EP1144644A2 - Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies - Google Patents

Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies

Info

Publication number
EP1144644A2
EP1144644A2 EP00901524A EP00901524A EP1144644A2 EP 1144644 A2 EP1144644 A2 EP 1144644A2 EP 00901524 A EP00901524 A EP 00901524A EP 00901524 A EP00901524 A EP 00901524A EP 1144644 A2 EP1144644 A2 EP 1144644A2
Authority
EP
European Patent Office
Prior art keywords
seq
polypeptide
sequence
polynucleotide
polynucleotides
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP00901524A
Other languages
German (de)
English (en)
French (fr)
Inventor
Jean-Louis SmithKline Beecham Biol. S.A. RUELLE
Joelle SmithKline Beecham Biol. S.A. THONNARD
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Biologicals SA
Original Assignee
SmithKline Beecham Biologicals SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GBGB9900952.4A external-priority patent/GB9900952D0/en
Priority claimed from GBGB9901948.1A external-priority patent/GB9901948D0/en
Priority claimed from GBGB9901945.7A external-priority patent/GB9901945D0/en
Priority claimed from GBGB9902088.5A external-priority patent/GB9902088D0/en
Priority claimed from GBGB9902078.6A external-priority patent/GB9902078D0/en
Priority claimed from GBGB9902074.5A external-priority patent/GB9902074D0/en
Priority claimed from GBGB9902879.7A external-priority patent/GB9902879D0/en
Priority claimed from GBGB9902936.5A external-priority patent/GB9902936D0/en
Priority claimed from GBGB9903978.6A external-priority patent/GB9903978D0/en
Priority claimed from GBGB9904133.7A external-priority patent/GB9904133D0/en
Priority claimed from GBGB9904404.2A external-priority patent/GB9904404D0/en
Application filed by SmithKline Beecham Biologicals SA filed Critical SmithKline Beecham Biologicals SA
Publication of EP1144644A2 publication Critical patent/EP1144644A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies

Definitions

  • BASB051 polynucleotide(s) polynucleotide(s)
  • BASB057 polynucleotide(s) polynucleotide(s)
  • BASB060 polynucleotide(s) polynucleotide(s)”
  • BASB061 polynucleotide(s) polypeptides encoded by them
  • BASB051 polypeptides encoded by them
  • Neisseria meningitidis is a Gram-negative bacterium frequently isolated from the human upper respiratory tract. It occasionally causes invasive bacterial diseases such as bacteremia and meningitis.
  • the incidence of meningococcal disease shows geographical seasonal and annual differences (Schwartz, B., Moore, P.S., Broome, CN.; Clin. Microbiol. Rev. 2 (Supplement), S18-S24, 1989).
  • Most disease in temperate countries is due to strains of serogroup B and varies in incidence from 1-10/100,000/year total population sometimes reaching higher values (Kaczmarski, E.B. (1997), Commun. Dis. Rep. Rev.
  • the polysaccharide vaccines are currently being improved by way of chemical conjugating them to carrier proteins (Lieberman, J.M., Chiu, S.S., Wong, V.K., et al. JAMA 275 : 1499- 1503, 1996).
  • a serogroup B vaccine is not available, since the B capsular polysaccharide was found to be nonimmunogenic, most likely because it shares structural similarity to host components (Wyle, F.A., Artenstein, M.S., Brandt, M.L. et al. J. Infect. Dis. 126: 514-522, 1972; Finne, J.M., Leinonen, M., Makela, P.M. Lancet ii.: 355-357, 1983).
  • bacterial outer membrane components are present in these vaccines, such as PorA, PorB, Rmp, Ope, Opa, FrpB and the contribution of these components to the observed protection still needs futher definition.
  • Other bacterial outer membrane components have been defined by using animal or human antibodies to be potentially relevant to the induction of protective immunity, such as TbpB and NspA (Martin, D., Cadieux, N., Hamel, J., Brodeux, B.R., J. Exp. Med. 185: 1173-1183, 1997; Lissolo, L., Ma ⁇ tre-Wilmotte, C, Dumas, p. et al, Inf. Immun. 63: 884-890, 1995).
  • the mechanisms of protective immunity will involve antibody mediated bactericidal activity and opsonophagocytosis.
  • a bacteremia animal model has been used to combine all antibody mediated mechanisms (Saukkonen, K., Leinonen, M., Abdillahi, H. Poolman, J. T. Vaccine 7: 325-328, 1989). It is generally accepted that the late complement component mediated bactericidal mechanism is crucial for immunity against meningococcal disease (Ross, S.C., Rosenthal P.J., Berberic, H.M., Densen, P. J. Infect. Dis. 155: 1266-1275, 1987).
  • Neisseria meningitidis infections has risen dramatically in the past few decades. This has been attributed to the emergence of multiply antibiotic resistant strains and an increasing population of people with weakened immune systems. It is no longer uncommon to isolate Neisseria meningitidis strains that are resistant to some or all of the standard antibiotics. This phenomenon has created an unmet medical need and demand for new anti-microbial agents, vaccines, drug screening methods, and diagnostic tests for this organism.
  • the present invention relates to BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066, and BASB071, in particular BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066, and BASB071 polypeptides and BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066, and BASB071 polynucleotides, recombinant materials and methods for their production.
  • the invention relates to methods for using such polypeptides and polynucleotides, including prevention and treatment of microbial diseases, amongst others.
  • the invention relates to diagnostic assays for detecting diseases associated with microbial infections and conditions associated with such infections, such as assays for detecting expression or activity of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066, and BASB071 polynucleotides or polypeptides.
  • the invention relates to BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066, and BASB071 polypeptides and polynucleotides as described in greater detail below.
  • the invention relates especially to BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066, and BASB071 having the nucleotide and amino acid sequences set out in SEQ ID NO:l,3,5,7,9,l 1,13,15 and SEQ ID NO:2,4,6,8,10,12,14,16 respectively.
  • sequences recited in the Sequence Listing below as "DNA” represent an exemplification of one embodiment of the invention, since those of ordinary skill will recognize that such sequences can be usefully employed in polynucleotides in general, including ribopolynucleotides.
  • polypeptides of Neisseria meningitidis referred to herein as "BASB051", “BASB057”, “BASB060”, “BASB061”, “BASB063”, “BASB065", “BASB066” and “BASB071”, and “BASB051 polypeptides”, “BASB057 polypeptides”, “BASB060 polypeptides”, “BASB061 polypeptides”, “BASB063 polypeptides”, “BASB065 polypeptides", “BASB066 polypeptides", and “BASB071 polypeptides” as well as biologically, diagnostically, prophylactically, clinically or therapeutically useful variants thereof, and compositions comprising the same.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% or exact identity, to that of SEQ ID NO:2.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO: 1 over the entire length of SEQ ID NO: 1.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity, to the amino acid sequence of SEQ ID NO:2.
  • the BASB051 polypeptide provided in SEQ ID NO:2 is the BASB051 polypeptide from Neisseria meningitidis strain ATCC 13090.
  • the invention also provides an immunogenic fragment of a BASB051 polypeptide, that is, a contiguous portion of the BASB051 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO:2. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the B ASB051 polypeptide.
  • an immunogenic fragment may include, for example, the B ASB051 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB051 comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to that of SEQ ID NO:2 over the entire length of SEQ ID NO:2.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% or exact identity, to that of SEQ ID NO:4.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO:3 over the entire length of SEQ ID NO:3.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity, to the amino acid sequence of SEQ ID NO:4
  • the BASB057 polypeptide provided in SEQ ID NO:4 is the BASB057 polypeptide from Neisseria meningitidis strain ATCC 13090.
  • the invention also provides an immunogenic fragment of a BASB057 polypeptide, that is, a contiguous portion of the BASB057 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO:4. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB057 polypeptide.
  • an immunogenic fragment may include, for example, the BASB057 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB057 comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to that of SEQ ID NO:4 over the entire length of SEQ ID NO:4.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85%) identity, more preferably at least 90%> identity, yet more preferably at least 95%> identity, most preferably at least 91-99% or exact identity, to that of SEQ ID NO:6.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO: 5 over the entire length of SEQ ID NO:5.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90%) identity, yet more preferably at least 95% identity, even more preferably at least 97- 99%> or exact identity, to the amino acid sequence of SEQ ID NO: 6
  • the BASB060 polypeptide provided in SEQ ID NO:6 is the BASB060 polypeptide from Neisseria meningitidis strain ATCC 13090.
  • the invention also provides an immunogenic fragment of a BASB060 polypeptide, that is, a contiguous portion of the BASB060 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO:6. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB060 polypeptide.
  • an immunogenic fragment may include, for example, the B ASB060 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB060 comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to that of SEQ ID NO:6 over the entire length of SEQ ID NO:6.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, most preferably at least 97-99%> or exact identity, to that of SEQ ID NO:8.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85%) identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO:7 over the entire length of SEQ ID NO:7.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99%o or exact identity, to the amino acid sequence of SEQ ID NO:8
  • the BASB061 polypeptide provided in SEQ ID NO:8 is the BASB061 polypeptide from Neisseria meningitidis strain ATCC13090.
  • the invention also provides an immunogenic fragment of a BASB061 polypeptide, that is, a contiguous portion of the BASB061 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO:8. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB061 polypeptide.
  • an immunogenic fragment may include, for example, the BASB061 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB061 comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to that of SEQ ID NO: 8 over the entire length of SEQ ID NO:8.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% or exact identity, to that of SEQ ID NO: 10.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO:9 over the entire length of SEQ ID NO:9.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90%) identity, yet more preferably at least 95% identity, even more preferably at least 97- 99%o or exact identity, to the amino acid sequence of SEQ ID NO: 10
  • the BASB063 polypeptide provided in SEQ ID NO: 10 is the BASB063 polypeptide from Neisseria meningitidis strain ATCC 13090.
  • the invention also provides an immunogenic fragment of a B ASB063 polypeptide, that is, a contiguous portion of the BASB063 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO: 10. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB063 polypeptide.
  • an immunogenic fragment may include, for example, the BASB063 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB063 according to the invention comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95%o identity, most preferably at least 97-99% identity, to that of SEQ ID NO: 10 over the entire length of SEQ ID NO: 10.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 91-99% or exact identity, to that of SEQ ID NO: 12.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 91-99% or exact identity to SEQ ID NO: 11 over the entire length of SEQ ID NO: 11.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity, to the amino acid sequence of SEQ ID NO: 12
  • the BASB065 polypeptide provided in SEQ ID NO: 12 is the BASB065 polypeptide from Neisseria meningitidis strain ATCC 13090.
  • the invention also provides an immunogenic fragment of a BASB065 polypeptide, that is, a contiguous portion of the BASB065 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO: 12. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB065 polypeptide.
  • an immunogenic fragment may include, for example, the BASB065 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB065 comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, most preferably at least 91-99% identity, to that of SEQ ID NO: 12 over the entire length of SEQ ID NO: 12.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, most preferably at least 91-99% or exact identity, to that of SEQ ID NO: 14.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO:13 over the entire length of SEQ ID NO:13.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity, to the amino acid sequence of SEQ ID NO: 14
  • the BASB066 polypeptide provided in SEQ ID NO: 14 is the BASB066 polypeptide from Neisseria meningitidis strain ATCC 13090.
  • the invention also provides an immunogenic fragment of a BASB066 polypeptide, that is, a contiguous portion of the BASB066 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO: 14. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB066 polypeptide.
  • an immunogenic fragment may include, for example, the BASB066 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB066 according to the invention comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90%o identity, yet more preferably at least 95%) identity, most preferably at least 97-99% identity, to that of SEQ ID NO: 14 over the entire length of SEQ ID NO: 14.
  • the present invention further provides for: (a) an isolated polypeptide which comprises an amino acid sequence which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, most preferably at least 97-99%) or exact identity, to that of SEQ ID NO: 16.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97-99% or exact identity to SEQ ID NO: 15 over the entire length of SEQ ID NO: 15.
  • polypeptide encoded by an isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide which has at least 85% identity, more preferably at least 90%) identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity, to the amino acid sequence of SEQ ID NO: 16
  • the BASB071 polypeptide provided in SEQ ID NO: 16 is the BASB071 polypeptide from Neisseria meningitidis strain ATCC13090.
  • the invention also provides an immunogenic fragment of a BASB071 polypeptide, that is, a contiguous portion of the BASB071 polypeptide which has the same or substantially the same immunogenic activity as the polypeptide comprising the amino acid sequence of SEQ ID NO: 16. That is to say, the fragment (if necessary when coupled to a carrier) is capable of raising an immune response which recognises the BASB071 polypeptide.
  • an immunogenic fragment may include, for example, the BASB071 polypeptide lacking an N- terminal leader sequence, and/or a transmembrane domain and/or a C-terminal anchor domain.
  • the immunogenic fragment of BASB071 comprises substantially all of the extracellular domain of a polypeptide which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, most preferably at least 97-99% identity, to that of SEQ ID NO: 16 over the entire length of SEQ ID NO: 16.
  • a fragment is a polypeptide having an amino acid sequence that is entirely the same as part but not all of any amino acid sequence of any polypeptide of the invention.
  • fragments may be "free-standing,” or comprised within a larger polypeptide of which they form a part or region, most preferably as a single continuous region in a single larger polypeptide.
  • Preferred fragments include, for example, truncation polypeptides having a portion of an amino acid sequence of SEQ ID NO:2,4,6,8,10,12,14,16 or of variants thereof, such as a continuous series of residues that includes an amino- and/or carboxyl-terminal amino acid sequence.
  • Degradation forms of the polypeptides of the invention produced by or in a host cell, are also preferred.
  • fragments characterized by structural or functional attributes such as fragments that comprise alpha-helix and alpha-helix forming regions, beta-sheet and beta-sheet-forming regions, turn and turn-forming regions, coil and coil-forming regions, hydrophilic regions, hydrophobic regions, alpha amphipathic regions, beta amphipathic regions, flexible regions, surface-forming regions, substrate binding region, and high antigenic index regions.
  • fragments include an isolated polypeptide comprising an amino acid sequence having at least 15, 20, 30, 40, 50 or 100 contiguous amino acids from the amino acid sequence of SEQ ID NO:2,4,6, 8, 10,12, 14,16 or an isolated polypeptide comprising an amino acid sequence having at least 15, 20, 30, 40, 50 or 100 contiguous amino acids truncated or deleted from the amino acid sequence of SEQ ID NO:2,4,6,8,10,12,14,16.
  • Fragments of the polypeptides of the invention may be employed for producing the corresponding full-length polypeptide by peptide synthesis; therefore, these fragments may be employed as intermediates for producing the full-length polypeptides of the invention.
  • polypeptides, or immunogenic fragments, of the invention may be in the form of the "mature" protein or may be a part of a larger protein such as a precursor or a fusion protein. It is often advantageous to include an additional amino acid sequence which contains secretory or leader sequences, pro-sequences, sequences which aid in purification such as multiple histidine residues, or an additional sequence for stability during recombinant production. Furthermore, addition of exogenous polypeptide or lipid tail or polynucleotide sequences to increase the immunogenic potential of the final molecule is also considered.
  • the invention relates to genetically engineered soluble fusion proteins comprising a polypeptide of the present invention, or a fragment thereof, and various portions of the constant regions of heavy or light chains of immunoglobulins of various subclasses (IgG, IgM, IgA, IgE).
  • immunoglobulin is the constant part of the heavy chain of human IgG, particularly IgGl, where fusion takes place at the hinge region.
  • the Fc part can be removed simply by incorporation of a cleavage sequence which can be cleaved with blood clotting factor Xa.
  • this invention relates to processes for the preparation of these fusion proteins by genetic engineering, and to the use thereof for drug screening, diagnosis and therapy.
  • a further aspect of the invention also relates to polynucleotides encoding such fusion proteins. Examples of fusion protein technology can be found in International Patent Application Nos. WO94/29458 and WO94/22914.
  • the proteins may be chemically conjugated, or expressed as recombinant fusion proteins allowing increased levels to be produced in an expression system as compared to non- fused protein.
  • the fusion partner may assist in providing T helper epitopes (immunological fusion partner), preferably T helper epitopes recognised by humans, or assist in expressing the protein (expression enhancer) at higher yields than the native recombinant protein.
  • the fusion partner will be both an immunological fusion partner and expression enhancing partner. Fusion partners include protein D from Haemophilus influenzas, and the non-structural protein from influenzae virus, NS1 (hemagglutinin). Another fusion partner is the protein known as LytA.
  • the C terminal portion of the molecule is used.
  • LytA is derived from Streptococcus pneumoniae which synthesize an N-acetyl-L-alanine amidase, amidase LytA, (coded by the lytA gene ⁇ Gene, 43 (1986) page 265-272 ⁇ ) an autolysin that specifically degrades certain bonds in the peptidoglycan backbone.
  • the C- terminal domain of the LytA protein is responsible for the affinity to the choline or to some choline analogues such as DEAE. This property has been exploited for the development of E.coli C-LytA expressing plasmids useful for expression of fusion proteins.
  • the present invention also includes variants of the aforementioned polypeptides, that is polypeptides that vary from the referents by conservative amino acid substitutions, whereby a residue is substituted by another with like characteristics. Typical such substitutions are among Ala, Val, Leu and He; among Ser and Thr; among the acidic residues Asp and Glu; among Asn and Gin; and among the basic residues Lys and Arg; or aromatic residue's Phe and Tyr.
  • Polypeptides of the present invention can be prepared in any suitable manner.
  • Such polypeptides include isolated naturally occurring polypeptides, recombinantly produced polypeptides, synthetically produced polypeptides, or polypeptides produced by a combination of these methods. Means for preparing such polypeptides are well understood in the art.
  • a polypeptide of the invention is derived from Neisseria meningitidis, however, it may preferably be obtained from other organisms of the same taxonomic genus.
  • a polypeptide of the invention may also be obtained, for example, from organisms of the same taxonomic family or order.
  • Polynucleotides It is an object of the invention to provide polynucleotides that encode BASB051 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB051.
  • the polynucleotide comprises a region encoding BASB051 polypeptides comprising a sequence set out in SEQ ID NO: 1 which includes a full length gene, or a variant thereof.
  • the BASB051 polynucleotide provided in SEQ ID NO:l is the BASB051 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB051 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB051 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB051 polypeptide having a deduced amino acid sequence of SEQ ID NO:2 and polynucleotides closely related thereto and variants thereof.
  • BASB051 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO:2 or a variant thereof.
  • a polynucleotide of the invention encoding BASB051 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO:l
  • a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence.
  • Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO: 1 was discovered in a DNA library derived from Neisseria meningitidis.
  • the DNA sequence set out in SEQ ID NO: 1 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO:2 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the polynucleotide of SEQ ID NO:l between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 802 of SEQ ID NO:l, encodes the polypeptide of SEQ ID NO:2.
  • the present invention provides for an isolated polynucleotide comprising or consisting of:
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%>) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO: 1 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • stringent hybridization conditions for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%>
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO: 1. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl. Acad. Sci., USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al, Cell 37: 161 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB051 polypeptide of SEQ ID NO:2 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 801 of SEQ ID NO: 1. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:2.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis B ASB051 having an amino acid sequence set out in SEQ ID NO:2.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO:2. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention. Further particularly preferred embodiments are polynucleotides encoding BASB051 variants, that have the amino acid sequence of BASB051 polypeptide of SEQ ID NO:2 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination. Especially preferred among these are silent substitutions, additions and deletions, that do not alter the properties and activities of BASB051 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB051 polypeptide having an amino acid sequence set out in SEQ ID NO:2 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO-1.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB051 polynucleotide sequences, such as those polynucleotides in SEQ ID NO: 1.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95%) and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10%) dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in O.lx SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 11 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO: l under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO: l
  • fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding B ASB051 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the B ASB051 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB051 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO:l to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to.
  • the polynucleotide comprises a region encoding BASB057 polypeptides comprising a sequence set out in SEQ ID NO:3 which includes a full length gene, or a variant thereof.
  • the BASB057 polynucleotide provided in SEQ ID NO:3 is the BASB057 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB057 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB057 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB057 polypeptide having a deduced amino acid sequence of SEQ ID NO:4 and polynucleotides closely related thereto and variants thereof.
  • BASB057 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO:4 or a variant thereof.
  • a polynucleotide of the invention encoding BASB057 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO:3
  • a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence.
  • Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO:3 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO:3 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO:4 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85% identity, more preferably at least 90%) identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity to SEQ ID NO:3 over the entire length of SEQ ID NO:3; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO:3 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO:3. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl. Acad. Sci., USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al, Cell 37: 161 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB057 polypeptide of SEQ ID NO:4 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 1401 of SEQ ID NO:3. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:4.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB057 having an amino acid sequence set out in SEQ ID NO:4.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO:4. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • BASB057 variants that have the amino acid sequence of BASB057 polypeptide of SEQ ID NO:4 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination.
  • silent substitutions, additions and deletions that do not alter the properties and activities of BASB057 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB057 polypeptide having an amino acid sequence set out in SEQ ID NO:4 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99%o are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO-3.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB057 polynucleotide sequences, such as those polynucleotides in SEQ ID NO:3.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95% and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO:3 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO:3
  • fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB057 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB057 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB057 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO:3 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to. It is an object of the invention to provide polynucleotides that encode BASB060 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB060.
  • the polynucleotide comprises a region encoding BASB060 polypeptides comprising a sequence set out in SEQ ID NO: 5 which includes a full length gene, or a variant thereof.
  • the BASB060 polynucleotide provided in SEQ ID NO:5 is the BASB060 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB060 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB060 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB060 polypeptide having a deduced amino acid sequence of SEQ ID NO:6 and polynucleotides closely related thereto and variants thereof.
  • BASB060 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO: 6 or a variant thereof.
  • a polynucleotide of the invention encoding BASB060 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO:5
  • a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence.
  • Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al, MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor. New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO:5 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO: 5 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO: 6 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the polynucleotide of SEQ ID NO:5 between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 418 of SEQ ID NO:5, encodes the polypeptide of SEQ ID NO:6.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85%> identity, more preferably at least 90%o identity, yet more preferably at least 95% identity, even more preferably at least 97- 99%> or exact identity to SEQ ID NO: 5 over the entire length of SEQ ID NO:5; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO:5 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO:5. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl Acad. Sci., USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al, Cell 37: 161 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB060 polypeptide of SEQ ID NO: 6 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 417 of SEQ ID NO:5. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:6.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB060 having an amino acid sequence set out in SEQ ID NO:6.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO:6. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • BASB060 variants are polynucleotides encoding BASB060 variants, that have the amino acid sequence of BASB060 polypeptide of SEQ ID NO:6 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination. Especially preferred among these are silent substitutions, additions and deletions that do not alter the properties and activities of BASB060 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB060 polypeptide having an amino acid sequence set out in SEQ ID NO:6 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO:5.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB060 polynucleotide sequences, such as those polynucleotides in SEQ ID NO:5.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95% and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in 0.1 x SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 1 1 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO: 5 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO: 5
  • fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB060 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB060 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB060 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO: 5 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to. It is an object of the invention to provide polynucleotides that encode BASB061 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB061.
  • the polynucleotide comprises a region encoding BASB061 polypeptides comprising a sequence set out in SEQ ID NO: 7 which includes a full length gene, or a variant thereof.
  • the BASB061 polynucleotide provided in SEQ ID NO:7 is the BASB061 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB061 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB061 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB061 polypeptide having a deduced amino acid sequence of SEQ ID NO: 8 and polynucleotides closely related thereto and variants thereof.
  • BASB061 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO:8 or a variant thereof.
  • a polynucleotide of the invention encoding BASB061 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO: 7 typically a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence. Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions. By sequencing the individual clones thus identified by hybridization with sequencing primers designed from the original polypeptide or polynucleotide sequence it is then possible to extend the polynucleotide sequence in both directions to determine a full length gene sequence.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO:7 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO: 7 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO: 8 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the polynucleotide of SEQ ID NO:7 between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 514 of SEQ ID NO:7, encodes the polypeptide of SEQ ID NO:8.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity to SEQ ID NO:7 over the entire length of SEQ ID NO:7; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65 °C and an SDS concentration from 0.1 - l%o) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO:7 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • stringent hybridization conditions for example, using a temperature in the range of 45 - 65 °C and an SDS concentration from 0.1 - l%o
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO:7. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl. Acad. Sci., USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al, Cell 37: 767 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB061 polypeptide of SEQ ID NO:8 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 513 of SEQ ID NO: 7. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:8.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB061 having an amino acid sequence set out in SEQ ID NO:8.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO:8. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • BASB061 variants are polynucleotides encoding BASB061 variants, that have the amino acid sequence of BASB061 polypeptide of SEQ ID NO:8 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination. Especially preferred among these are silent substitutions, additions and deletions that do not alter the properties and activities of BASB061 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB061 polypeptide having an amino acid sequence set out in SEQ ID NO: 8 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly preferred, with at least 99%) being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO.7.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB061 polynucleotide sequences, such as those polynucleotides in SEQ ID NO: 7.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95% and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10%) dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in 0.1 x SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 11 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO:7 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO:7
  • fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB061 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB061 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB061 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO:7 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to. It is an object of the invention to provide polynucleotides that encode BASB063 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB063.
  • the polynucleotide comprises a region encoding BASB063 polypeptides comprising a sequence set out in SEQ ID NO:9 which includes a full length gene, or a variant thereof.
  • the BASB063 polynucleotide provided in SEQ ID NO:9 is the BASB063 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB063 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB063 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB063 polypeptide having a deduced amino acid sequence of SEQ ID NO: 10 and polynucleotides closely related thereto and variants thereof.
  • BASB063 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO: 10 or a variant thereof.
  • a polynucleotide of the invention encoding BASB063 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO: 9 typically a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence. Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions. By sequencing the individual clones thus identified by hybridization with sequencing primers designed from the original polypeptide or polynucleotide sequence it is then possible to extend the polynucleotide sequence in both directions to determine a full length gene sequence.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO: 9 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO: 9 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO: 10 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99%> or exact identity to SEQ ID NO:9 over the entire length of SEQ ID NO:9; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO:9 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO:9. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl. Acad. Sci., USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al. Cell 37: 767 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB063 polypeptide of SEQ ID NO: 10 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 813 of SEQ ID NO:9. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO: 10.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB063 having an amino acid sequence set out in SEQ ID NO: 10.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO: 10. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • BASB063 variants that have the amino acid sequence of BASB063 polypeptide of SEQ ID NO: 10 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination.
  • silent substitutions, additions and deletions that do not alter the properties and activities of BASB063 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB063 polypeptide having an amino acid sequence set out in SEQ ID NO: 10 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90%> identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO:9.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB063 polynucleotide sequences, such as those polynucleotides in SEQ ID NO:9.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95% and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in O.lx SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 11 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO: 9 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO: 9
  • fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB063 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the B ASB063 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB063 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO:9 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to. It is an object of the invention to provide polynucleotides that encode BASB065 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB065.
  • the polynucleotide comprises a region encoding BASB065 polypeptides comprising a sequence set out in SEQ ID NO:l 1 which includes a full length gene, or a variant thereof.
  • the BASB065 polynucleotide provided in SEQ ID NO: 11 is the BASB065 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB065 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB065 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB065 polypeptide having a deduced amino acid sequence of SEQ ID NO: 12 and polynucleotides closely related thereto and variants thereof.
  • BASB065 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO: 12 or a variant thereof.
  • a polynucleotide of the invention encoding BASB065 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO:l 1 typically a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence. Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions. By sequencing the individual clones thus identified by hybridization with sequencing primers designed from the original polypeptide or polynucleotide sequence it is then possible to extend the polynucleotide sequence in both directions to determine a full length gene sequence.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO: 11 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO: 11 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO: 12 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the polynucleotide of SEQ ID NO: 11 between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 715 of SEQ ID NO:l 1, encodes the polypeptide of SEQ ID NO: 12.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85% identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity to SEQ ID NO: 11 over the entire length of SEQ ID NO: 11 ; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO: 11 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO: 11. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3 ' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al. , Proc. Natl. Acad. Sci., USA 86: 821 -824 ( 1989), or an HA peptide tag (Wilson et al. , Cell 37: 161 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB065 polypeptide of SEQ ID NO: 12 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 714 of SEQ ID NO: 11. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO: 12.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB065 having an amino acid sequence set out in SEQ ID NO: 12.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO: 12. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • BASB065 variants that have the amino acid sequence of BASB065 polypeptide of SEQ ID NO:12 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination.
  • silent substitutions, additions and deletions that do not alter the properties and activities of BASB065 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB065 polypeptide having an amino acid sequence set out in SEQ ID NO: 12 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95%o are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO.l l.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB065 polynucleotide sequences, such as those polynucleotides in SEQ ID NO: 11.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95% and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10%) dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in 0.1 x SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 11 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO:l 1 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO:l 1 or a fragment thereof; and isolating said polynucleotide sequence.
  • Fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB065 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB065 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB065 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO:l 1 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to. It is an object of the invention to provide polynucleotides that encode BASB066 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB066.
  • the polynucleotide comprises a region encoding BASB066 polypeptides comprising a sequence set out in SEQ ID NO: 13 which includes a full length gene, or a variant thereof.
  • the BASB066 polynucleotide provided in SEQ ID NO: 13 is the BASB066 polynucleotide from Neisseria meningitidis strains ATCC13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB066 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB066 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB066 polypeptide having a deduced amino acid sequence of SEQ ID NO: 14 and polynucleotides closely related thereto and variants thereof.
  • BASB066 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO: 14 or a variant thereof.
  • a polynucleotide of the invention encoding BASB066 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO: 13 typically a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence. Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions. By sequencing the individual clones thus identified by hybridization with sequencing primers designed from the original polypeptide or polynucleotide sequence it is then possible to extend the polynucleotide sequence in both directions to determine a full length gene sequence.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al, MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO: 13 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO: 13 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO: 14 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the polynucleotide of SEQ ID NO: 13 between the start codon at nucleotide number 1 and the stop codon which begins at nucleotide number 1174 of SEQ ID NO: 13, encodes the polypeptide of SEQ ID NO: 14.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85%) identity, more preferably at least 90% identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity to SEQ ID NO:13 over the entire length of SEQ ID NO:13; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%>) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO: 13 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • stringent hybridization conditions for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%>
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO: 13. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl. Acad. Sci, USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al, Cell 37: 161 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB066 polypeptide of SEQ ID NO: 14 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 1173 of SEQ ID NO: 13. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO: 14.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB066 having an amino acid sequence set out in SEQ ID NO: 14.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO: 14. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • B ASB066 variants that have the amino acid sequence of BASB066 polypeptide of SEQ ID NO: 14 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination.
  • silent substitutions, additions and deletions that do not alter the properties and activities of BASB066 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB066 polypeptide having an amino acid sequence set out in SEQ ID NO: 14 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98%> and at least 99% are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO.13.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB066 polynucleotide sequences, such as those polynucleotides in SEQ ID NO : 13.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95%o and preferably at least 97% identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50%> formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in O.lx SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al, Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 11 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO: 13 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO: 13 or a fragment thereof; and isolating said polynucleotide sequence.
  • Fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB066 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB066 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB066 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO: 13 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to. It is an object of the invention to provide polynucleotides that encode BASB071 polypeptides, particularly polynucleotides that encode the polypeptide herein designated BASB071.
  • the polynucleotide comprises a region encoding BASB071 polypeptides comprising a sequence set out in SEQ ID NO: 15 which includes a full length gene, or a variant thereof.
  • the BASB071 polynucleotide provided in SEQ ID NO: 15 is the BASB071 polynucleotide from Neisseria meningitidis strains ATCC 13090.
  • isolated nucleic acid molecules encoding and/or expressing BASB071 polypeptides and polynucleotides, particularly Neisseria meningitidis BASB071 polypeptides and polynucleotides, including, for example, unprocessed RNAs, ribozyme RNAs, mRNAs, cDNAs, genomic DNAs, B- and Z-DNAs.
  • Further embodiments of the invention include biologically, diagnostically, prophylactically, clinically or therapeutically useful polynucleotides and polypeptides, and variants thereof, and compositions comprising the same.
  • Another aspect of the invention relates to isolated polynucleotides, including at least one full length gene, that encodes a BASB071 polypeptide having a deduced amino acid sequence of SEQ ID NO: 16 and polynucleotides closely related thereto and variants thereof.
  • BASB071 polypeptide from Neisseria meningitidis comprising or consisting of an amino acid sequence of SEQ ID NO: 16 or a variant thereof.
  • a polynucleotide of the invention encoding BASB071 polypeptide may be obtained using standard cloning and screening methods, such as those for cloning and sequencing chromosomal DNA fragments from bacteria using Neisseria meningitidis cells as starting material, followed by obtaining a full length clone.
  • a polynucleotide sequence of the invention such as a polynucleotide sequence given in SEQ ID NO: 15 typically a library of clones of chromosomal DNA of Neisseria meningitidis in E.coli or some other suitable host is probed with a radiolabeled oligonucleotide, preferably a 17-mer or longer, derived from a partial sequence. Clones carrying DNA identical to that of the probe can then be distinguished using stringent hybridization conditions. By sequencing the individual clones thus identified by hybridization with sequencing primers designed from the original polypeptide or polynucleotide sequence it is then possible to extend the polynucleotide sequence in both directions to determine a full length gene sequence.
  • sequencing is performed, for example, using denatured double stranded DNA prepared from a plasmid clone. Suitable techniques are described by Maniatis, T., Fritsch, E.F. and Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (1989). (see in particular Screening By Hybridization 1.90 and Sequencing Denatured Double-Stranded DNA Templates 13.70). Direct genomic DNA sequencing may also be performed to obtain a full length gene sequence. Illustrative of the invention, each polynucleotide set out in SEQ ID NO: 15 was discovered in a DNA library derived from Neisseria meningitidis.
  • DNA sequence set out in SEQ ID NO: 15 contains an open reading frame encoding a protein having about the number of amino acid residues set forth in SEQ ID NO: 16 with a deduced molecular weight that can be calculated using amino acid residue molecular weight values well known to those skilled in the art.
  • the present invention provides for an isolated polynucleotide comprising or consisting of: (a) a polynucleotide sequence which has at least 85% identity, more preferably at least 90%> identity, yet more preferably at least 95% identity, even more preferably at least 97- 99% or exact identity to SEQ ID NO:15 over the entire length of SEQ ID NO: 15; or
  • a polynucleotide encoding a polypeptide of the present invention may be obtained by a process which comprises the steps of screening an appropriate library under stringent hybridization conditions (for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%>) with a labeled or detectable probe consisting of or comprising the sequence of SEQ ID NO: 15 or a fragment thereof; and isolating a full-length gene and/or genomic clones containing said polynucleotide sequence.
  • stringent hybridization conditions for example, using a temperature in the range of 45 - 65°C and an SDS concentration from 0.1 - 1%>
  • the invention provides a polynucleotide sequence identical over its entire length to a coding sequence (open reading frame) in SEQ ID NO: 15. Also provided by the invention is a coding sequence for a mature polypeptide or a fragment thereof, by itself as well as a coding sequence for a mature polypeptide or a fragment in reading frame with another coding sequence, such as a sequence encoding a leader or secretory sequence, a pre-, or pro- or prepro-protein sequence.
  • the polynucleotide of the invention may also contain at least one non-coding sequence, including for example, but not limited to at least one non-coding 5' and 3' sequence, such as the transcribed but non-translated sequences, termination signals (such as rho-dependent and rho-independent termination signals), ribosome binding sites, Kozak sequences, sequences that stabilize mRNA, introns, and polyadenylation signals.
  • the polynucleotide sequence may also comprise additional coding sequence encoding additional amino acids. For example, a marker sequence that facilitates purification of the fused polypeptide can be encoded.
  • the marker sequence is a hexa-histidine peptide, as provided in the pQE vector (Qiagen, Inc.) and described in Gentz et al, Proc. Natl. Acad. Sci, USA 86: 821-824 (1989), or an HA peptide tag (Wilson et al, Cell 37: 161 (1984), both of which may be useful in purifying polypeptide sequence fused to them.
  • Polynucleotides of the invention also include, but are not limited to, polynucleotides comprising a structural gene and its naturally associated sequences that control gene expression.
  • the nucleotide sequence encoding BASB071 polypeptide of SEQ ID NO: 16 may be identical to the polypeptide encoding sequence contained in nucleotides 1 to 804 of SEQ ID NO: 15. Alternatively it may be a sequence, which as a result of the redundancy (degeneracy) of the genetic code, also encodes the polypeptide of SEQ ID NO:16.
  • polynucleotide encoding a polypeptide encompasses polynucleotides that include a sequence encoding a polypeptide of the invention, particularly a bacterial polypeptide and more particularly a polypeptide of the Neisseria meningitidis BASB071 having an amino acid sequence set out in SEQ ID NO: 16.
  • polynucleotides that include a single continuous region or discontinuous regions encoding the polypeptide (for example, polynucleotides interrupted by integrated phage, an integrated insertion sequence, an integrated vector sequence, an integrated transposon sequence, or due to RNA editing or genomic DNA reorganization) together with additional regions, that also may contain coding and/or non-coding sequences.
  • the invention further relates to variants of the polynucleotides described herein that encode variants of a polypeptide having a deduced amino acid sequence of SEQ ID NO: 16. Fragments of polynucleotides of the invention may be used, for example, to synthesize full- length polynucleotides of the invention.
  • BASB071 variants that have the amino acid sequence of BASB071 polypeptide of SEQ ID NO: 16 in which several, a few, 5 to 10, 1 to 5, 1 to 3, 2, 1 or no amino acid residues are substituted, modified, deleted and/or added, in any combination.
  • silent substitutions, additions and deletions that do not alter the properties and activities of BASB071 polypeptide.
  • polynucleotides that are at least 85% identical over their entire length to a polynucleotide encoding BASB071 polypeptide having an amino acid sequence set out in SEQ ID NO: 16 and polynucleotides that are complementary to such polynucleotides.
  • polynucleotides at least 90% identical over their entire length to the same are particularly preferred, and among these particularly preferred polynucleotides, those with at least 95% are especially preferred.
  • those with at least 97% are highly preferred among those with at least 95%, and among these those with at least 98% and at least 99% are particularly highly preferred, with at least 99% being the more preferred.
  • Preferred embodiments are polynucleotides encoding polypeptides that retain substantially the same biological function or activity as the mature polypeptide encoded by a DNA of SEQ ID NO-15.
  • polynucleotides that hybridize, particularly under stringent conditions, to BASB071 polynucleotide sequences, such as those polynucleotides in SEQ ID NO: 15.
  • the invention further relates to polynucleotides that hybridize to the polynucleotide sequences provided herein.
  • the invention especially relates to polynucleotides that hybridize under stringent conditions to the polynucleotides described herein.
  • stringent conditions and “stringent hybridization conditions” mean hybridization occurring only if there is at least 95% and preferably at least 97%o identity between the sequences.
  • a specific example of stringent hybridization conditions is overnight incubation at 42°C in a solution comprising: 50%> formamide, 5x SSC (150mM NaCl, 15mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5x Denhardt's solution, 10%) dextran sulfate, and 20 micrograms/ml of denatured, sheared salmon sperm DNA, followed by washing the hybridization support in 0.1 x SSC at about 65°C.
  • Hybridization and wash conditions are well known and exemplified in Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor, N.Y., (1989), particularly Chapter 1 1 therein. Solution hybridization may also be used with the polynucleotide sequences provided by the invention.
  • the invention also provides a polynucleotide consisting of or comprising a polynucleotide sequence obtained by screening an appropriate library containing the complete gene for a polynucleotide sequence set forth in SEQ ID NO: 15 under stringent hybridization conditions with a probe having the sequence of said polynucleotide sequence set forth in SEQ ID NO: 15 or a fragment thereof; and isolating said polynucleotide sequence.
  • Fragments useful for obtaining such a polynucleotide include, for example, probes and primers fully described elsewhere herein.
  • the polynucleotides of the invention may be used as a hybridization probe for RNA, cDNA and genomic DNA to isolate full-length cDNAs and genomic clones encoding BASB071 and to isolate cDNA and genomic clones of other genes that have a high identity, particularly high sequence identity, to the BASB071 gene.
  • Such probes generally will comprise at least 15 nucleotide residues or base pairs.
  • such probes will have at least 30 nucleotide residues or base pairs and may have at least 50 nucleotide residues or base pairs.
  • Particularly preferred probes will have at least 20 nucleotide residues or base pairs and will have less than 30 nucleotide residues or base pairs.
  • a coding region of a BASB071 gene may be isolated by screening using a DNA sequence provided in SEQ ID NO: 15 to synthesize an oligonucleotide probe.
  • a labeled oligonucleotide having a sequence complementary to that of a gene of the invention is then used to screen a library of cDNA, genomic DNA or mRNA to determine which members of the library the probe hybridizes to.
  • RACE Rapid Amplification of cDNA ends
  • the PCR reaction is then repeated using "nested" primers, that is, primers designed to anneal within the amplified product (typically an adaptor specific primer that anneals further 3 ' in the adaptor sequence and a gene specific primer that anneals further 5' in the selected gene sequence).
  • primers designed to anneal within the amplified product typically an adaptor specific primer that anneals further 3 ' in the adaptor sequence and a gene specific primer that anneals further 5' in the selected gene sequence.
  • the products of this reaction can then be analyzed by DNA sequencing and a full-length DNA constructed either by joining the product directly to the existing DNA to give a complete sequence, or carrying out a separate full-length PCR using the new sequence information for the design of the 5' primer.
  • polynucleotides and polypeptides of the invention may be employed, for example, as research reagents and materials for discovery of treatments of and diagnostics for diseases, particularly human diseases, as further discussed herein relating to polynucleotide assays.
  • polynucleotides of the invention that are oligonucleotides derived from a sequence of SEQ ID NOS:l - 16 may be used in the processes herein as described, but preferably for PCR, to determine whether or not the polynucleotides identified herein in whole or in part are transcribed in bacteria in infected tissue. It is recognized that such sequences will also have utility in diagnosis of the stage of infection and type of infection the pathogen has attained.
  • the invention also provides polynucleotides that encode a polypeptide that is the mature protein plus additional amino or carboxyl-terminal amino acids, or amino acids interior to the mature polypeptide (when the mature form has more than one polypeptide chain, for instance).
  • Such sequences may play a role in processing of a protein from precursor to a mature form, may allow protein transport, may lengthen or shorten protein half-life or may facilitate manipulation of a protein for assay or production, among other things.
  • the additional amino acids may be processed away from the mature protein by cellular enzymes.
  • polynucleotide of the invention there is provided a polynucleotide complementary to it. It is preferred that these complementary polynucleotides are fully complementary to each polynucleotide with which they are complementary.
  • a precursor protein, having a mature form of the polypeptide fused to one or more prosequences may be an inactive form of the polypeptide.
  • inactive precursors When prosequences are removed such inactive precursors generally are activated. Some or all of the prosequences may be removed before activation. Generally, such precursors are called proproteins.
  • N may also be used in describing certain polynucleotides of the invention. “N” means that any of the four DNA or RNA nucleotides may appear at such a designated position in the DNA or RNA sequence, except it is preferred that N is not a nucleic acid that when taken in combination with adjacent nucleotide positions, when read in the correct reading frame, would have the effect of generating a premature termination codon in such reading frame.
  • a polynucleotide of the invention may encode a mature protein, a mature protein plus a leader sequence (which may be referred to as a preprotein), a precursor of a mature protein having one or more prosequences that are not the leader sequences of a preprotein, or a preproprotein, which is a precursor to a proprotein, having a leader sequence and one or more prosequences, which generally are removed during processing steps that produce active and mature forms of the polypeptide.
  • a leader sequence which may be referred to as a preprotein
  • a precursor of a mature protein having one or more prosequences that are not the leader sequences of a preprotein or a preproprotein, which is a precursor to a proprotein, having a leader sequence and one or more prosequences, which generally are removed during processing steps that produce active and mature forms of the polypeptide.
  • a polynucleotide of the invention for therapeutic or prophylactic purposes, in particular genetic immunization.
  • a polynucleotide of the invention in genetic immunization will preferably employ a suitable delivery method such as direct injection of plasmid DNA into muscles (Wolff et al, Hum Mol Genet (1992) 1 : 363, Manthorpe et al, Hum. Gene Ther. (1983) 4: 419), delivery of DNA complexed with specific protein carriers (Wu et al, J Biol Chem.
  • the invention also relates to vectors that comprise a polynucleotide or polynucleotides of the invention, host cells that are genetically engineered with vectors of the invention and the production of polypeptides of the invention by recombinant techniques.
  • Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the invention.
  • Recombinant polypeptides of the present invention may be prepared by processes well known in those skilled in the art from genetically engineered host cells comprising expression systems. Accordingly, in a further aspect, the present invention relates to expression systems that comprise a polynucleotide or polynucleotides of the present invention, to host cells which are genetically engineered with such expression systems, and to the production of polypeptides of the invention by recombinant techniques.
  • host cells can be genetically engineered to incorporate expression systems or portions thereof or polynucleotides of the invention.
  • Introduction of a polynucleotide into the host cell can be effected by methods described in many standard laboratory manuals, such as Davis, et al. , BASIC METHODS IN MOLECULAR BIOLOGY, (1986) and Sambrook, et al, MOLECULAR CLONING: A LABORATORY MANUAL, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989), such as, calcium phosphate transfection, DEAE-dextran mediated transfection, transvection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction and infection.
  • bacterial cells such as cells of streptococci, staphylococci, enterococci, E. coli, streptomyces, cyanobacteria, Bacillus subtilis, Moraxella catarrhalis, Haemophilus influenzae and Neisseria meningitidis
  • fungal cells such as cells of a yeast, Kluveromyces, Saccharomyces, a basidiomycete, Candida albicans and Aspergillus
  • insect cells such as cells of Drosophila S2 and Spodoptera Sf9
  • animal cells such as CHO, COS, HeLa, C127, 3T3, BHK, 293, CV-1 and Bowes melanoma cells
  • plant cells such as cells of a gymnosperm or angiosperm.
  • vectors include, among others, chromosomal-, episomal- and virus-derived vectors, for example, vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses, picornaviruses, retroviruses, and alphaviruses and vectors derived from combinations thereof, such as those derived from plasmid and bacteriophage genetic elements, such as cosmids and phagemids.
  • the expression system constructs may contain control regions that regulate as well as engender expression.
  • any system or vector suitable to maintain, propagate or express polynucleotides and/or to express a polypeptide in a host may be used for expression in this regard.
  • the appropriate DNA sequence may be inserted into the expression system by any of a variety of well-known and routine techniques, such as, for example, those set forth in Sambrook et al., MOLECULAR CLONING, A LABORATORY MANUAL, (supra).
  • secretion signals may be incorporated into the expressed polypeptide. These signals may be endogenous to the polypeptide or they may be heterologous signals.
  • Polypeptides of the present invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, ion metal affinity chromatography (IMAC) is employed for purification.
  • IMAC ion metal affinity chromatography
  • Well known techniques for refolding proteins may be employed to regenerate active conformation when the polypeptide is denatured during intracellular synthesis, isolation and or purification.
  • the expression system may also be a recombinant live microorganism, such as a virus or bacterium.
  • the gene of interest can be inserted into the genome of a live recombinant virus or bacterium. Inoculation and in vivo infection with this live vector will lead to in vivo expression of the antigen and induction of immune responses.
  • Viruses and bacteria used for this purpose are for instance: poxviruses (e.g; vaccinia, fowlpox, canarypox), alphaviruses (Sindbis virus, Semliki Forest Virus, Dialoguelian Equine Encephalitis Virus), adenoviruses, adeno-associated virus, picornaviruses (poliovirus, rhinovirus), herpesviruses (varicella zoster virus, etc), Listeria, Salmonella , Shigella, Neisseria, BCG. These viruses and bacteria can be virulent, or attenuated in various ways in order to obtain live vaccines. Such live vaccines also form part of the invention.
  • poxviruses e.g; vaccinia, fowlpox, canarypox
  • alphaviruses Semliki Forest Virus, Kunststoffuelian Equine Encephalitis Virus
  • adenoviruses adeno-associated virus
  • This invention is also related to the use of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotides and polypeptides of the invention for use as diagnostic reagents. Detection of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotides and/or polypeptides in a eukaryote, particularly a mammal, and especially a human, will provide a diagnostic method for diagnosis of disease, staging of disease or response of an infectious organism to drugs.
  • Eukaryotes particularly mammals, and especially humans, particularly those infected or suspected to be infected with an organism comprising the BASB051 , BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 gene or protein, may be detected at the nucleic acid or amino acid level by a variety of well known techniques as well as by methods provided herein.
  • Polypeptides and polynucleotides for prognosis, diagnosis or other analysis may be obtained from a putatively infected and/or infected individual's bodily materials.
  • Polynucleotides from any of these sources may be used directly for detection or may be amplified enzymatically by using PCR or any other amplification technique prior to analysis.
  • RNA, particularly mRNA, cDNA and genomic DNA may also be used in the same ways.
  • amplification, characterization of the species and strain of infectious or resident organism present in an individual may be made by an analysis of the genotype of a selected polynucleotide of the organism.
  • Deletions and insertions can be detected by a change in size of the amplified product in comparison to a genotype of a reference sequence selected from a related organism, preferably a different species of the same genus or a different strain of the same species.
  • Point mutations can be identified by hybridizing amplified DNA to labeled BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide sequences.
  • Perfectly or significantly matched sequences can be distinguished from imperfectly or more significantly mismatched duplexes by DNase or RNase digestion, for DNA or RNA respectively, or by detecting differences in melting temperatures or renaturation kinetics.
  • Polynucleotide sequence differences may also be detected by alterations in the electrophoretic mobility of polynucleotide fragments in gels as compared to a reference sequence. This may be carried out with or without denaturing agents.
  • Polynucleotide differences may also be detected by direct DNA or RNA sequencing. See, for example, Myers et al, Science, 230: 1242 (1985). Sequence changes at specific locations also may be revealed by nuclease protection assays, such as RNase, V 1 and S 1 protection assay or a chemical cleavage method. See, for example, Cotton et al, Proc. Natl. Acad. Sci, USA, 85: 4397-4401 (1985).
  • an array of oligonucleotides probes comprising a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 nucleotide sequence or fragments thereof can be constructed to conduct efficient screening of, for example, genetic mutations, serotype, taxonomic classification or identification.
  • Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see, for example, Chee et al, Science, 274: 610 (1996)).
  • the present invention relates to a diagnostic kit which comprises:
  • a polynucleotide of the present invention preferably the nucleotide sequence of SEQ ID NO:l,3,5,7,9,l 1,13,15 or a fragment thereof ;
  • polypeptide of the present invention preferably the polypeptide of SEQ ID NO:2,4,6,8,10,12,14,16 or a fragment thereof;
  • kits an antibody to a polypeptide of the present invention, preferably to the polypeptide of SEQ ID NO:2,4,6,8,10,12,14,16. It will be appreciated that in any such kit, (a), (b), (c) or (d) may comprise a substantial component. Such a kit will be of use in diagnosing a disease or susceptibility to a disease, among others.
  • This invention also relates to the use of polynucleotides of the present invention as diagnostic reagents.
  • Detection of a mutated form of a polynucleotide of the invention, preferable, SEQ ID NO.T, 3, 5, 7,9,11,13,15 which is associated with a disease or pathogenicity will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, a prognosis of a course of disease, a determination of a stage of disease, or a susceptibility to a disease, which results from under-expression, over-expression or altered expression of the polynucleotide.
  • Organisms, particularly infectious organisms, carrying mutations in such polynucleotide may be detected at the polynucleotide level by a variety of techniques, such as those described elsewhere herein.
  • RNA, cDNA or genomic DNA may also be used for the same purpose, PCR.
  • PCR primers complementary to a polynucleotide encoding BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide can be used to identify and analyze mutations.
  • the invention further provides primers with 1 , 2, 3 or 4 nucleotides removed from the 5' and/or the 3' end. These primers may be used for, among other things, amplifying BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 DNA and or RNA isolated from a sample derived from an individual, such as a bodily material.
  • the primers may be used to amplify a polynucleotide isolated from an infected individual, such that the polynucleotide may then be subject to various techniques for elucidation of the polynucleotide sequence. In this way, mutations in the polynucleotide sequence may be detected and used to diagnose and/or prognose the infection or its stage or course, or to serotype and/or classify the infectious agent.
  • the invention further provides a process for diagnosing disease, preferably bacterial infections, more preferably infections caused by Neisseria meningitidis, comprising determining from a sample derived from an individual, such as a bodily material, an increased level of expression of polynucleotide having a sequence of SEQ ID NO:l,3,5,7,9,l 1,13,15.
  • Increased or decreased expression of a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide can be measured using any on of the methods well known in the art for the quantitation of polynucleotides, such as, for example, amplification, PCR, RT-PCR, RNase protection, Northern blotting, spectrometry and other hybridization methods.
  • a diagnostic assay in accordance with the invention for detecting over-expression of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide compared to normal control tissue samples may be used to detect the presence of an infection, for example.
  • Assay techniques that can be used to determine levels of a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide, in a sample derived from a host, such as a bodily material are well- known to those of skill in the art.
  • Such assay methods include radioimmunoassays, competitive-binding assays, Western Blot analysis, antibody sandwich assays, antibody detection and ELISA assays.
  • the polynucleotides of the invention may be used as components of polynucleotide arrays, preferably high density arrays or grids. These high density arrays are particularly useful for diagnostic and prognostic purposes.
  • a set of spots each comprising a different gene, and further comprising a polynucleotide or polynucleotides of the invention may be used for probing, such as using hybridization or nucleic acid amplification, using a probe obtained or derived from a bodily sample, to determine the presence of a particular polynucleotide sequence or related sequence in an individual.
  • Such a presence may indicate the presence of a pathogen, particularly Neisseria meningitidis, and may be useful in diagnosing and/or prognosing disease or a course of disease.
  • a grid comprising a number of variants of the polynucleotide sequence of SEQ ID NO: 1,3,5,7,9,11,13,15 are preferred. Also preferred is a grid comprising a number of variants of a polynucleotide sequence encoding the polypeptide sequence of SEQ ID NO:2,4,6,8,10,12,14,16.
  • polypeptides and polynucleotides of the invention or variants thereof, or cells expressing the same can be used as immunogens to produce antibodies immunospecific for such polypeptides or polynucleotides respectively.
  • Antibodies generated against the polypeptides or polynucleotides of the invention can be obtained by administering the polypeptides and/or polynucleotides of the invention, or epitope-bearing fragments of either or both, analogues of either or both, or cells expressing either or both, to an animal, preferably a nonhuman, using routine protocols.
  • any technique known in the art that provides antibodies produced by continuous cell line cultures can be used. Examples include various techniques, such as those in Kohler, G. and Milstein, C, Nature 256: 495-497 (1975); Kozbor et al, Immunology Today 4: 72 (1983); Cole et al, pg. 77-96 in MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc. (1985).
  • phage display technology may be utilized to select antibody genes with binding activities towards a polypeptide of the invention either from repertoires of PCR amplified v-genes of lymphocytes from humans screened for possessing anti- B ASB051 , BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 or from naive libraries (McCafferty, et al, (1990), Nature 348, 552-554; Marks, et al, (1992) Biotechnology 10, 779-783).
  • the affinity of these antibodies can also be improved by, for example, chain shuffling (Clackson et al, (1991) Nature 352: 628).
  • the above-described antibodies may be employed to isolate or to identify clones expressing the polypeptides or polynucleotides of the invention to purify the polypeptides or polynucleotides by, for example, affinity chromatography.
  • antibodies against BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 -polypeptide or BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 -polynucleotide may be employed to treat infections, particularly bacterial infections.
  • Polypeptide variants include antigenically, epitopically or immunologically equivalent variants form a particular aspect of this invention.
  • the antibody or variant thereof is modified to make it less immunogenic in the individual.
  • the antibody may most preferably be "humanized," where the complimentarity determining region or regions of the hybridoma- derived antibody has been transplanted into a human monoclonal antibody, for example as described in Jones et al. (1986), Nature 321, 522-525 or Tempest et al, (1991) Biotechnology 9, 266-273.
  • Polypeptides and polynucleotides of the invention may also be used to assess the binding of small molecule substrates and ligands in, for example, cells, cell-free preparations, chemical libraries, and natural product mixtures.
  • substrates and ligands may be natural substrates and ligands or may be structural or functional mimetics. See, e.g., Coligan et al, Current Protocols in Immunology 1(2): Chapter 5 (1991).
  • the screening methods may simply measure the binding of a candidate compound to the polypeptide or polynucleotide, or to cells or membranes bearing the polypeptide or polynucleotide, or a fusion protein of the polypeptide by means of a label directly or indirectly associated with the candidate compound.
  • the screening method may involve competition with a labeled competitor.
  • these screening methods may test whether the candidate compound results in a signal generated by activation or inhibition of the polypeptide or polynucleotide, using detection systems appropriate to the cells comprising the polypeptide or polynucleotide. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist by the presence of the candidate compound is observed.
  • Constitutively active polypeptide and/or constitutively expressed polypeptides and polynucleotides may be employed in screening methods for inverse agonists or inhibitors, in the absence of an agonist or inhibitor, by testing whether the candidate compound results in inhibition of activation of the polypeptide or polynucleotide, as the case may be. Further, the screening methods may simply comprise the steps of mixing a candidate compound with a solution containing a polypeptide or polynucleotide of the present invention, to form a mixture, measuring
  • BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide and/or polynucleotide activity in the mixture and comparing the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide and/or polynucleotide activity of the mixture to a standard.
  • Fusion proteins such as those made from Fc portion and B ASB051 , B ASB057, B ASB060, B ASB061 , BASB063, BASB065, BASB066 or BASB071 polypeptide, as hereinbefore described, can also be used for high-throughput screening assays to identify antagonists of the polypeptide of the present invention, as well as of phylogenetically and and/or functionally related polypeptides (see D. Bennett et al, J Mol Recognition, 8:52-58 (1995); and K. Johanson et al, J Biol Chem, 270(16):9459-9471 (1995)).
  • polypeptides and antibodies that bind to and/or interact with a polypeptide of the present invention may also be used to configure screening methods for detecting the effect of added compounds on the production of mRNA and/or polypeptide in cells.
  • an ELISA assay may be constructed for measuring secreted or cell associated levels of polypeptide using monoclonal and polyclonal antibodies by standard methods known in the art. This can be used to discover agents which may inhibit or enhance the production of polypeptide (also called antagonist or agonist, respectively) from suitably manipulated cells or tissues.
  • the invention also provides a method of screening compounds to identify those which enhance (agonist) or block (antagonist) the action of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptides or polynucleotides, particularly those compounds that are bacteristatic and/or bactericidal.
  • the method of screening may involve high-throughput techniques.
  • a synthetic reaction mix comprising BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide and a labeled substrate or ligand of such polypeptide is incubated in the absence or the presence of a candidate molecule that may be a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 agonist or antagonist.
  • the ability of the candidate molecule to agonize or antagonize the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide is reflected in decreased binding of the labeled ligand or decreased production of product from such substrate. Molecules that bind gratuitously, /. e. , without inducing the effects of BASB051 , BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide are most likely to be good antagonists.
  • Molecules that bind well and, as the case may be, increase the rate of product production from substrate, increase signal transduction, or increase chemical channel activity are agonists. Detection of the rate or level of, as the case may be, production of product from substrate, signal transduction, or chemical channel activity may be enhanced by using a reporter system.
  • Reporter systems that may be useful in this regard include but are not limited to colorimetric, labeled substrate converted into product, a reporter gene that is responsive to changes in BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide or polypeptide activity, and binding assays known in the art.
  • Another example of an assay for BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 agonists is a competitive assay that combines BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 and a potential agonist with BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 -binding molecules, recombinant BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 binding molecules, natural substrates or ligands, or substrate or ligand mimetics, under appropriate conditions for a competitive inhibition assay.
  • BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 can be labeled, such as by radioactivity or a colorimetric compound, such that the number of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 molecules bound to a binding molecule or converted to product can be determined accurately to assess the effectiveness of the potential antagonist.
  • Potential antagonists include, among others, small organic molecules, peptides, polypeptides and antibodies that bind to a polynucleotide and/or polypeptide of the invention and thereby inhibit or extinguish its activity or expression.
  • Potential antagonists also may be small organic molecules, a peptide, a polypeptide such as a closely related protein or antibody that binds the same sites on a binding molecule, such as a binding molecule, without inducing BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 -induced activities, thereby preventing the action or expression of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptides and/or polynucleotides by excluding BASB051, BASB057, BASB060, BASB
  • Potential antagonists include a small molecule that binds to and occupies the binding site of the polypeptide thereby preventing binding to cellular binding molecules, such that normal biological activity is prevented.
  • small molecules include but are not limited to small organic molecules, peptides or peptide-like molecules.
  • Other potential antagonists include antisense molecules (see Okano, J Neurochem. 56: 560 (1991);
  • Preferred potential antagonists include compounds related to and variants of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071.
  • the present invention relates to genetically engineered soluble fusion proteins comprising a polypeptide of the present invention, or a fragment thereof, and various portions of the constant regions of heavy or light chains of immunoglobulins of various subclasses (IgG, IgM, IgA, IgE).
  • immunoglobulin is the constant part of the heavy chain of human IgG, particularly IgGl, where fusion takes place at the hinge region.
  • the Fc part can be removed simply by incorporation of a cleavage sequence which can be cleaved with blood clotting factor Xa.
  • this invention relates to processes for the preparation of these fusion proteins by genetic engineering, and to the use thereof for drug screening, diagnosis and therapy.
  • a further aspect of the invention also relates to polynucleotides encoding such fusion proteins. Examples of fusion protein technology can be found in International Patent Application Nos. WO94/29458 and WO94/22914.
  • Each of the polynucleotide sequences provided herein may be used in the discovery and development of antibacterial compounds.
  • the encoded protein upon expression, can be used as a target for the screening of antibacterial drugs.
  • the polynucleotide sequences encoding the amino terminal regions of the encoded protein or Shine-Delgarno or other translation facilitating sequences of the respective mRNA can be used to construct antisense sequences to control the expression of the coding sequence of interest.
  • the invention also provides the use of the polypeptide, polynucleotide, agonist or antagonist of the invention to interfere with the initial physical interaction between a pathogen or pathogens and a eukaryotic, preferably mammalian, host responsible for sequelae of infection.
  • the molecules of the invention may be used: in the prevention of adhesion of bacteria, in particular gram positive and/or gram negative bacteria, to eukaryotic, preferably mammalian, extracellular matrix proteins on in-dwelling devices or to extracellular matrix proteins in wounds; to block bacterial adhesion between eukaryotic, preferably mammalian, extracellular matrix proteins and bacterial BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 proteins that mediate tissue damage and/or; to block the normal progression of pathogenesis in infections initiated other than by the implantation of in-dwelling devices or by other surgical techniques.
  • BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 agonists and antagonists preferably bacteristatic or bactericidal agonists and antagonists.
  • the antagonists and agonists of the invention may be employed, for instance, to prevent, inhibit and/or treat diseases.
  • the present invention relates to mimotopes of the polypeptide of the invention.
  • a mimotope is a peptide sequence, sufficiently similar to the native peptide (sequentially or structurally), which is capable of being recognised by antibodies which recognise the native peptide; or is capable of raising antibodies which recognise the native peptide when coupled to a suitable carrier.
  • Peptide mimotopes may be designed for a particular purpose by addition, deletion or substitution of elected amino acids.
  • the peptides may be modified for the purposes of ease of conjugation to a protein carrier. For example, it may be desirable for some chemical conjugation methods to include a terminal cysteine.
  • peptides conjugated to a protein carrier may include a hydrophobic terminus distal from the conjugated terminus of the peptide, such that the free unconjugated end of the peptide remains associated with the surface of the carrier protein.
  • the peptides may be altered to have an N-terminal cysteine and a C-terminal hydrophobic amidated tail.
  • the addition or substitution of a D-stereoisomer form of one or more of the amino acids may be performed to create a beneficial derivative, for example to enhance stability of the peptide.
  • peptide mimotopes may be identified using antibodies which are capable themselves of binding to the polypeptides of the present invention using techniques such as phage display technology (EP 0 552 267 Bl). This technique, generates a large number of peptide sequences which mimic the structure of the native peptides and are, therefore, capable of binding to anti-native peptide antibodies, but may not necessarily themselves share significant sequence homology to the native polypeptide.
  • Another aspect of the invention relates to a method for inducing an immunological response in an individual, particularly a mammal, preferably humans, which comprises inoculating the individual with BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide and/or polypeptide, or a fragment or variant thereof, adequate to produce antibody and/ or T cell immune response to protect said individual from infection, particularly bacterial infection and most particularly Neisseria meningitidis infection. Also provided are methods whereby such immunological response slows bacterial replication.
  • Yet another aspect of the invention relates to a method of inducing immunological response in an individual which comprises delivering to such individual a nucleic acid vector, sequence or ribozyme to direct expression of BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide and/or polypeptide, or a fragment or a variant thereof, for expressing BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide and/or polypeptide, or a fragment or a variant thereof in vivo in order to induce an immunological response, such as, to produce antibody and/ or T cell immune response, including, for example, cytokine- producing T cells or cytotoxic T cells, to protect said individual, preferably a human, from disease, whether that disease is already established within the individual
  • nucleic acid vector may comprise DNA, RNA, a ribozyme, a modified nucleic acid, a DNA/RNA hybrid, a DNA-protein complex or an RNA-protein complex.
  • a further aspect of the invention relates to an immunological composition that when introduced into an individual, preferably a human, capable of having induced within it an immunological response, induces an immunological response in such individual to a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide and/or polypeptide encoded therefrom, wherein the composition comprises a recombinant BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide and/or polypeptide encoded therefrom and/or comprises DNA and/or RNA which encodes and expresses an antigen of said BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleot
  • a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide or a fragment thereof may be fused with co-protein or chemical moiety which may or may not by itself produce antibodies, but which is capable of stabilizing the first protein and producing a fused or modified protein which will have antigenic and/or immunogenic properties, and preferably protective properties.
  • fused recombinant protein preferably further comprises an antigenic co-protein, such as lipoprotein D from Haemophilus influenzae, Glutathione-S-transferase (GST) or beta- galactosidase, or any other relatively large co-protein which solubilizes the protein and facilitates production and purification thereof.
  • an antigenic co-protein such as lipoprotein D from Haemophilus influenzae, Glutathione-S-transferase (GST) or beta- galactosidase, or any other relatively large co-protein which solubilizes the protein and facilitates production and purification thereof.
  • the co-protein may act as an adjuvant in the sense of providing a generalized stimulation of the immune system of the organism receiving the protein.
  • the co-protein may be attached to either the amino- or carboxy-terminus of the first protein.
  • a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide and/or polynucleotide, or a fragment, or a mimotope, or a variant thereof may be present in a vector, such as the live recombinant vectors described above for example live bacterial vectors.
  • non-live vectors for the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide, for example bacterial outer- membrane vesicles or "blebs".
  • OM blebs are derived from the outer membrane of the two- layer membrane of Gram-negative bacteria and have been documented in many Gram- negative bacteria (Zhou, L et al. 1998. FEMS Microbiol. Lett. 163:223-228) including C. trachomatis and C.
  • a non-exhaustive list of bacterial pathogens reported to produce blebs also includes: Bordetella pertussis, Borrelia burgdorferi, Brucella melitensis, Brucella ovis, Esherichia coli, Haemophilus influenza, Legionella pneumophila, Neisseria gonorrhoeae, Neisseria meningitidis, Pseudomonas aeruginosa and Yersinia enterocolitica.
  • Blebs have the advantage of providing outer-membrane proteins in their native conformation and are thus particularly useful for vaccines. Blebs can also be improved for vaccine use by engineering the bacterium so as to modify the expression of one or more molecules at the outer membrane.
  • a desired immunogenic protein at the outer membrane such as the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide, can be introduced or upregulated (e.g. by altering the promoter).
  • the expression of outer- membrane molecules which are either not relevant (e.g. unprotective antigens or immunodominant but variable proteins) or detrimental (e.g. toxic molecules such as LPS, or potential inducers of an autoimmune response) can be downregulated.
  • the non-coding flanking regions of the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 gene contains regulatory elements important in the expression of the gene. This regulation takes place both at the transcriptional and translational level.
  • the sequence of these regions, either upstream or downstream of the open reading frame of the gene, can be obtained by DNA sequencing. This sequence information allows the determination of potential regulatory motifs such as the different promoter elements, terminator sequences, inducible sequence elements, repressors, elements responsible for phase variation, the shine-dalgarno sequence, regions with potential secondary structure involved in regulation, as well as other types of regulatory motifs or sequences.
  • This sequence information allows the modulation of the natural expression of the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 gene.
  • the upregulation of the gene expression may be accomplished by altering the promoter, the shine-dalgarno sequence, potential repressor or operator elements, or any other elements involved.
  • downregulation of expression can be achieved by similar types of modification.
  • the expression of the gene can be put under phase variation control, or it may be uncoupled from this regulation.
  • the expression of the gene can be put under the control of one or more inducible elements allowing regulated expression. Examples of such regulation include, but are not limited to, induction by temperature shift, addition of inductor substrates like selected carbohydrates or their derivatives, trace elements, vitamins, co-factors, metal ions, etc.
  • modifications as described above can be introduced by several different means.
  • the modification of sequences involved in gene expression can be carried out in vivo by random mutagenesis followed by selection for the desired phenotype.
  • Another approach consists in isolating the region of interest and modifying it by random mutagenesis, or site- directed replacement, insertion or deletion mutagenesis.
  • the modified region can then be reintroduced into the bacterial genome by homologous recombination, and the effect on gene expression can be assessed.
  • the sequence knowledge of the region of interest can be used to replace or delete all or part of the natural regulatory sequences.
  • the regulatory region targeted is isolated and modified so as to contain the regulatory elements from another gene, a combination of regulatory elements from different genes, a synthetic regulatory region, or any other regulatory region, or to delete selected parts of the wild-type regulatory sequences. These modified sequences can then be reintroduced into the bacterium via homologous recombination into the genome.
  • a non-exhaustive list of preferred promoters that could be used for up-regulation of gene expression includes the promoters porA, porB, IbpB, tbpB, pi 10, 1st, hpuAB from N. meningitidis or N.
  • gonorroheae ompCD, copB, IbpB, ompE, UspAl; UspA2; TbpB from M. Catarrhalis; pi, p2, p4, p5, p6, lpD, tbpB, D15, Hia, Hmwl, Hmw2 from H. influenzae.
  • the expression of the gene can be modulated by exchanging its promoter with a stronger promoter (through isolating the upstream sequence of the gene, in vitro modification of this sequence, and reintroduction into the genome by homologous recombination).
  • Upregulated expression can be obtained in both the bacterium as well as in the outer membrane vesicles shed (or made) from the bacterium.
  • the described approaches can be used to generate recombinant bacterial strains with improved characteristics for vaccine applications. These can be, but are not limited to, attenuated strains, strains with increased expression of selected antigens, strains with knock-outs (or decreased expression) of genes interfering with the immune response, strains with modulated expression of immunodominant proteins, strains with modulated shedding of outer-membrane vesicles.
  • modified upstream region of the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 gene which modified upstream region contains a heterologous regulatory element which alters the expression level of the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 protein located at the outer membrane.
  • the upstream region includes the sequence upstream of the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 gene.
  • the upstream region starts immediately upstream of the BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 gene and continues usually to a position no more than about 1000 bp upstream of the gene from the ATG start codon.
  • the upstream region can start immediately preceding the gene of interest, or preceding the first gene in the operon.
  • a modified upstream region according to this aspect of the invention contains a heterologous promotor at a position between 500 and 700 bp upstream of the ATG.
  • the invention provides a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 and BASB071 polypeptide, in a modified bacterial bleb.
  • the invention further provides modified host cells capable of producing the non-live membrane-based bleb vectors.
  • the invention further provides nucleic acid vectors comprising the B ASB051 , BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 and BASB071 gene having a modified upstream region containing a heterologous regulatory element.
  • compositions particularly vaccine compositions, and methods comprising the polypeptides and/or polynucleotides of the invention and immunostimulatory DNA sequences, such as those described in Sato, Y. et al. Science 273 : 352 (1996).
  • polynucleotide or particular fragments thereof which have been shown to encode non-variable regions of bacterial cell surface proteins, in polynucleotide constructs used in such genetic immunization experiments in animal models of infection with Neisseria meningitidis.
  • Such experiments will be particularly useful for identifying protein epitopes able to provoke a prophylactic or therapeutic immune response. It is believed that this approach will allow for the subsequent preparation of monoclonal antibodies of particular value, derived from the requisite organ of the animal successfully resisting or clearing infection, for the development of prophylactic agents or therapeutic treatments of bacterial infection, particularly Neisseria meningitidis infection, in mammals, particularly humans.
  • the invention also includes a vaccine formulation which comprises an immunogenic recombinant polypeptide and/or polynucleotide of the invention together with a suitable carrier, such as a pharmaceutically acceptable carrier. Since the polypeptides and polynucleotides may be broken down in the stomach, each is preferably administered parenterally, including, for example, administration that is subcutaneous, intramuscular, intravenous, or intradermal.
  • Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteristatic compounds and solutes which render the formulation isotonic with the bodily fluid, preferably the blood, of the individual; and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents.
  • the formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use.
  • the vaccine formulation of the invention may also include adjuvant systems for enhancing the immunogenicity of the formulation.
  • the adjuvant system raises preferentially a TH1 type of response.
  • An immune response may be broadly distinguished into two extreme catagories, being a humoral or cell mediated immune responses (traditionally characterised by antibody and cellular effector mechanisms of protection respectively). These categories of response have been termed THl-type responses (cell-mediated response), and TH2-type immune responses (humoral response).
  • Extreme THl-type immune responses may be characterised by the generation of antigen specific, haplotype restricted cytotoxic T lymphocytes, and natural killer cell responses.
  • mice THl-type responses are often characterised by the generation of antibodies of the IgG2a subtype, whilst in the human these correspond to IgGl type antibodies.
  • TH2-type immune responses are characterised by the generation of a broad range of immunoglobulin isotypes including in mice IgGl, IgA, and IgM.
  • cytokines the driving force behind the development of these two types of immune responses.
  • High levels of THl-type cytokines tend to favour the induction of cell mediated immune responses to the given antigen, whilst high levels of TH2-type cytokines tend to favour the induction of humoral immune responses to the antigen.
  • THl and TH2-type immune responses are not absolute. In reality an individual will support an immune response which is described as being predominantly THl or predominantly TH2.
  • Mosmann and Coffman Mosmann, T.R. and Coffman, R.L.
  • THl and TH2 cells different patterns oflymphokine secretion lead to different functional properties. Annual Review of Immunology, 7, pi 45-173).
  • THl-type responses are associated with the production of the INF- ⁇ and IL-2 cytokines by T-lymphocytes.
  • Other cytokines often directly associated with the induction of THl-type immune responses are not produced by T-cells, such as IL-12.
  • TH2- type responses are associated with the secretion of IL-4, IL-5, IL-6 and IL-13.
  • the best indicators of the THl :TH2 balance of the immune response after a vaccination or infection includes direct measurement of the production of THl or TH2 cytokines by T lymphocytes in vitro after restimulation with antigen, and/or the measurement of the IgGl :IgG2a ratio of antigen specific antibody responses.
  • a THl-type adjuvant is one which preferentially stimulates isolated T-cell populations to produce high levels of THl-type cytokines when re-stimulated with antigen in vitro, and promotes development of both CD8+ cytotoxic T lymphocytes and antigen specific immunoglobulin responses associated with THl-type isotype.
  • Adjuvants which are capable of preferential stimulation of the THl cell response are described in International Patent Application No. WO 94/00153 and WO 95/17209.
  • 3 De-O-acylated monophosphoryl lipid A is one such adjuvant. This is known from GB 2220211 (Ribi). Chemically it is a mixture of 3 De-O-acylated monophosphoryl lipid A with 4, 5 or 6 acylated chains and is manufactured by Ribi Immunochem, Montana. A preferred form of 3 De-O-acylated monophosphoryl lipid A is disclosed in European Patent 0 689 454 Bl (SmithKline Beecham Biologicals SA).
  • the particles of 3D-MPL are small enough to be sterile filtered through a 0.22micron membrane (European Patent number 0 689 454).
  • 3D-MPL will be present in the range of lO ⁇ g - lOO ⁇ g preferably 25-50 ⁇ g per dose wherein the antigen will typically be present in a range 2-50 ⁇ g per dose.
  • Another preferred adjuvant comprises QS21, an Hplc purified non-toxic fraction derived from the bark of Quillaja Saponaria Molina.
  • this may be admixed with 3 De- O-acylated monophosphoryl lipid A (3D-MPL), optionally together with a carrier.
  • 3D-MPL 3 De- O-acylated monophosphoryl lipid A
  • Non-reactogenic adjuvant formulations containing QS21 have been described previously (WO 96/33739). Such formulations comprising QS21 and cholesterol have been shown to be successful THl stimulating adjuvants when formulated together with an antigen.
  • Further adjuvants which are preferential stimulators of THl cell response include immunomodulatory oligonucleotides, for example unmethylated CpG sequences as disclosed in WO 96/02555.
  • THl stimulating adjuvants such as those mentioned hereinabove, are also contemplated as providing an adjuvant which is a preferential stimulator of THl cell response.
  • QS21 can be formulated together with 3D- MPL.
  • the ratio of QS21 : 3D-MPL will typically be in the order of 1 : 10 to 10 : 1; preferably 1 :5 to 5 : 1 and often substantially 1 : 1.
  • the preferred range for optimal synergy is 2.5 : 1 to 1 : 1 3D-MPL: QS21.
  • a carrier is also present in the vaccine composition according to the invention.
  • the carrier may be an oil in water emulsion, or an aluminium salt, such as aluminium phosphate or aluminium hydroxide.
  • a preferred oil-in-water emulsion comprises a metabolisible oil, such as squalene, alpha tocopherol and Tween 80.
  • a metabolisible oil such as squalene, alpha tocopherol and Tween 80.
  • the antigens in the vaccine composition according to the invention are combined with QS21 and 3D-MPL in such an emulsion.
  • the oil in water emulsion may contain span 85 and/or lecithin and/or tricaprylin.
  • QS21 and 3D-MPL will be present in a vaccine in the range of l ⁇ g - 200 ⁇ g, such as 10-100 ⁇ g, preferably lO ⁇ g - 50 ⁇ g per dose.
  • the oil in water will comprise from 2 to 10% squalene, from 2 to 10% alpha tocopherol and from 0.3 to 3%> tween 80.
  • the ratio of squalene: alpha tocopherol is equal to or less than 1 as this provides a more stable emulsion.
  • Span 85 may also be present at a level of 1%. In some cases it may be advantageous that the vaccines of the present invention will further contain a stabiliser.
  • Non-toxic oil in water emulsions preferably contain a non-toxic oil, e.g. squalane or squalene, an emulsifier, e.g. Tween 80, in an aqueous carrier.
  • a non-toxic oil e.g. squalane or squalene
  • an emulsifier e.g. Tween 80
  • the aqueous carrier may be, for example, phosphate buffered saline.
  • the present invention also provides a polyvalent vaccine composition
  • a polyvalent vaccine composition comprising a vaccine formulation of the invention in combination with other antigens, in particular antigens useful for treating cancers, autoimmune diseases and related conditions.
  • a polyvalent vaccine composition may include a TH-1 inducing adjuvant as hereinbefore described.
  • the antigen can also be delivered in the form of whole bacteria (dead or alive) or as subcellular fractions, these possibilities do include N. meningitidis itself
  • compositions for purposes of compositions, kits and administration
  • compositions comprising a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polynucleotide and or a BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 or BASB071 polypeptide for administration to a cell or to a multicellular organism.
  • compositions comprising a polynucleotide and/or a polypeptide discussed herein or their agonists or antagonists.
  • the polypeptides and polynucleotides of the invention may be employed in combination with a non-sterile or sterile carrier or carriers for use with cells, tissues or organisms, such as a pharmaceutical carrier suitable for administration to an individual.
  • a pharmaceutical carrier suitable for administration to an individual.
  • Such compositions comprise, for instance, a media additive or a therapeutically effective amount of a polypeptide and/or polynucleotide of the invention and a pharmaceutically acceptable carrier or excipient.
  • Such carriers may include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol and combinations thereof.
  • the formulation should suit the mode of administration.
  • the invention further relates to diagnostic and pharmaceutical packs and kits comprising one or more containers filled with one or more of the ingredients of the aforementioned compositions of the invention.
  • Polypeptides, polynucleotides and other compounds of the invention may be employed alone or in conjunction with other compounds, such as therapeutic compounds.
  • compositions may be administered in any effective, convenient manner including, for instance, administration by topical, oral, anal, vaginal, intravenous, intraperitoneal, intramuscular, subcutaneous, intranasal or intradermal routes among others.
  • the active agent may be administered to an individual as an injectable composition, for example as a sterile aqueous dispersion, preferably isotonic.
  • the present invention provides for pharmaceutical compositions comprising a therapeutically effective amount of a polypeptide and/or polynucleotide, such as the soluble form of a polypeptide and/or polynucleotide of the present invention, agonist or antagonist peptide or small molecule compound, in combination with a pharmaceutically acceptable carrier or excipient.
  • a pharmaceutically acceptable carrier or excipient include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
  • the invention further relates to pharmaceutical packs and kits comprising one or more containers filled with one or more of the ingredients of the aforementioned compositions of the invention.
  • Polypeptides, polynucleotides and other compounds of the present invention may be employed alone or in conjunction with other compounds, such as therapeutic compounds.
  • composition will be adapted to the route of administration, for instance by a systemic or an oral route.
  • Preferred forms of systemic administration include injection, typically by intravenous injection. Other injection routes, such as subcutaneous, intramuscular, or intraperitoneal, can be used.
  • Alternative means for systemic administration include transmucosal and transdermal administration using penetrants such as bile salts or f ⁇ isidic acids or other detergents.
  • penetrants such as bile salts or f ⁇ isidic acids or other detergents.
  • oral administration may also be possible. Administration of these compounds may also be topical and/or localized, in the form of salves, pastes, gels, solutions, powders and the like.
  • the daily dosage level of the active agent will be from 0.01 mg/kg to 10 mg/kg, typically around 1 mg/kg.
  • the physician in any event will determine the actual dosage which will be most suitable for an individual and will vary with the age, weight and response of the particular individual.
  • the above dosages are exemplary of the average case. There can, of course, be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention.
  • Suitable dosages are in the range of 0.1 -100 ⁇ g/kg of subject.
  • a vaccine composition is conveniently in injectable form. Conventional adjuvants may be employed to enhance the immune response.
  • a suitable unit dose for vaccination is 0.5-5 microgram/kg of antigen, and such dose is preferably administered 1-3 times and with an interval of 1-3 weeks. With the indicated dose range, no adverse toxicological effects will be observed with the compounds of the invention which would preclude their administration to suitable individuals.
  • Sequence Databases Sequences in a Tangible Medium, and Algorithms
  • Polynucleotide and polypeptide sequences form a valuable information resource with which to determine their 2- and 3-dimensional structures as well as to identify further sequences of similar homology.
  • These approaches are most easily facilitated by storing the sequence in a computer readable medium and then using the stored data in a known macromolecular structure program or to search a sequence database using well known searching tools, such as the GCG program package.
  • sequence analysis includes, for example, methods of sequence homology analysis, such as identity and similarity analysis, DNA, RNA and protein structure analysis, sequence assembly, cladistic analysis, sequence motif analysis, open reading frame determination, nucleic acid base calling, codon usage analysis, nucleic acid base trimming, and sequencing chromatogram peak analysis.
  • a computer based method for performing homology identification. This method comprises the steps of: providing a first polynucleotide sequence comprising the sequence of a polynucleotide of the invention in a computer readable medium; and comparing said first polynucleotide sequence to at least one second polynucleotide or polypeptide sequence to identify homology.
  • a computer based method for performing homology identification, said method comprising the steps of: providing a first polypeptide sequence comprising the sequence of a polypeptide of the invention in a computer readable medium; and comparing said first polypeptide sequence to at least one second polynucleotide or polypeptide sequence to identify homology.
  • Identity is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as the case may be, as determined by comparing the sequences.
  • identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences.
  • Identity can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heine, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M.
  • Methods to determine identity are designed to give the largest match between the sequences tested. Moreover, methods to determine identity are codified in publicly available computer programs. Computer program methods to determine identity between two sequences include, but are not limited to, the GAP program in the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN (Altschul, S.F. et al., J Mol. Biol.
  • BLAST Pearson and Lipman Proc. Natl. Acad. Sci. USA 85; 2444-2448 (1988).
  • the BLAST family of programs is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al, NCBI NLM NIH Bethesda, MD 20894; Altschul, S., et al, J. Mol. Biol. 215: 403-410 (1990).
  • the well known Smith Waterman algorithm may also be used to determine identity.
  • Parameters for polynucleotide comparison include the following:
  • Gap Length Penalty 3 Available as: The "gap” program from Genetics Computer Group, Madison WI. These are the default parameters for nucleic acid comparisons.
  • Polynucleotide embodiments further include an isolated polynucleotide comprising a polynucleotide sequence having at least a 50, 60, 70, 80, 85, 90, 95, 97 or 100% identity to the reference sequence of SEQ ID NO:l, wherein said polynucleotide sequence may be identical to the reference sequence of SEQ ID NO:l or may include up to a certain integer number of nucleotide alterations as compared to the reference sequence, wherein said alterations are selected from the group consisting of at least one nucleotide deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among the nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence, and wherein said number of nucleotide alterations is determined by multiplying the total number of nucleotides in SEQ ID NO:l by the integer
  • n n is the number of nucleotide alterations
  • x n is the total number of nucleotides in SEQ ID NO:l
  • y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%, 0.97 for 97% or 1.00 for 100%
  • • is the symbol for the multiplication operator, and wherein any non-integer product of x n and y is rounded down to the nearest integer prior to subtracting it from x n .
  • Alterations of a polynucleotide sequence encoding the polypeptide of SEQ ID NO:2 may create nonsense, missense or frameshift mutations in this coding sequence and thereby alter the polypeptide encoded by the polynucleotide following such alterations.
  • a polynucleotide sequence of the present invention may be identical to the reference sequence of SEQ ID NO:l, that is it may be 100% identical, or it may include up to a certain integer number of nucleic acid alterations as compared to the reference sequence such that the percent identity is less than 100% identity.
  • Such alterations are selected from the group consisting of at least one nucleic acid deletion, substitution, including transition and transversion, or insertion, and wherein said alterations may occur at the 5' or 3' terminal positions of the reference polynucleotide sequence or anywhere between those terminal positions, interspersed either individually among the nucleic acids in the reference sequence or in one or more contiguous groups within the reference sequence.
  • the number of nucleic acid alterations for a given percent identity is determined by multiplying the total number of nucleic acids in SEQ ID NO:l by the integer defining the percent identity divided by 100 and then subtracting that product from said total number of nucleic acids in SEQ ID NO:l, or: n n ⁇ x n - (x n • y),
  • n n is the number of nucleic acid alterations
  • x n is the total number of nucleic acids in SEQ ID NO:l
  • y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc.
  • • is the symbol for the multiplication operator, and wherein any non-integer product of x n and y is rounded down to the nearest integer prior to subtracting it from x n .
  • Polypeptide embodiments further include an isolated polypeptide comprising a polypeptide having at least a 50, 60, 70, 80, 85, 90, 95, 97 or 100% identity to a polypeptide reference sequence of SEQ ID NO:2, wherein said polypeptide sequence may be identical to the reference sequence of SEQ ID NO:2 or may include up to a certain integer number of amino acid alterations as compared to the reference sequence, wherein said alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence, and wherein said number of amino acid alterations is determined by multiplying the total number of amino acids in SEQ ID NO:2 by the integer defining the percent identity divided by 100 and then subtracting that product from said total number of amino acids in SEQ ID
  • n a is the number of amino acid alterations
  • x a is the total number of amino acids in SEQ ID NO:2
  • y is 0.50 for 50%, 0.60 for 60%, 0.70 for 70%, 0.80 for 80%, 0.85 for 85%, 0.90 for 90%, 0.95 for 95%, 0.97 for 97% or 1.00 for 100%
  • • is the symbol for the multiplication operator, and wherein any non-integer product of x a and y is rounded down to the nearest integer prior to subtracting it from x a .
  • a polypeptide sequence of the present invention may be identical to the reference sequence of SEQ ID NO:2, that is it may be 100% identical, or it may include up to a certain integer number of amino acid alterations as compared to the reference sequence such that the percent identity is less than 100%> identity.
  • Such alterations are selected from the group consisting of at least one amino acid deletion, substitution, including conservative and non-conservative substitution, or insertion, and wherein said alterations may occur at the amino- or carboxy-terminal positions of the reference polypeptide sequence or anywhere between those terminal positions, interspersed either individually among the amino acids in the reference sequence or in one or more contiguous groups within the reference sequence.
  • the number of amino acid alterations for a given % identity is determined by multiplying the total number of amino acids in SEQ ID NO:2 by the integer defining the percent identity divided by 100 and then subtracting that product from said total number of amino acids in SEQ ID NO:2, or:
  • n a is the number of amino acid alterations
  • x a is the total number of amino acids in SEQ ID NO:2
  • y is, for instance 0.70 for 70%, 0.80 for 80%, 0.85 for 85% etc.
  • • is the symbol for the multiplication operator, and wherein any non- integer product of x a and y is rounded down to the nearest integer prior to subtracting it from x a .
  • Isolated means altered “by the hand of man” from its natural state, i.e., if it occurs in nature, it has been changed or removed from its original environment, or both.
  • a polynucleotide or a polypeptide naturally present in a living organism is not “isolated,” but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is “isolated”, as the term is employed herein.
  • a polynucleotide or polypeptide that is introduced into an organism by transformation, genetic manipulation or by any other recombinant method is "isolated” even if it is still present in said organism, which organism may be living or non-living.
  • Polynucleotide(s) generally refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA including single and double-stranded regions.
  • Variant refers to a polynucleotide or polypeptide that differs from a reference polynucleotide or polypeptide, but retains essential properties.
  • a typical variant of a polynucleotide differs in nucleotide sequence from another, reference polynucleotide. Changes in the nucleotide sequence of the variant may or may not alter the amino acid sequence of a polypeptide encoded by the reference polynucleotide. Nucleotide changes may result in amino acid substitutions, additions, deletions, fusions and truncations in the polypeptide encoded by the reference sequence, as discussed below.
  • a typical variant of a polypeptide differs in amino acid sequence from another, reference polypeptide.
  • a variant and reference polypeptide may differ in amino acid sequence by one or more substitutions, additions, deletions in any combination.
  • a substituted or inserted amino acid residue may or may not be one encoded by the genetic code.
  • a variant of a polynucleotide or polypeptide may be a naturally occurring such as an allelic variant, or it may be a variant that is not known to occur naturally. Non-naturally occurring variants of polynucleotides and polypeptides may be made by mutagenesis techniques or by direct synthesis.
  • Disease(s) means any disease caused by or related to infection by a bacteria, including , for example, upper respiratory tract infection, invasive bacterial diseases, such as bacteremia and meningitis.
  • the BASB051 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID ⁇ O: l .
  • the BASB051 polypeptide contains a leader sequence characteristic of a lipoprotein signal sequence.
  • the BASB057 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID NO: 3.
  • the BASB057 polypeptide conains a leader sequence characteristic of a lipoprotein signal sequence.
  • the BASB060 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID ⁇ O:5.
  • the BASB060 polypeptide contains a leader sequence which is characteristic of a lipoprotein signal sequence and has the characteristics of an outer membrane lipoprotein.
  • the BASB061 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID NO:7.
  • the BASB061 polypeptide contains a leader sequence which is characteristic of a lipoprotein signal sequence and has the characteristics of an outer membrane lipoprotein.
  • the BASB063 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID NO:9.
  • the BASB063 polypeptide does contain a leader sequence which is characteristic of a lipoprotein signal sequence and has the characteristics of an outer membrane lipoprotein.
  • the BASB065 gene in N.meningitidis strain ATCC 13090 is shown in SEQ ID ⁇ O: l l .
  • the BASB065 polypeptide does contain a leader sequence which is characteristic of a lipoprotein signal sequence and has the characteristics of an outer membrane lipoprotein.
  • the BASB066 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID NO: 13.
  • the BASB066 polypeptide contains a leader sequence which has the characteristics of a lipoprotein signal sequence and has the characteristics of a protein located in the outer membrane.
  • the BASB071 gene of N. meningitidis strain ATCC 13090 is shown in SEQ ID NO: 15.
  • the BASB071 polypeptide is contains a leader sequence which has the characteristics of a lipoprotein signal sequence.
  • Neisseria meningitidis BASB051 polynucleotide sequence from strain ATCC 13090 ATGAAAAAAATTCTTTTAACGGTTTCATTAGGTTTGGCACTGAGTGCCTGTGCCACTCAA GGTACGGTCGATAAAGATGCTCAGATTACCCAAGATTGGAGTGTGGAGAAGCTCTATGCC GAAGCCCAGGACGAATTGAACAGCAGCAATTATACGCGGGCTGTCAAGTTATACGAAATC TTGGAATCGCGCTTCCCCACCAGCCGGCAATCCCAACTGGATACCGCATAC GCCTATTATAAAGACGATGAAAAAGACAAGGCTCTGGCGGCAATCGAACGCTTCCGCCGC CTCCATCCGCAGCATCCGAATATGGATTACGCGCTGTATCTGCGCGGCTTGGTGCTGTTC AACGAAGACCAGTCCTTCTTGAACAAACTGGCCTCGCAAGACTGGTCCGACCGCGACCCG AAAGCCAACCGCGAAGTAACCCAGGCGTTTGCGGAACTCGTCCAA
  • SEQ ID NO:3 Neisseria meningitidis BASB057 polynucleotide sequence from strain ATCC 13090
  • Neisseria meningitidis BASB060 polynucleotide sequence from strain ATCC 13090 ATGAAAAAACTTCTAATGATAACCCTCACCGGTATGCTTGCAGCTTGTGCAACAGGTGTC AATGTCGGCCGGTTGATGGTTGAAATGCCGCAGGGAGAACGTTCTGTCGTTGTGCAGGTT CCCGCGACAAATAACCCGCTTTCCGATACGGTAGCTGTCGGAATGATTAAAACATCCGGT TCGCCTTCGGCATCAAATATGATTGAAATGCTCGGCGCGGACAATATCAACGTCGGCGTG GTGGGAAGCAGCCAAATGCTTAATAAGGCGACCGCACTTTATTCCTTAAACCATGCAAAG AAAGTCGGAAATAATGTCAGTGTTTATATGATGGGCGACAGCGAAAGTGACAAGGCCGAT TTGGAAAACGCGGCAAATGCCAAAAATATCAAATTGCATTTCTTTAACCAAAAATAAATAAAATAAAATAAAATAAAATAAAATAAAATAAAATAAAATAAAATAAAATAAA
  • Neisseria meningitidis BASB061 polynucleotide sequence from strain ATCC 13090
  • SEQ ID NO:14 Neisseria meningitidis BASB066 polypeptide sequence deduced from the polynucleotide sequence of SEQ ID NO: 13 MFKVKFYIRHAVLLLCGSLIVGCSAIPSSGPSAKKIVSLGQQSEVQIPEVELIDVNHTVA QLLYKAQINQSFTQFGDGYASAGTLNIGDVLDIMI EAPPAVLFGGGLSSMGSGSAHQTK LPEQLVTARGTVSVP- /GDISVVGKTPGQVQEIIKGRLKK ⁇ ANQPQVMVRLVQNNAANVS VIRAGNSVRMPLTAAGERVLDAVAAVGGSTANVQDTNVQLTRGNWRTVALEDLVANPRQ NILLRRGDWTMI NPYTFTSMGAVGRTQEIGFSARGLSLSEAIGRMGGLQDRRSDARGV FVFRYTPLVELPAERQDK IAQGYGSEAEIPTVYRVNMADAHSLFSMQRFPVKNKDV
  • a deposit containing a Neisseria meningitidis Serogroup B strain has been deposited with the American Type Culture Collection (herein "ATCC") on June 22, 1997 and assigned deposit number 13090.
  • the deposit was described as Neisseria meningitidis (Albrecht and Ghon) and is a freeze-dried, 1.5-2.9 kb insert library constructed from N. meningitidis isolate.
  • the deposit is described in Int. Bull. Bacteriol. ⁇ omencl. Taxon. 8: 1-15 (1958).
  • the Neisseria meningitidis strain deposit is referred to herein as "the deposited strain” or as “the D ⁇ A of the deposited strain.”
  • the deposited strain contains the full-length BASB051, BASB057, BASB060, BASB061, BASB063, BASB065, BASB066 and BASB071 genes.
  • the sequence of the polynucleotides contained in the deposited strain, as well as the amino acid sequence of any polypeptide encoded thereby, are controlling in the event of any conflict with any description of sequences herein.
  • the deposit of the deposited strain has been made under the terms of the Budapest Treaty on the International Recognition of the Deposit of Micro-organisms for Purposes of Patent Procedure.
  • the strain will be irrevocably and without restriction or condition released to the public upon the issuance of a patent.
  • the deposited strain is provided merely as convenience to those of skill in the art and is not an admission that a deposit is required for enablement, such as that required under 35 U.S.C. ⁇ 112.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)
  • Communicable Diseases (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
EP00901524A 1999-01-15 2000-01-10 Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies Withdrawn EP1144644A2 (en)

Applications Claiming Priority (25)

Application Number Priority Date Filing Date Title
GB9900838 1999-01-15
GB9900838 1999-01-15
GBGB9900952.4A GB9900952D0 (en) 1999-01-15 1999-01-15 Novel compounds
GB9900952 1999-01-15
GB9901945 1999-01-28
GBGB9901948.1A GB9901948D0 (en) 1999-01-28 1999-01-28 Novel compounds
GB9901948 1999-01-28
GBGB9901945.7A GB9901945D0 (en) 1999-01-28 1999-01-28 Novel compounds
GB9902078 1999-01-29
GBGB9902078.6A GB9902078D0 (en) 1999-01-29 1999-01-29 Novel compounds
GB9902088 1999-01-29
GB9902074 1999-01-29
GBGB9902088.5A GB9902088D0 (en) 1999-01-29 1999-01-29 Novel compounds
GBGB9902074.5A GB9902074D0 (en) 1999-01-29 1999-01-29 Novel compounds
GBGB9902879.7A GB9902879D0 (en) 1999-02-09 1999-02-09 Novel compounds
GB9902879 1999-02-09
GBGB9902936.5A GB9902936D0 (en) 1999-02-10 1999-02-10 Novel compounds
GB9902936 1999-02-10
GB9903978 1999-02-20
GBGB9903978.6A GB9903978D0 (en) 1999-02-20 1999-02-20 Novel compounds
GBGB9904133.7A GB9904133D0 (en) 1999-02-23 1999-02-23 Novel compounds
GB9904133 1999-02-23
GBGB9904404.2A GB9904404D0 (en) 1999-02-25 1999-02-25 Novel compounds
GB9904404 1999-02-25
PCT/EP2000/000135 WO2000042191A2 (en) 1999-01-15 2000-01-10 Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies

Publications (1)

Publication Number Publication Date
EP1144644A2 true EP1144644A2 (en) 2001-10-17

Family

ID=27583076

Family Applications (1)

Application Number Title Priority Date Filing Date
EP00901524A Withdrawn EP1144644A2 (en) 1999-01-15 2000-01-10 Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies

Country Status (6)

Country Link
EP (1) EP1144644A2 (zh)
JP (1) JP2004537953A (zh)
AU (1) AU2288900A (zh)
CA (1) CA2359504A1 (zh)
HK (1) HK1043151A1 (zh)
WO (1) WO2000042191A2 (zh)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB0103171D0 (en) 2001-02-08 2001-03-28 Smithkline Beecham Biolog Vaccine composition
US20120070457A1 (en) * 2010-09-10 2012-03-22 J. Craig Venter Institute, Inc. Polypeptides from neisseria meningitidis
US9657297B2 (en) 2012-02-02 2017-05-23 Glaxosmithkline Biologicals Sa Promoters for increased protein expression in meningococcus

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2751000B1 (fr) * 1996-07-12 1998-10-30 Inst Nat Sante Rech Med Adn specifiques des bacteries de l'espece neisseria meningitidis, leurs procedes d'obtention et leurs applications biologiques

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0042191A2 *

Also Published As

Publication number Publication date
WO2000042191A3 (en) 2000-11-16
WO2000042191A2 (en) 2000-07-20
AU2288900A (en) 2000-08-01
JP2004537953A (ja) 2004-12-24
CA2359504A1 (en) 2000-07-20
HK1043151A1 (zh) 2002-09-06

Similar Documents

Publication Publication Date Title
US8580279B2 (en) Compounds
EP2360260A1 (en) BASB006 polynucleotide(s) and polypeptides from Neisseria meningitis
WO1999058683A9 (en) BASB029 POLYNUCLEOTIDE(S) AND POLYPEPTIDES FROM $i(NEISSERIA MENINGITIDIS)
US20050272091A1 (en) Polynucleotides and polypeptides BASB033 from Neisseria meningitidis and their uses
EP1073747A1 (en) Basb013 dna and proteins from neisseria meningitidis
US20100203057A1 (en) Novel compounds
CA2359486A1 (en) Neisseria meningitidis polypeptide basb052
CA2360658A1 (en) Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies
US20080057067A1 (en) Polypeptides and Polynucleotides "BASB040" From Neisseria Meningitidis and Vaccine Comprising Said Polypeptides and Polynucleotides
US6797273B1 (en) Neisseria meningitidis antigen
EP1105493A1 (en) Basb024 outer membrane protein of neisseria meningitidis
EP1144644A2 (en) Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies
EP1149165A1 (en) Basb055 polynucleotide and polypeptide from neisseria meningitidis. uses thereof

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20010816

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE

AX Request for extension of the european patent

Free format text: AL;LT;LV;MK;RO;SI

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: GLAXOSMITHKLINE BIOLOGICALS S.A.

17Q First examination report despatched

Effective date: 20050610

17Q First examination report despatched

Effective date: 20050610

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20061213

REG Reference to a national code

Ref country code: HK

Ref legal event code: WD

Ref document number: 1043151

Country of ref document: HK