TL 4 7.4 4.0 <2.7 <0.7 <0.7 <0.7 rcp45 NP 1 7.0 ND 4.7 4.2 <0.7 <0.7
(Animal #1616) NP 2 7.5 ND 4.4 3.7 <0.7 <0.7
NP 3 7.3 ND 3.7 <0.7 <0.7 <0.7
NP 4 7.4 ND 4.5 <0.7 <0.7 <0.7
NP 5 6.3 ND 4.0 <0.7 <0.7 <0.7
NP 6 7.2 ND 4.9 3.4 <0.7 <0.7
NP 7 5.8 ND <3.7 <0.7 <0.7 <0.7
NP 8 5.9 ND 4.5 2.2 <0.7 <0.7
NP 13 6.9 ND 4.3 3.4 <0.7 <0.7
TL 2 7.5 5.3 4.3 3.3 <0.7 <0.7
TL 4 7.2 5.7 4.5 <0.7 <0.7 <0.7 rcp45-456a 8.4 6.0 4.6 <0.7 <0.7 <0.7 rcp45 a 8.0 7.0 5.8 3.4 <0.7 <0.7 rwta a 7.2 7.2 7.3 7.0 6.9 7.0 rcp45-456b 8.3 7.0 5.0 3.0 <0.7 <0.7 rcp45 b 7.8 7.5 6.3 4.8 2.3 <0.7 rwtb 7.8 7.6 7.4 7.5 7.4 7.2 a Control virus suspensions. , study #1. b Control virus suspensions. , study #2 (see Table 10). i'irus isolates were harvested following passage of chimpanzee nasopharyngea swabs and tracheal lavage specimens in LLC-MK2 cells at 30°C. ' 1 Virus isolates i were titered on LLC-MK2 monolayer cultures at the indicated temperature for 6 days, and plaques were enumerated b y immunoperc )xidase staining using anti-HPIV3 HN monoclonal antibodies. ND= not determined.
Table 10: Both τcp45 and rc ?45-456 maintain their temperature-sensitive phenotypes following replication in seronegative chimpanzees: summary of two experiments
Virus used to infect Percentage of isolates with viral { )laques detected at indicated temperature animal Total no. of 36°C 37°C 38°C 39°C 40°C
(no. of animals) isolates
Experiment 1 rep 45 (2) 20a 100 95 70 0 0 rcp45-456(4) 42b 83 60 0 0 0
Experiment 2 rcp45(2) 25° 100 100 100 72 0 rcp45-456(2) 22d 100 86 91 5 0
Isolates were obtained as described in Material and Methods and th shut-off temperature of plaque formation was determined by efficiency of plaquing at the indicated temperatures (see Materials and Methods, and Table 9). a Total number includes 18 nasopharyngeal and 2 tracheal lavage isolates. b Total number includes 39 nasopharyngeal and 3 tracheal lavage isolates.
0 Total number includes 20 nasopharyngeal and 5 tracheal lavage isolates. d Total number includes 21 nasopharyngeal and 1 tracheal lavage isolates.
The foregoing results demonstrate that the mutation in RSV cpts530, namely substitution ofthe parental phenylalanine at position 521 in the L protein, confers a similar level of temperature sensitivity and attenuation when introduced into the corresponding position (456) in the L protein of PIV3. RSV and PIV3 represent separate subfamilies within the paramyxovirus family, namely Pneumovirinae and
Paramyxovirinae, respectively. The two viruses share unambiguous, statistically significant sequence relatedness for their L proteins (Stec et al. Virology 183:273-287 (1991)), particularly in a region of approximately 540-570 amino acids which lies near the amino-terminus (aa 422-938 of RSV and 357-896 of PIV3) and which includes four highly-conserved polymerase motifs described by Poch et al. (J. Gen. Virol. 5:1153-62 (1990); and Stec et al. Virology 183:273-287 (1991)). The mutation described here, at position 521 in RSV and 456 in PIV3, lies within this general region but is approximately 175 residues upstream ofthe first conserved motif identified by Poch et al. Notably, this residue is strictly conserved, as is a leucine residue located 12 residues C-terminal to its position (Figure 1 , panel A), among thirteen heterologou s paramyxoviruses tested in the present study. Despite this strict conservation, without prior identification ofthe 521 L mutation in the RSV cpt_f530 mutant and successful transfer of this mutation to a conserved position in the HPIV3 L protein, it would not have been possible to predict that this residue, out ofthe 2233 positions in the amino acid sequence ofthe PIV3 L protein, would be an appropriate target site for mutagenesis to yield a conditional-lethal attenuated recombinant. In view of these results, it is now possible to extend the methods ofthe invention to embrace the large number of attenuating mutations recently identified among diverse members ofthe Mononegavirales, particularly the paramyxoviruses (Bukreyev et al.. J. Virol. 71(12). 8973-8982 (1997); Garcin et al.. Virology 238(2):424-431 (1997); Juhasz et al., Vaccine 17:1416-1424 (1999); Juhasz et al.. J. Virol. 71(8 :5814-5819
(1997); Kato et al, EMBO J. 16(3):578-587 (1997a); Kato et al., J. Virol. 7i(10):7266- 7272 (1997b); Kondo et al., J. Biol Chem. 268(29) :21924-21930 (1993); Kurotani et al., Genes Cells 3(2):111-124 (1998): Skiadopoulos et al.. J. Virol. 72(3): 1762-8 (1998); Whitehead et al., J. Virol. 73:871-877 and 73:3438-3442 (1999); Whitehead et al., Virology 247(2):232-239 (1998a); Whitehead et al, J. Virol. 73(2):871-877 (1999b); Whitehead et al., J. Virol. 72(5):4467-4471 (1998b), each incoφorated herein by reference).
The present findings provide novel PIV vaccine candidates and also enable transfer of attenuating mutations from RSV to other paramyxoviruses wherein the
mutation maps to a conserved parental residue/position. Further in this context, the 521 L mutation of RSV is amenable to importation into recently developed chimeric PIV3 recombinants having the hemagglutinin-neuraminidase (HN) and F genes of JS wt PIV3 replaced by those of PIV1 (Tao et al., J. Virol. 72(4), 2955-2961 (1998), incoφorated herein by reference). This chimeric recombinant can be attenuated further by incoφoration of one or more additional mutations identified in the cp45 mutant, which mutations have now been incoφorated in their entirety (with the exception ofthe three mutations occurring in the F and HN genes) within an infectious, attenuated, chimeric PIV3-1 clone bearing the PIV1 HN and F genes substituted within a JS wt PIV3 background.
EXAMPLE III
Heterologous Transfer of an Attenuating Mutation in the C Protein of Sendai Virus into a Recombinant HPIV3 Vaccine Candidate
The present example describes heterologous transfer of a known attenuating mutation in the C protein of Sendai virus (SeV), marked by a substitution of phenylalanine (F) to serine (S) at position 170 (Itoh et al., J. Gen. Virol. 78:3207-3215 (1997), incoφorated herein by reference), to a corresponding position in a recombinant HPIV3 clone. As described above and illustrated in Table 4, The F170 parental sequence element maps to an identically conserved sequence position/residτ.^ F164 in the HPIV3 C protein, which element is also conserved in SeV and BPIV-3.
The F170S mutation of SeV was transferred to a recombinant HPIV3 virus rF164S by introduction of a point mutation into the C ORF of HPIV3, changing amino acid position 164 from phenylalanine (F) to serine (S). The resulting rF164S recombinant was suφrisingly, more attenuated in the upper than the lower respiratory tract. This pattern is the converse of that seen with temperature-sensitive attenuating mutations, whereby inclusion of this novel mutation in recombinant, live-attenuated vaccine viruses will prove useful in reducing residual virulence in the upper respiratory tract. The rF164S recombinant also conferred protection against challenge with wildtype HPIV3.
The P and C proteins of HPIV3 are translated from separate, overlapping ORFs in the mRNA (Fig. 3). Whereas all paramyxoviruses encode a P protein, only members ofthe genera Respirovirus and Morbillivirus encode a C protein. Individual
viruses vary in the number of proteins expressed from the C ORF and in its importance in replication ofthe virus in vitro and in vivo. Sendai virus (SeV) expresses four independently initiated proteins from the C ORF: C, C, Yl, and Y2, whose translational start sites appear in that order in the mRNA (Curran, et al., Enzyme 44:244-9 (1990); Lamb et al., p. 181-214, in D. Kingsbury (ed.), The Paramyxoviruses. Plenum Press, New York (1991), whereas HPIV3 and measles virus (MeV) express only a single C protein (Bellini et al., J Virol. 53:908-19, (1985); Sanchez et al., Virology 147:177-86 (1985); Spriggs et al., J. Gen. Virol. 67:2705-2719 (1986)).
A viable recombinant SeV in which all four C-derived proteins were ablated was found to replicate extremely inefficiently in vitro (Kurotani et al., Genes Cells 3:111-124 (1998)), whereas ablation of individual C proteins had complex effects (Cadd et al.. J Virol. 70:5067-74 (1996); Curran, et al.. Virology 189:647-56 (1992); Latorre et al., J Virol. 72:5984-93 (1998)).
A recombinant SeV bearing a single point mutation resulting in a phenylalanine (F) to serine (S) substitution at amino acid position 170 ofthe C protein was attenuated in mice, but its replication in cell culture was not impaired (Garcin et al., Virology 238:424-431 (1997); Itoh et al., J. Gen. Virol. 78:3207-15 (1997)). In marked contrast to SeV, a C-minus measles virus (MeV) replicated efficiently in Vero cells (Radecke et al., Virology 217:418-21 (1996)), although it exhibited restriction of replication in human peripheral blood cells and appeared to be only somewhat attenuated in vivo (Escoffier et al, J Virol. 73:1695-8 (1999); Valsamakis et al., J Virol. 72:7754-61 (1998)).
The altered replication ofthe various MeV and SeV C mutants in animals suggests that this protein is a potential target for the introduction of attenuating mutations useful in the development live attenuated HPIV3 vaccines. In the present example, reverse genetics methodology was used to introduce a mutation into the C ORF of HPIV3 which created a F-→S change at amino acid position 164, which corresponds to the F-→S change at amino acid position 170 in a heterologous, attenuated SeV mutant.
Cells and Viruses
HEp-2 and simian LLC-MK2 monolayer cell cultures were maintained in OptiMEM 1 (Life Technologies, Gaithersburg, MD) supplemented with 2% fetal bovine serum, gentamicin sulfate (50ug/mL), and 4mM glutamine. The modified vaccinia strain
Ankara (MVA) recombinant virus that expresses bacteriophage T7 RNA polymerase was generously provided by Drs. L. Wyatt and B. Moss (Wyatt et al., Virology 210:202-205 (1995)). The JS wildtype (wt) strain of PIV3 and its attenuated ts derivative, JS cp45, were propagated in LLC-MK2 cells as described previously (Hall et al, Virus Res. 22:173-184 (1992)).
cDNAs
The full-length cDNA clone encoding the complete 15462 nt antigenome {p3/7(131)2G} ofthe JS wt virus was described previously (Genebank accession #Z11575) (Durbin et al., Virology 235:323-332 (1997)). This clone was used as the template for the construction of a mutated cDNA encoding a phenylalanine to serine change at amino acid position 164 ofthe C ORF (Table 11, Fig. 3). The Pmll to BamHI fragment of p3/7(131)2G (nt 1215-3903 ofthe PIV3 antigenome) was subcloned into the plasmid pUC 119 {pUC 119(PmlI-BamHI) } which had been modified to include a Pmll site in the multiple cloning region. Site-directed mutagenesis was then performed on pUCl 19(PmlI -BamHI) using Kunkel's method (Kunkel et al., Methods Enzymol. 154:367-382, 1987) to introduce mutations in the C ORF.
Table 11: Nucleotide change introduced into rPIV3 to yield rF164S virus.
Nucleotide sequence of wt/mutated sequence rPIV3 Amino acid SEQ. designation substitution ID NO. rF164S Phe-164 to Ser 2276-GCA AAT GTT CCA AGC GAG ATA TC 5
GCAAATGTCCCA AGC GAG ATA TC 6
1 The nucleotide sequence ofthe mutated region is shown and compared with wildtype (wt) sequence. The first nucleotide in the sequence is numbered according to its position in the complete antigenome RNA. Sequences as blocked is the P open reading frame. Nucleotides underlined are the codon for the C ORF at amino acid position 164 for HP 103.
Construction of Antigenomic cDNA Encoding Virus with the F164S Mutation in the C ORF (rF164S)
A phenylalanine (F) to serine (S) change at amino acid position 164 ofthe C ORF was created using a mutagenic primer which introduced an A to G change at nt position 2284 ofthe full-length antigenome. This mutation was also silent in the P ORF. The Pmll to BamHI fragment ofthe full-length clone was sequenced in its entirety to confirm the presence ofthe introduced mutation and to confirm that other mutations had not been introduced incidently. The fragment was then separately cloned back into the full-length clone p3/7(131)2G as previously described (Durbin et al., Virology 235:323- 332 (1997)) to create the antigenomic cDNA clone.
Recovery of a Recombinant C F164S Mutant from cDNA
The full-length antigenomic cDNA bearing the C F164S mutation was transfected into HEp-2 cells on six-well plates (Costar, Cambridge, MA) together with the support plasmids {pTM(N), pTM (P no C), and pTM (L)} using LipofectACE (Life Technologies) and infected with MVA-T7 as previously described (Durbin et al., Virology 235:323-332, 1997). pTM(P no C) is identical to the pTM(P) plasmid described previously (Durbin et al., Virology 234:74-83 (1997)) with the exception that the C transcriptional start site had been mutated from ATG to ACG, changing the first amino acid in the C ORF from methionine to threonine. After incubation at 32°C for three days, the transfection harvest was passaged onto a fresh LLC-MK2 cell monolayer in a T25 flask and incubated for 5 days at 32°C (referred to as passage 1). The amount of virus present in the F164S harvest was determined by plaque titration on LLC-MK2 monolayer cultures with plaques visualized by immunoperoxidase staining with PIV3 HN-specific monoclonal antibodies as described previously (Durbin et al., Virology 235:323-332 (1997)).
The F164S recombinant virus present in the supernatant of passage 1 harvest was then plaque purified three times on LLC-MK2 cells as previously described (Hall et al., Virus Res. 22:173-184 (1992)). The biologically cloned recombinant virus from the third round of plaque purification was then amplified twice in LLC-MK2 cells at 32°C to produce virus for further characterization.
Sequence Analysis of Recovered Recombinant Viruses
Virus was concentrated from clarified medium from infected cell monolayers by polyethylene glycol precipitation as described previously (Durbin et al., Virology 235 :323-332 (1997)). The RNA was purified with TRIzol reagent (Life Technologies) following the manufacturer's recommended procedure. RT-PCR was performed with the Advantage RT-for-PCR kit (Clontech, Palo Alto, CA) following the recommended protocol. Control reactions were identical except that reverse transcriptase was omitted from the reaction to confirm that the PCR products were derived solely from viral RNA and not from possible contaminating cDNA plasmids. Primers were used to generate the PCR fragment spanning nucleotides 1595-3104 ofthe full-length antigenome. This fragment includes the entire C, D and V ORFs ofthe recombinant viruses. The resultant PCR products were then sequenced using cycle dideoxynucleotide sequence analysis (New England Biolabs, Beverly, MA).
Protein Analysis by Immunoprecipitation
Two PIV3 C-specific antisera were raised in rabbits by the multiple antigen peptide (MAP) technique against two different C peptides (Research Genetics, HuntsviUe, AL). The two peptides spanned amino acid regions 30-44 and 60-74 ofthe C protein. Eight copies of each C peptide were placed on a branched carrier core and injected separately into rabbits (two rabbits per peptide) with Freund's adjuvant. The rabbits were boosted with the designated MAP at 2 and 4 weeks and bled at 4, 8, and 10 weeks. Each antiserum recognized the C peptide used as an immunogen in high titer and precipitated C protein from HPIV3 infected cells in a radioimmunoprecipitation assay (RIPA).
T25 cell monolayers of LLC-MK2 cells were infected at a multiplicity of infection (MOI) of 5 with either rF164S, recombinant JS wt virus (rJS) or were mock infected and incubated at 32°C. At 24 hours post-infection, the monolayer was washed with methionine-minus DMEM (Life Technologies) and incubated in the presence of 10 uCi/w/ of 35S methionine in methionine-minus DMEM for an additional 6 hours. The cells were then harvested, washed 3 times, and resuspended in 1 ml RIPA buffer { 1% (w/v) sodium deoxycholate, 1% (v/v) Triton X-100, 0.2% (w/v) SDS, 150mM NaCl, 50mM Tris-HCl, pH 7.4}, freeze-thawed and pelleted at 6500XG. The cell extract was
transferred to a fresh eppendorf tube and a mixture of both C antisera (5ul each) was added to each sample and incubated with constant mixing for 2 hours at 4°C. 1 Out of a mixture of mAb 454/11 and 101/1, which recognize the HN glycoprotein of HPIV3 (van Wyke Coelingh et al., J Virol. 6J.:1473-1477 (1987)), were added to each sample to confirm that recovered virus was indeed HPIV3. Immune complexes were precipitated by adding 200ul of a 10% suspension of protein A Sepharose beads (Sigma, St. Louis, MO) to each sample followed by constant mixing at 4°C overnight. Each sample was denatured, reduced, and analyzed on a 4-12% polyacrylamide gel (NuPAGE, Novex, San Diego, CA) per the manufacturer's recommendations. The gel was dried and analyzed by autoradiography.
Multicycle Replication of rPIV3s
Monolayers of LLC-MK2 cells in T25 flasks were infected in duplicate with rF 164S or rJS at an MOI of 0.1 and incubated at 32°C in 5% CO2. 250ul samples were removed from each flask at 24 hour intervals for 5 consecutive days and were flash frozen. An equivalent volume of fresh media was replaced at each time point. Each sample was titered on LLC-MK2 cell monolayers in 96-well plates incubated for 7 days at 32°C. Virus was detected by hemadsoφtion and reported as log.o TCIDso/ml.
Animal Studies
4-6 week-old golden Syrian hamsters in groups of 21 were inoculated intranasally with 0.1 ml per animal of EMEM (Life Technologies) containing 105 PFU of rF164S, rJS, cp45 (the biologically-derived live attenuated derivative of JS wt virus), or respiratory syncytial virus (RSV). On days 3, 4, and 5 post-inoculation 5 hamsters from each group, except those which received RSV, were sacrificed and the lungs and nasal turbinates harvested. The nasal turbinates and lungs were homogenized to prepare a 10% or 20% w/v suspension in L-15 (Quality Biologicals, Gaithersburg, MD) respectively, and the samples were rapidly frozen. Virus present in the samples was titered on 96 well plates of LLC-MK2 cell monolayers incubated at 32°C for 7 days. Virus was detected by hemadsoφtion and the mean log.o TCID5o/g was calculated for each day for each group of five hamsters. Sera were collected from the remaining 6 hamsters in each group on days 0 and 28 post-inoculation. Serum antibody responses to each virus was evaluated by
hemagglutination-inhibition (HAI) assay as previously described (van Wyke Coelingh et al., Virology 143:569-582 (1985)). On day 28 the remaining hamsters in each group, including those immunized with RSV, were challenged intranasally with 106 PFU of biologically-derived PIV3 JS wt virus. The animals were sacrificed on day 4 post- challenge and the lungs and nasal turbinates were harvested and processed as described above. The quantity of virus present in the challenge samples was determined as described above.
African Green monkeys (AGMs) in groups of 4 animals each were inoculated intranasally and intratracheally with 106 PFU of either rF164S, JSwt, or cp45 as previously described for earlier studies in rhesus monkeys (Durbin et al., Vaccine 16:1324-30 (1998)). Nasopharyngeal swab samples were collected daily for 12 consecutive days post-inoculation and tracheal lavage samples were collected on days 2, 4, 6, 8, and 10 post-inoculation. The specimens were flash frozen and stored at -70°C until all specimens had been collected. Virus present in the samples was titered on LLC- MK2 cell monolayers in 96 well plates that were incubated at 32°C for 7 days. Virus was detected by hemadsoφtion and the mean log.o TCID5o/ml was calculated for each day. Serum was collected from each monkey on days 0 and 28, and the PIV3 HAI antibody response to experimental infection with the various mutants and the PIV3 wild type (JS) was determined. On day 28 post-inoculation, the AGMs were challenged with 106 PFU ofthe biologically-derived PIV3 wild type virus administered in a 1ml inoculum intranasally and intratracheally. Nasopharyngeal swab samples were collected on days 0,
1, 2, 4, 6, 8, 10, and 12 post-challenge and tracheal lavage samples were collected on days
2, 4, 6, 8, and 10 post-challenge. Specimens were flash frozen, stored, and virus present was titered as described above.
RESULTS
Recovery of Recombinant Mutant rF164S
An HPIV3 antigenomic cDNA was prepared to encode the mutant virus rF164S, in which the C protein aa residue 164 was changed from F to S. The mutation was translationally silent in the overlapping P ORF (Table 11).
The antigenomic cDNA was transfected into HEp-2 cells along with the three PIV3 support plasmids {pTM(P no C), pTM(N), pTM(L)} and the cells were
simultaneously infected with MVA expressing the T7 RNA polymerase. The efficiency of recovery of rPIV3 containing the mutation in the C ORF was compared with that of a similarly transfected-infected HEp-2 cell culture using the p3/7(131)2G, the plasmid expressing full-length PIN3 antigenome from which recombinant JSwt PIV3 (rJS) was previously recovered (Durbin et al., Virology 235:323-332 (1997)). After incubation for 3 days at 32°C the transfected cells were harvested, and supernatant was passaged onto a fresh monolayer of LLC-MK2 cells in a T25 flask and incubated for 5 days at 32°C (passage 1). After 5 days at 32°C, the LLC-MK2 cell monolayer of rJS and rF164S exhibited 3-4+ cytopathic effect (CPE). After three rounds of biological cloning by plaque isolation, the recombinant mutant was amplified twice in LLC-MK2 cells to produce a suspension of virus for further characterization.
To confirm that the recovered virus was indeed the expected rF164S mutant, the cloned virus was analyzed by RT-PCR using a primer pair which amplified a fragment of DΝA spanning nt 1595-3104 ofthe HPIV3 antigenome, which includes the portion ofthe P gene containing the C, D, and V ORFs. The generation of PCR product was dependent upon the inclusion of RT, indicating derivation from RΝA and not from contaminating cDΝA. Nucleotide sequencing was conducted on the RT-PCR product to confirm the presence ofthe introduced mutation. The introduced mutation was confirmed to be present in the RT-PCR fragment spanning nt 1595-3104 amplified from the cloned recombinant, and other incidental mutations were not found.
Radioimmunoprecipitation assay (RIPA) was performed to compare the rF164S mutant virus with the rJS wt virus. Cells were infected, incubated in the presence of 35S methionine from 24 to 30 h post-infection, and cell lysates were prepared. Equivalent amounts ofthe total protein were incubated with anti-C and anti-HN antibodies and the antibody was then bound to protein A sepharose beads. rJS and rF164S each encoded both HN and C proteins (Fig. 4). The C protein expressed by rF164S appeared to be of identical size as that expressed by the parent rJS and was expressed in similar quantity as well (Fig. 4).
Replication of rF164S in Cell Culture
Duplicate cultures of LLC-MK2 cell monolayers were infected with rF164S or rJS at an MOI of 0.1 and incubated for 5 days at 32°C. Medium from each culture was sampled at 24 hour intervals and this material was subsequently titered to
evaluate the replication of each virus in cell culture. Replication of rF164S was essentially indistinguishable from that ofthe parent rJS wt with regard to both the rate of virus production and the final titer (Fig. 5) as well as the ability to replicate at elevated temperature.
Replication of rF164S in Hamsters
The rF164S mutant virus was next compared with the rJS wt parent for the ability to replicate in the upper and lower respiratory tract of hamsters. Groups of hamsters were inoculated intranasally with 105 pfu per animal of rF164S or cp45, the biologically-derived vaccine candidate. Compared to rJS, replication of rF164S was reduced one hundred to five hundred-fold in upper respiratory tract and was reduced more than ten-fold in the lower respiratory tract ofthe hamsters (Table 12). The hamsters which were infected with rF164S and rJS had a significant antibody response to HPIV3 and exhibited a high level of restriction of replication of PIV3 challenge virus (Table 13).
Table 12: The rF164s virus is attenuated in the upper and lower respiratory tracts of hamsters.
Mean virus titer (log10TCID50/g±S.E.2 on day post-infection
Day3 Day 4 Day 5
Virus Nasal turb. Lungs Nasal turb. Lungs Nasal turb.
Xψ 5 4.7±0.2 2.7±0.2 5.0±0.5 2.8±0.5 5.4±0.3
rF164S 4.0±0.2 5.3±0.3 4.7±0.3 5.4±0.2 4.4±0.6
rJS 6.7±0.3 6.8±0.5 7.4±0.2 6.6±0.4 6.6±0.2
1 Groups of 5 hamsters were inoculated intranasally with 105 pfu of indicated virus. cpAS is a biologically-derived virus,
2 Standard error.
3 Means in each column with a different letter are significantly different (a=0.05) by Duncan's Multiple Range test wherea different
Table 13: The rF164S virus is immunogenic and protective against challenge with PIV3 wt virus in hamsters.
Response to Challenge
Immunizing Serum HAI Antibody Titer Mean PIV3 titer^ (log10TCID50/g) ± S.E.
Virus1 (reciprocal mean log2 ± S.E.) Nasal turb. Lungs rF 164S 10.8 ± 0.2 < 1.5 ± 0.0 < 1.2 ± 0.0 cp45 11.8 ± 0.3 < 1.5 ± 0.0 < 1.2 ± 0.0 rJS 12.1 ± 0.2 < 1.5 ± 0.0 < 1.2 ± 0.0
RSV < 2.0 ± 0.0 7.0 ± 0.2 4.7 ± 0.0
' Indicates virus used to immunize groups of six hamsters on Day 0.
2 On day 28, all hamsters were bled to determine the serum HAI antibody titer and were challenged with 106 PFU biologically-derived JS wt HPIV3. Lungs and nasal turbinates were harvested on day 4 post- challenge.
Replication of rF164S in Primates
To further evaluate the attenuation phenotype and protective efficacy of rF164S, this recombinant mutant was administered to a group of four AGMs, and its replication in the upper and lower respiratory tracts was compared with that of cp45 and JS wt. Replication of rF 164S was 100-fold or more reduced in the upper respiratory tract ofthe AGMs. The attenuation observed for this virus in the upper respiratory tract was comparable to that of cp45 (Table 14). rF164S was moderately (<10-fold) restricted in the lower respiratory tract ofthe AGMs. The recombinant virus induced an HAI antibody response to HPIV3 (Table 14). The immunized AGMs were challenged on day 28 with 106 PFU biologically-derived JS wt virus given IN and IT. The animals which had received rF164S or the cp45 vaccine candidate virus were completely protected against replication of challenge virus in both the upper and lower respiratory tracts ofthe AGMs.
Table 14: rF164S is attenuated and induces a serum HAI antibody response in African Green monkeys
Mean peak titer
Mean peak titer Serum HAI (log10TCID50/ml)±S.E. of
(log10TCID50/ml)±S.E.2 antibody titer on challenge virus4 day 28
Virus1 Nasopharyn Tracheal Number (reciprocal mean NasopharynTracheal geal swab lavage of animals log2±S.E.)3 geal swab lavage rF164S 4.3±0.3 (C)5 5.8±0.2 (B)5 4 12.5±0.3 <0.5±0.0 <0.5±0.0 cp45 5.1±0.4 (B) 5.3±0.1 (C) 4 12.0±0.6 <0.5±0.0 <0.5±0.0
JSwt 6.3±0.2 (A) 6.6±0.1 (A) 6 13.2±0.2
1 AGMs were inoculated intranasally and intratracheally with 106 PFU of indicated virus on day 0.
2 Standard error.
3 The mean serum HAI antibody titer (reciprocal mean log2) on day 0 was ±2.0.
4 Animals were challenged on day 28 with 106 PFU HPIV3 JS wt virus given intranasally and intratracheally.
5 Means in each column with a different letter are significantly different α =0.05) by Duncan's Multiple Range test whereas those with the same letter are not significantly different.
6 Two animals in this group received the recombinant JS wt virus rJS and 4 animals received the biologically-derived JSwt virus. Peak mean titers ofthe two viruses was not different (6.4 vs 6.3 in the upper respiratory tract and 6.6 vs 6.7 in the lower respiratory tract). Because the peak titers were not different, the groups were combined for further analyses.
Summarizing the above example, the F170S mutation in SeV was generated biologically by adapting the virus to growth in LLC-MK2 simian cells (Garcin et al. Virology 238:424-431 (1997), and Itoh et al.. J. Gen. Virol. 78:3207-15 (1997)). Although recombinant SeV with the F170S mutation demonstrates enhanced replication in vitro, this mutant is highly restricted in replication in mice, being as impaired in replication as the SeV C7C mutant (Garcin et al., Virology 238:424-431 (1997) and Latorre et al., J Virol. 72:5984-93 (1998)). Since the C proteins of SeV and HPIV3 are only 38% homologous, it was suφrising to find that importation ofthe F170S mutation of SeV into HPIV3 caused attenuation in vivo.
The HPIV3 recombinant rF164S, which bears the mutation at the amino acid residue of HPIV3 corresponding to position 170 of SeV, was not restricted in replication in vitro but was significantly attenuated in both the upper and lower respiratory tracts of hamsters and in the upper and lower respiratory tracts of AGMs. rF164S induced a serum antibody response comparable to that of wt PIV3 infection and completely protected both hamsters and AGMs against challenge with wt HPIV3. These
results indicate that the F164S mutation will be useful in developing a live attenuated vaccine against HPIV3.
DEPOSIT OF BIOLOGICAL MATERIAL
The following materials have been deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, VA 20110-2209, under the terms ofthe Budapest Treaty.
Virus Accession No. Deposit Date p3/7(131)2G (ATCC 97989) April 18, 1997 p3/7(131) (ATCC 97990) April 18, 1997 p218(131) (ATCC 97991) April 18, 1997 cpts RSV 248 (ATCC VR 2450) March 22, 1994 cpts RSV 530/1009 (ATCC VR 2451) March 22, 1994 RSV cpts530 (ATCC VR 2452) March 22, 1994 cpts RSV 248/955 (ATCC VR 2453) March 22, 1994 cpts RSV 248/404 (ATCC VR 2454) March 22, 1994 cpts RSV 530/1030 (ATCC VR 2455) March 22, 1994 RSV B-1 cp52/2B5 (ATCC VR 2542) September 26, 1996
A2 ts530-s cllcp, or t_?530-sites (ATCC VR 2545) October 17, 1996
RSV B-1 cp-23 (ATCC VR 2579) July 15, 1997
Although the foregoing invention has been described in some detail by way of illustration and example for puφoses of clarity of understanding, it will be obvious that certain changes and modifications may be practiced within the scope ofthe appended claims.
Claims
1. A method for producing an isolated, attenuated, recombinant negative stranded RNA virus from one or more isolated polynucleotide molecules encoding said negative stranded RNA virus, comprising:
coexpressing in a cell or cell-free system one or more expression vector(s) which comprises one or more polynucleotide molecule(s) encoding a recombinant genome or antigenome and essential viral proteins necessary to produce an infectious viral particle of said recombinant negative stranded RNA virus, said recombinant genome or antigenome modified to encode a mutation within a recombinant protein of said recombinant virus at an amino acid position corresponding to an amino acid position of an attenuating mutation identified in a heterologous, mutant negative stranded RNA virus, which mutation by incoφoration within said recombinant protein confers an attenuated phenotype on said recombinant virus.
2. The method of claim 1 , wherein said recombinant negative stranded RNA virus is a respiratory syncytial virus (RSV).
3. The method of claim 2, wherein said RSV is a human RSV subgroup A, human RSV subgroup B, bovine RSV, murine RSV, or avian pneumovirus.
4. The method of claim 2, wherein said heterologous, mutant negative stranded RNA virus is a heterologous RSV, human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
5. The method of claim 4, wherein said heterologous, mutant negative stranded RNA virus is RSV cpts24S (ATCC VR 2450), RSV cpte248/404 (ATCC VR 2454), RSV cpts248/955 (ATCC VR 2453), RSV cpts530 (ATCC VR 2452), RSV cp s530/1009 (ATCC VR 2451), RSV cpts 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), or RSV B-1 cp-23 (ATCC VR 2579).
6. The method of claim 2, wherein said recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within a RSV NS1, NS2, N, P, M, SH, M2(ORFl), M2(ORF2), L, F or G protein.
7. The method of claim 2, wherein said mutation incoφorated within said recombinant protein confers a temperature sensitive (ts) phenotype on said recombinant negative stranded RNA virus.
8. The method of claim 1, wherein said mutation incoφorated within said recombinant protein comprises an amino acid substitution within the RSV L protein.
9. The method of claim 8, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV cpts530 (ATCC VR 2452).
10. The method of claim 1 , wherein said recombinant negative stranded RNA virus is a parainfluenza virus (PIV).
11. The method of claim 10, wherein said PIV is human PIV 1 (HPIVl), human PIV2 (HPIV2), human PIV3 (HPIV3), bovine PIV (BPIV), or murine PIV (MPIV).
12. The method of claim 10, wherein said heterologous, mutant virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
13. The method of claim 10, wherein said recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within a PIV N, P, C, D, V, M, F, HN or L protein.
14. The method of claim 10, wherein the mutation incoφorated within said recombinant protein confers a temperature sensitive (ts) phenotype on said recombinant negative stranded RNA virus.
15. The method of claim 10, wherein said heterologous, mutant negative stranded RNA virus is HPIV3 JS cp45.
16. The method of claim 15, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution within the HPIV3 JS cp45 L protein.
17. The method of claim 16, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of tyrosine at position 942 ofthe L protein of HPIV3 JS cp45.
18. The method of claim 16, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of leucine at position 992 ofthe L protein of HPIV3 JS cp45.
19. The method of claim 16, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of threonine at position 1558 of the L protein of HPIV3 JS cp45.
20. The method of claim 15, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution within the F protein of HPIV3 JS cp45.
21. The method of claim 20, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of isoleucine at position 420 ofthe F protein of HPIV3 JS cp45.
22. The method of claim 20, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of alanine at position 450 ofthe F protein of HPIV3 JS cp45.
23. The method of claim 10, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV cpts530 (ATCC VR 2452).
24. The method of claim 23, wherein the recombinant negative stranded RNA virus is human PIV3 (HPIV3) and said mutation incoφorated within said recombinant protein comprises an amino acid substitution of phenylalanine at position
85 456 ofthe L protein of said HPIV3.
25. The method of claim 10, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 170 ofthe C protein of SeV.
26. The method of claim 25, wherein the recombinant negative
90 stranded RNA virus is human PIV3 (HPIV3) and said mutation incoφorated within said recombinant protein comprises an amino acid substitution of phenylalanine at position 164 ofthe C protein of said HPIV3.
27. The method of claim 1 , wherein said recombinant negative stranded RNA virus is a measles virus (MeV).
95 28. The method of claim 27, wherein said heterologous, mutant virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
100 29. The method of claim 27, wherein said heterologous, mutant negative stranded RNA virus is HPIV3 JS cp45.
30. The method of claim 29, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of tyrosine at position 942 or leucine at position 992 ofthe L protein of
105 HPIV3 JS cp45.
31. The method of claim 1 , wherein the recombinant negative stranded RNA virus is a chimeric virus having a recombinant genome or antigenome comprising a partial or complete genome or antigenome of one species, subgroup, or strain of negative stranded RNA virus combined with a heterologous gene or gene segment of a different
110 species, subgroup, or strain of negative stranded RNA virus.
32. The method of claim 31 , wherein said attenuating mutation is incoφorated within a protein or protein region encoded by said heterologous gene or gene segment.
33. The method of claim 31 , wherein the chimeric virus is a
115 parainfluenza virus (PIV) having a recombinant genome or antigenome comprising a partial or complete genome or antigenome of one PIV species, subgroup, or strain combined with at least one gene or gene segment ofthe HN and F glycoprotein genes of a heterologous PIV species, subgroup, or strain.
34. The method of claim 33, wherein the HN and F genes of human 120 PIV3 are substituted by the HN and F genes of human PIV1.
35. The method of claim 31 , wherein the chimeric virus is a respiratory syncytial virus (RSV) having a recombinant genome or antigenome comprising a partial or complete genome or antigenome of one RSV species, subgroup, or strain combined with at least one gene or gene segment ofthe F, G and SH glycoprotein genes of a
125 heterologous RSV species, subgroup, or strain.
36. The method of claim 35, wherein the F and G glycoprotein of human RSV subgroup A are substituted by the F and G glycoprotein genes of human RSV subgroup B.
37. The method of claim 1 , wherein the recombinant genome or 130 antigenome is further modified to encode one or more additional attenuating mutations adopted from a biologically-derived mutant negative strand RNA virus.
38. The method of claim 7, wherein the recombinant negative stranded RNA virus is a respiratory syncytial virus (RSV) and the recombinant genome or antigenome encodes at least one and up to a full complement of attenuating mutations
135 present within a panel of biologically -derived mutant RSV strains, said panel comprising cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579).
140 39. The method of claim 37, wherein the recombinant negative stranded RNA virus is a parainfluenza virus (PIV) and the recombinant genome or antigenome encodes at least one and up to a full complement of attenuating mutations present within HPIV3 JS cp45.
40. The method of claim 37, wherein the recombinant genome or 145 antigenome includes at least one attenuating mutation stabilized by multiple nucleotide changes in a codon specifying the mutation.
41. The method of claim 1 , wherein the recombinant genome or antigenome is further modified by a nucleotide modification specifying a phenotypic change selected from a change in growth characteristics, attenuation, temperature-
150 sensitivity, cold-adaptation, small plaque size, host range restriction, or a change in immunogenicity.
42. The method of claim 41 , wherein the recombinant negative stranded RNA virus is a respiratory syncytial virus (RSV) and the recombinant genome or antigenome incoφorates a modification ofthe SH, NS1, NS2 or G gene.
155 43. The method of claim 42, wherein the SH, NS 1 or NS2 gene is deleted or expression ofthe gene is ablated.
44. The method of claim 42, wherein the nucleotide modification comprises a nucleotide deletion, insertion, addition or rearrangement of a cis-acting regulatory sequence of a selected RSV gene within the recombinant genome or
160 antigenome.
45. The method of claim 1 , wherein the recombinant negative stranded RNA virus is a subviral particle.
46. An isolated, attenuated, recombinant negative stranded RNA virus comprising:
165 a recombinant genome or antigenome and essential viral proteins necessary to produce an infectious viral particle of said recombinant negative stranded RNA virus, said recombinant genome or antigenome modified to encode a mutation within a recombinant protein of said recombinant virus at an amino acid position corresponding to an amino acid position of an attenuating mutation identified in a 170 heterologous, mutant negative stranded RNA virus, which mutation by incoφoration within said recombinant protein confers an attenuated phenotype on said recombinant virus.
47. The attenuated, recombinant negative stranded RNA virus of claim
46, wherein said recombinant negative stranded RNA virus is a respiratory syncytial virus 175 (RSV).
48. The attenuated, recombinant negative stranded RNA virus of claim
47, wherein said RSV is a human RSV subgroup A, human RSV subgroup B, bovine RSV, murine RSV, or avian RSV.
49. The attenuated, recombinant negative stranded RNA virus of claim 180 47, wherein said heterologous, mutant negative stranded RNA virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
185 50. The attenuated, recombinant negative stranded RNA virus of claim
49, wherein said heterologous, mutant negative stranded RNA virus is RSV cpts248 (ATCC VR 2450), RSV cpt 248/404 (ATCC VR 2454), RSV cpts248/955 (ATCC VR 2453), RSV cpts53Q (ATCC VR 2452), RSV cpts530/1009 (ATCC VR 2451), RSV cpts 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), or RSV B-1 cp-23
190 (ATCC VR 2579).
51. The attenuated, recombinant negative stranded RNA virus of claim 47, wherein said recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within RSV NS1, NS2, N, P, M, SH, M2(ORFl), M2(ORF2), L, F or G gene.
195 52. The attenuated, recombinant negative stranded RNA virus of claim
47, wherein the mutation incoφorated within said recombinant protein confers a temperature sensitive (ts) phenotype on said recombinant negative stranded RNA virus.
53. The attenuated, recombinant negative stranded RNA virus of claim 47, wherein the mutation incoφorated within said recombinant protein comprises an
200 amino acid substitution within the RSV L protein.
54. The attenuated, recombinant negative stranded RNA virus of claim 47, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV cpts530 (ATCC VR 2452).
205 55. The attenuated, recombinant negative stranded RNA virus of claim
46, wherein said recombinant negative stranded RNA virus is a parainfluenza virus (PIV).
56. The attenuated, recombinant negative stranded RNA virus of claim 55, wherein said PIV is human PIV1 (HPIVl), human PIV2 (HPIV2), human PIV3 (HPIV3), bovine PIV (BPIV), or murine PIV (MPIV).
210 57. The attenuated, recombinant negative stranded RNA virus of claim
55, wherein said heterologous, mutant virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis
215 virus (VSV).
58. The attenuated, recombinant negative stranded RNA virus of claim 55, wherein said recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within a PIV N, P, C, D, V, M, F, HN or L protein.
59. The attenuated, recombinant negative stranded RNA virus of claim 220 55, wherein the mutation incoφorated within said recombinant protein confers a fa phenotype on said recombinant negative stranded RNA virus.
60. The attenuated, recombinant negative stranded RNA virus of claim 55, wherein said heterologous, mutant negative stranded RNA virus is HPIV3 JS cp45.
61. The attenuated, recombinant negative stranded RNA virus of claim 225 60, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution within the HPIV3 JS cp45 L protein.
62. The attenuated, recombinant negative stranded RNA virus of claim 60, wherein the attenuating mutation identified in said heterologous, mutant negative
230 stranded RNA virus comprises an amino acid substitution of tyrosine at position 942 of the L protein of HPIV3 JS cp45.
63. The attenuated, recombinant negative stranded RNA virus of claim 60, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of leucine at position 992 ofthe
235 L protein of HPI V3 JS cp45.
64. The attenuated, recombinant negative stranded RNA virus of claim 60, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of threonine at position 1558 of the L protein of HPIV3 JS cp45.
240 65. The attenuated, recombinant negative stranded RNA virus of claim
60, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution within the F protein of HPIV3 JS cp45.
66. The attenuated, recombinant negative stranded RNA virus of claim 245 60, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of isoleucine at position 420 of the F protein of HPIV3 JS cp45.
67. The attenuated, recombinant negative stranded RNA virus of claim 60, wherein the attenuating mutation identified in said heterologous, mutant negative
250 stranded RNA virus comprises an amino acid substitution of alanine at position 450 ofthe F protein of HPIV3 JS cp45.
68. The attenuated, recombinant negative stranded RNA virus of claim 55, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 255 521 of the L protein of human RSV cpts530 (ATCC VR 2452).
69. The attenuated, recombinant negative stranded RNA virus of claim 68, wherein the recombinant negative stranded RNA virus is human PIV3 (HPIV3) and said mutation incoφorated within said recombinant protein comprises an amino acid substitution of phenylalanine at position 456 ofthe L protein of said HPIV3.
260 70. The attenuated, recombinant negative stranded RNA virus of claim
55, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 170 ofthe C protein of SeV.
71. The attenuated, recombinant negative stranded RNA virus of claim 265 70, wherein the recombinant negative stranded RNA virus is human PIV3 (HPIV3) and said mutation incoφorated within said recombinant protein comprises an amino acid substitution of phenylalanine at position 164 ofthe C protein of said HPIV3.
72. The attenuated, recombinant negative stranded RNA virus of claim 46, wherein said recombinant negative stranded RNA virus is a measles virus (MeV).
270 73. The attenuated, recombinant negative stranded RNA virus of claim
72, wherein said heterologous, mutant virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis
275 virus (VSV).
74. The attenuated, recombinant negative stranded RNA virus of claim 72, wherein said heterologous, mutant negative stranded RNA virus is HPIV3 JS cp45.
75. The attenuated, recombinant negative stranded RNA virus of claim 74, wherein the attenuating mutation identified in said heterologous, mutant negative
280 stranded RNA virus comprises an amino acid substitution of tyrosine at position 942 of the L protein of HPIV3 JS cp45.
76. The attenuated, recombinant negative stranded RNA virus of claim 74, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of leucine at position 992 ofthe
285 L protein of HPIV3 JS cp45.
77. An isolated polynucleotide molecule encoding a recombinant genome or antigenome of a recombinant negative stranded RNA virus, said recombinant genome or antigenome modified to encode a mutation within a recombinant protein of said virus at an amino acid position corresponding to an amino acid position of an
290 attenuating mutation identified in a heterologous, mutant negative stranded RNA virus, which mutation by incoφoration within said recombinant protein confers an attenuated phenotype on said recombinant virus.
78. The isolated polynucleotide of claim 1, wherein said recombinant negative stranded RNA virus is a respiratory syncytial virus (RSV).
295 79. The isolated polynucleotide of claim 78, wherein said RSV is a human RSV subgroup A, human RSV subgroup B, bovine RSV, murine RSV, or avian pneumovirus RSV.
80. The method of claim 78, wherein said heterologous, mutant negative stranded RNA virus is a heterologous RSV, human parainfluenza virus (HPIV)l,
300 HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
81. The isolated polynucleotide of claim 78, wherein said recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or
305 insertion within a RSV NSl , NS2, N, P, M, SH, M2(ORFl), M2(ORF2), L, F or G protein.
82. The isolated polynucleotide of claim 78, wherein said mutation incoφorated within said recombinant protein confers a temperature sensitive (ts) phenotype on said recombinant negative stranded RNA virus.
310 83. The isolated polynucleotide of claim 77, wherein said mutation incoφorated within said recombinant protein comprises an amino acid substitution within the RSV L protein.
84. The isolated polynucleotide of claim 83, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises
315 an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV cpts530 (ATCC VR 2452).
85. The isolated polynucleotide of claim 77, wherein said recombinant negative stranded RNA virus is a parainfluenza virus (PIV).
86. The isolated polynucleotide of claim 85, wherein said PIV is
320 human PIVl (HPIVl), human PIV2 (HPIV2), human PIV3 (HPIV3), bovine PIV (BPIV), or Sendai virus (SeV).
87. The isolated polynucleotide of claim 85, wherein said heterologous, mutant virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIN2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle
325 disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
88. The isolated polynucleotide of claim 85, wherein said recombinant genome or antigenome is modified to encode an amino acid substitution, deletion or insertion within a PIV N, P, C, D, V, M, F, HN or L protein.
330 89. The isolated polynucleotide of claim 85, wherein the mutation incoφorated within said recombinant protein confers a temperature sensitive (ts) phenotype on said recombinant negative stranded RNA virus.
90. The isolated polynucleotide of claim 85, wherein said heterologous, mutant negative stranded RNA virus is HPIV3 JS cp45.
335 91. The isolated polynucleotide of claim 90, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution within the HPIV3 JS cp45 L protein.
92. The isolated polynucleotide of claim 91 , wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises
340 an amino acid substitution of tyrosine at position 942 ofthe L protein of HPIV3 JS cp45.
93. The isolated polynucleotide of claim 91 , wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of leucine at position 992 ofthe L protein of HPIV3 JS cp45.
94. The isolated polynucleotide of claim 91 , wherein the attenuating 345 mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of threonine at position 1558 of the L protein of HPIV3 JS cp45.
95. The isolated polynucleotide of claim 90, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises
350 an amino acid substitution within the F protein of HPIV3 JS cp45.
96. The isolated polynucleotide of claim 95, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of isoleucine at position 420 ofthe F protein of HPIV3 JS cp45.
355 97. The isolated polynucleotide of claim 95. wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of alanine at position 450 ofthe F protein of HPIV3 JS cp45.
98. The isolated polynucleotide of claim 85, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises
360 an amino acid substitution of phenylalanine at position 521 ofthe L protein of human RSV cpts530 (ATCC VR 2452).
99. The isolated polynucleotide of claim 98, wherein the recombinant negative stranded RNA virus is human PIV3 (HPIV3) and said mutation incoφorated within said recombinant protein comprises an amino acid substitution of phenylalanine at
365 position 456 ofthe L protein of said HPIV3.
100. The isolated polynucleotide of claim 85, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of phenylalanine at position 170 ofthe C protein of SeV.
101. The isolated polynucleotide of claim 100, wherein the recombinant 370 negative stranded RNA virus is human PIV3 (HPIV3) and said mutation incoφorated within said recombinant protein comprises an amino acid substitution of phenylalanine at position 164 ofthe C protein of said HPIV3.
102. The isolated polynucleotide of claim 77, wherein said recombinant negative stranded RNA virus is a measles virus (MeV).
375 103. The isolated polynucleotide of claim 102, wherein said heterologous, mutant virus is a respiratory syncytial virus (RSV), human parainfluenza virus (HPIV)l, HPIV2, HPIV3, bovine PIV (BPIV), Sendai virus (SeV), Newcastle disease virus (NDV), simian virus 5 (SV5), Mumps virus (MuV), measles virus (MeV), canine distemper virus (CDV), rabies virus (RaV), or vesicular stomatitis virus (VSV).
380 104. The isolated polynucleotide of claim 102, wherein said heterologous, mutant negative stranded RNA virus is HPIV3 JS cp45.
105. The isolated polynucleotide of claim 103, wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of tyrosine at position 942 ofthe L protein of HPIV3 JS cp45.
385 106. The isolated polynucleotide of claim 103 , wherein the attenuating mutation identified in said heterologous, mutant negative stranded RNA virus comprises an amino acid substitution of leucine at position 992 ofthe L protein of HPIV3 JS cp45.
107. The isolated polynucleotide of claim 77, wherein the recombinant negative stranded RNA virus is a chimeric virus having a recombinant genome or 390 antigenome comprising a partial or complete genome or antigenome of one species, subgroup, or strain of negative stranded RNA virus combined with a heterologous gene or gene segment of a different species, subgroup, or strain of negative stranded RNA virus.
108. The isolated polynucleotide of claim 107, wherein said attenuating mutation is incoφorated within a protein or protein region encoded by said heterologous
395 gene or gene segment.
109. The isolated polynucleotide of claim 107, wherein the chimeric virus is a parainfluenza virus (PIN) having a recombinant genome or antigenome comprising a partial or complete genome or antigenome of one PIN species, subgroup, or strain combined with at least one gene or gene segment ofthe HΝ and F glycoprotein
400 genes of a heterologous PIV species, subgroup, or strain.
110. The isolated polynucleotide of claim 109, wherein the ITΝ and F genes of human PIV3 are substituted by the HΝ and F genes of human PIVl.
111. The isolated polynucleotide of claim 107, wherein the chimeric virus is a respiratory syncytial virus (RSV) having a recombinant genome or antigenome
405 comprising a partial or complete genome or antigenome of one RSV species, subgroup, or strain combined with at least one gene or gene segment ofthe F, G and SH glycoprotein genes of a heterologous RSV species, subgroup, or strain.
112. The isolated polynucleotide of claim 111, wherein the F and G glycoprotein of human RSV subgroup A are substituted by the F and G glycoprotein
410 genes of human RSV subgroup B .
113. The isolated polynucleotide of claim 77, wherein the recombinant genome or antigenome is further modified to encode one or more additional attenuating mutations adopted from a biologically-derived mutant negative strand RΝA virus.
114. The isolated polynucleotide of claim 113, wherein the recombinant 415 negative stranded RΝA virus is a respiratory syncytial virus (RSV) and the recombinant genome or antigenome encodes at least one and up to a full complement of attenuating mutations present within a panel of biologically-derived mutant RSV strains, said panel comprising cpts RSV 248 (ATCC VR 2450), cpts RSV 248/404 (ATCC VR 2454), cpts RSV 248/955 (ATCC VR 2453), cpts RSV 530 (ATCC VR 2452), cpts RSV 530/1009 420 (ATCC VR 2451), cpts RSV 530/1030 (ATCC VR 2455), RSV B-1 cp52/2B5 (ATCC VR 2542), and RSV B-1 cp-23 (ATCC VR 2579).
115. The isolated polynucleotide of claim 113, wherein the recombinant negative stranded RNA virus is a parainfluenza virus (PIV) and the recombinant genome or antigenome encodes at least one and up to a full complement of attenuating mutations
425 present within PIV JS cρ45.
116. The isolated polynucleotide of claim 77, wherein the recombinant genome or antigenome includes at least one attenuating mutation stabilized by multiple nucleotide changes in a codon specifying the mutation.
117. The isolated polynucleotide of claim 77, wherein the recombinant 430 genome or antigenome is further modified by a nucleotide modification specifying a phenotypic change selected from a change in growth characteristics, attenuation, temperature-sensitivity, cold-adaptation, small plaque size, host range restriction, or a change in immunogenicity.
118. The isolated polynucleotide of claim 117, wherein the recombinant 435 negative stranded RNA virus is a respiratory syncytial virus (RSV) and the recombinant genome or antigenome incoφorates a modification ofthe SH, NSl, NS2 or G gene.
119. The isolated polynucleotide of claim 117, wherein the SH, NS 1 or NS2 gene is deleted or expression ofthe gene is ablated.
120. The isolated polynucleotide of claim 117, wherein the nucleotide 440 modification comprises a nucleotide deletion, insertion, addition or rearrangement of a cis-acting regulatory sequence of a selected RSV gene within the recombinant genome or antigenome.
121. An expression vector comprising an operably linked transcriptional promoter, a polynucleotide molecule encoding a recombinant genome or antigenome of a
445 recombinant negative stranded RNA virus, and a transcriptional terminator, wherein said recombinant genome or antigenome is modified to encode a mutation within a recombinant protein of said virus at an amino acid position corresponding to an amino acid position of an attenuating mutation identified in a heterologous, mutant negative stranded RNA virus, which mutation by incoφoration within said recombinant protein
450 confers an attenuated phenotype on said recombinant virus.
I l l
122. A method for stimulating the immune system of an individual to induce protection against a negative stranded RNA virus which comprises administering to the individual an immunologically sufficient amount ofthe attenuated, recombinant negative stranded virus of claim 46 combined with a physiologically acceptable carrier.
455 123. The method of claim 122, wherein the attenuated, recombinant negative stranded virus is administered in a dose of 103 to 106 PFU.
124. The method of claim 122, wherein the attenuated, recombinant negative stranded virus is a respiratory syncytial virus (RSV) or parainfluenza virus (PIN).
460 125. An immunogenic composition to elicit an immune response against a negative stranded RΝA virus which comprises an immunologically sufficient amount of the attenuated, recombinant negative stranded virus of claim 46 combined with a physiologically acceptable carrier.
126. The immunogenic composition of claim 122, wherein the 465 attenuated, recombinant negative stranded virus is a respiratory syncytial virus (RSN) or parainfluenza virus (PIV).
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US12900699P | 1999-04-13 | 1999-04-13 | |
| US129006P | 1999-04-13 | ||
| PCT/US2000/009695 WO2000061737A2 (en) | 1999-04-13 | 2000-04-12 | Production of attenuated negative stranded rna virus vaccines |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1171623A2 true EP1171623A2 (en) | 2002-01-16 |
Family
ID=22438049
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP00922075A Withdrawn EP1171623A2 (en) | 1999-04-13 | 2000-04-12 | Production of attenuated negative stranded rna virus vaccines |
Country Status (10)
| Country | Link |
|---|---|
| EP (1) | EP1171623A2 (en) |
| JP (1) | JP4646410B2 (en) |
| KR (1) | KR100760328B1 (en) |
| CN (1) | CN1347458A (en) |
| AU (2) | AU781238B2 (en) |
| BR (1) | BR0011159A (en) |
| CA (1) | CA2369817A1 (en) |
| IL (1) | IL145797A0 (en) |
| MX (1) | MXPA01010392A (en) |
| WO (1) | WO2000061737A2 (en) |
Families Citing this family (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7485440B2 (en) | 1995-09-27 | 2009-02-03 | The United States Of America As Represented By The Department Of Health And Human Services | Production of attenuated respiratory syncytial virus vaccines involving modification of M2 ORF2 |
| US6699476B1 (en) | 1996-07-15 | 2004-03-02 | Peter L. Collins | Production of recombinant respiratory syncytial viruses expressing immune modulatory molecules |
| EP0912724B1 (en) | 1996-07-15 | 2009-12-09 | The Government of The United States of America, as represented by The Department of Health and Human Services | Production of attenuated respiratory syncytial virus vaccines from cloned nucleotide sequences |
| US20030082209A1 (en) | 2000-07-05 | 2003-05-01 | Skiadopoulos Mario H. | Attenuated human-bovine chimeric parainfluenza virus (PIV) vaccines |
| US7201907B1 (en) | 1997-05-23 | 2007-04-10 | The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Attenuated human-bovine chimeric parainfluenza virus(PIV) vaccines |
| US7632508B2 (en) | 1997-05-23 | 2009-12-15 | The United States Of America | Attenuated human-bovine chimeric parainfluenza virus (PIV) vaccines |
| US7951383B2 (en) | 1997-05-23 | 2011-05-31 | The United States Of America As Represented By The Department Of Health And Human Services | Attenuated parainfluenza virus (PIV) vaccines |
| US7192593B2 (en) | 1997-05-23 | 2007-03-20 | The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Use of recombinant parainfluenza viruses (PIVs) as vectors to protect against infection and disease caused by PIV and other human pathogens |
| US7662397B2 (en) | 1997-07-15 | 2010-02-16 | The United States Of America As Represented By The Department Of Health And Human Services | Respiratory syncytial virus vaccines expressing protective antigens from promoter-proximal genes |
| US20040005542A1 (en) | 2001-06-22 | 2004-01-08 | Krempl Christine D | Respiratory syncytial virus vaccines expressing protective antigens from promotor- proximal genes |
| CN100354425C (en) | 1999-07-09 | 2007-12-12 | 美国政府健康及人类服务部 | Production of attenuated human-bovine chimeric respiratory syncytial virus vaccine |
| ATE307606T1 (en) | 2001-10-04 | 2005-11-15 | Ct Voor Onderzoek In Diergenee | ATTENUATED MUTANT STRAIN OF NEWCASTLE DISEASE VIRUS FOR IN OVO VACCINATION AND USE THEREOF |
| AU2003270824B2 (en) * | 2002-09-18 | 2009-02-19 | The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Recovery of recombinant human parainfluenza virus type 2 (HPIV2) from cDNA and use of recombinant HPIV2 in immunogenic compositions and as vectors to elicit immune responses against PIV and other human pathogens |
| EP1603939A2 (en) | 2003-02-28 | 2005-12-14 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES | Recombinant human metapneumovirus and its use |
| WO2004113517A2 (en) | 2003-06-09 | 2004-12-29 | Wyeth | IMPROVED METHOD FOR THE RECOVERY OF NON-SEGMENTED, NEGATIVE-STRANDED RNA VIRUSES FROM cDNA |
| US20100323428A1 (en) * | 2007-02-07 | 2010-12-23 | Dnavec Corporation | Attenuated minus-stranded rna virus |
| WO2011156273A1 (en) * | 2010-06-06 | 2011-12-15 | Mount Sinai School Of Medicine | Recombinant rna viruses and uses thereof |
| CN103525777B (en) * | 2013-07-01 | 2016-05-18 | 中国农业科学院兰州兽医研究所 | Attenuated vaccine strain with L gene mutation of type VII Newcastle disease virus and preparation method thereof |
| AU2018298499B2 (en) * | 2017-07-03 | 2024-07-18 | Bharat Biotech International Limited | A synthetic polypeptide epitope based vaccine composition |
| US20200276297A1 (en) * | 2017-09-15 | 2020-09-03 | Ohio State Innovation Foundation | Vaccines and methods of making and using vaccines for prevention of respiratory syncytial virus (rsv) infections |
| CN111019910B (en) * | 2019-11-04 | 2022-03-15 | 上海青赛生物科技有限公司 | F genotype mumps virus attenuated strain and construction method and application |
| CN111849927B (en) * | 2020-06-28 | 2022-07-08 | 浙江大学 | Method for efficiently producing recombinant nonsegmented negative-sense RNA virus and recombinant virus |
| CN116676275B (en) * | 2023-03-17 | 2024-06-07 | 北京赛尔富森生物科技有限公司 | A-genotype chimeric mumps virus strain and preparation method and application thereof |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5786199A (en) * | 1989-08-28 | 1998-07-28 | The Mount Sinai School Of Medicine Of The City University Of New York | Recombinant negative strand RNA virus expression systems and vaccines |
| US5869036A (en) * | 1995-12-08 | 1999-02-09 | St. Louis University | Live attenuated vaccines based on CP45 HPIV-3 strain and method to ensure attenuation in such vaccine |
| EP0912724B1 (en) * | 1996-07-15 | 2009-12-09 | The Government of The United States of America, as represented by The Department of Health and Human Services | Production of attenuated respiratory syncytial virus vaccines from cloned nucleotide sequences |
-
2000
- 2000-04-12 MX MXPA01010392A patent/MXPA01010392A/en active IP Right Grant
- 2000-04-12 CA CA002369817A patent/CA2369817A1/en not_active Abandoned
- 2000-04-12 EP EP00922075A patent/EP1171623A2/en not_active Withdrawn
- 2000-04-12 BR BR0011159-7A patent/BR0011159A/en not_active IP Right Cessation
- 2000-04-12 WO PCT/US2000/009695 patent/WO2000061737A2/en not_active Ceased
- 2000-04-12 CN CN00806224A patent/CN1347458A/en active Pending
- 2000-04-12 KR KR1020017013102A patent/KR100760328B1/en not_active Expired - Fee Related
- 2000-04-12 AU AU42315/00A patent/AU781238B2/en not_active Ceased
- 2000-04-12 IL IL14579700A patent/IL145797A0/en not_active IP Right Cessation
- 2000-04-12 JP JP2000611661A patent/JP4646410B2/en not_active Expired - Fee Related
-
2005
- 2005-08-12 AU AU2005203596A patent/AU2005203596C1/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO0061737A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2369817A1 (en) | 2000-10-19 |
| KR100760328B1 (en) | 2007-10-04 |
| AU781238B2 (en) | 2005-05-12 |
| AU2005203596B8 (en) | 2009-12-10 |
| JP2002541798A (en) | 2002-12-10 |
| KR20020008831A (en) | 2002-01-31 |
| JP4646410B2 (en) | 2011-03-09 |
| WO2000061737A2 (en) | 2000-10-19 |
| AU2005203596B2 (en) | 2008-09-11 |
| MXPA01010392A (en) | 2003-09-15 |
| WO2000061737A3 (en) | 2001-08-23 |
| IL145797A0 (en) | 2002-07-25 |
| CN1347458A (en) | 2002-05-01 |
| AU2005203596C1 (en) | 2009-12-10 |
| AU4231500A (en) | 2000-11-14 |
| BR0011159A (en) | 2002-07-23 |
| AU2005203596A1 (en) | 2005-09-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20120064569A9 (en) | Production of attenuated negative stranded rna virus vaccines from cloned nucleotide sequences | |
| AU781238B2 (en) | Production of attenuated negative stranded RNA virus vaccines from cloned nucleotide sequences | |
| AU783993C (en) | Recombinant parainfluenza virus vaccines attenuated by deletion or ablation of a non-essential gene | |
| AU2009202359A1 (en) | Recovery of recombinant human parainfluenza virus type 1 (HPIV1) from cDNA use of recombinant HPIV1 in immunogenic compositions and as vectors to elicit immune responses against PIV and other human pathogens | |
| CA2499404A1 (en) | Recovery of recombinant human parainfluenza virus type 2 (hpiv2) from cdna and use of recombinant hpiv2 in immunogenic compositions and as vectors to elicit immune responses against piv and other human pathogens | |
| EP2019140A2 (en) | Attenuated human-bovine chimeric parainfluenza virus (PIV) vaccines | |
| US7622123B2 (en) | Attenuated human-bovine chimeric parainfluenza virus (PIV) vaccines | |
| US7201907B1 (en) | Attenuated human-bovine chimeric parainfluenza virus(PIV) vaccines | |
| US7632508B2 (en) | Attenuated human-bovine chimeric parainfluenza virus (PIV) vaccines | |
| WO2002002605A2 (en) | Attenuated human-bovine chimeric parainfluenza virus (piv) vaccines |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
| AX | Request for extension of the european patent |
Free format text: AL;LT;LV;MK;RO;SI |
|
| 17P | Request for examination filed |
Effective date: 20011015 |
|
| 17Q | First examination report despatched |
Effective date: 20041018 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20120605 |