EP0680607A1 - Testverfahren zur ausschluss von membranrissen als risiko bei kurz vor der entbindung stehenden frauen - Google Patents
Testverfahren zur ausschluss von membranrissen als risiko bei kurz vor der entbindung stehenden frauenInfo
- Publication number
- EP0680607A1 EP0680607A1 EP94906621A EP94906621A EP0680607A1 EP 0680607 A1 EP0680607 A1 EP 0680607A1 EP 94906621 A EP94906621 A EP 94906621A EP 94906621 A EP94906621 A EP 94906621A EP 0680607 A1 EP0680607 A1 EP 0680607A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- sample
- igfbp
- delivery
- patient
- membranes
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/689—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to pregnancy or the gonads
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/36—Gynecology or obstetrics
- G01N2800/368—Pregnancy complicated by disease or abnormalities of pregnancy, e.g. preeclampsia, preterm labour
Definitions
- This invention relates to methods for detection of impending delivery, and determining in those women at risk whether the membranes have ruptured.
- this invention is directed to the determination of impending delivery by detecting a biochemical marker for impending delivery in a cervicovaginal secretion sample and ruling out rupture of membranes as the cause of the risk by identifying a lack of IGFBP-1 in the sample.
- Fetal fibronectin is synthesized by extravillus trophoblasts as the trophoblasts invade the maternal decidualized uterus. Insoluble fetal fibronectin is laid down in the extracellular matrix of the placental bed. Soluble fetal fibronectin is found in amniotic fluid.
- the secretion of fetal fibronectin down the birth canal into cervical secretions may arise either by rupture of membranes when amniotic fluid is released down the birth canal or by release (solubilization) of fetal fibronectin from the extracellular matrix in the placental bed or release of fetal fibronectin from trophoblast cells.
- the presence of fetal fibronectin in cervical secretions is a predictor of preterm delivery. Insulin-like growth factor binding protein one
- IGFBP-1 other names for IGFBP-1 include pregnancy-associated endometrial ⁇ -globulin ( ⁇ PEG) , and placental protein-12 (pp 12) [ aites et al, J. Clinical Endocrinology and Metab . 67:1100 1986]), which is synthesized by the uterine endometrium stro a in the late secretory pre-decidualization phase and pregnancy-induced maternal decidua in response to implantation of the fetus in the uterine wall, is an even more abundant protein of amniotic fluid than fetal fibronectin. IGFBP-1 appears to be efficiently transported into the amniotic sac from the decidua.
- ⁇ PEG pregnancy-associated endometrial ⁇ -globulin
- pp 12 placental protein-12
- IGFBP-1 insulin growth factor-1
- the levels of IGFBP-1 in amniotic fluid increase with the length of gestation.
- IGFBP-1 levels increase to approximately 20 mg/ml, and IGFBP-1 becomes one of the most abundant proteins of amniotic fluid.
- Lockwood et al [New Engl . J. Med . , 325:669-674
- IGFBP-1 or any other potential marker is released at a different point in the course of impending delivery, the marker could be used to evaluate the course of the disease.
- the present invention provides an assay that distinguishes those patients with impending imminent delivery with intact membranes from those in whom the membranes have ruptured.
- the method comprises obtaining a cervicovaginal secretion sample from a pregnant patient determined to be as at risk for imminent delivery by detection of a biochemical marker for imminent delivery in a cervicovaginal secretion sample from the patient and determining the level of IGFBP-1 in the sample. If the level of IGFBP-1 is elevated, the patient has rupture of membranes. If IGFBP-1 is not present, the patient has intact membranes.
- the method comprises obtaining a cervicovaginal secretion sample from a pregnant patient after about week 20 of gestation and determining the level of fetal fibronectin and IGFBP-1 in the sample.
- the presence of an elevated fibronectin level in the sample indicates an increased risk of imminent delivery. If the level of IGFBP-1 is elevated, the patient had rupture of membranes. If IGFBP-1 is not present, the patient has intact membranes.
- the fetal fibronectin/IGFBP-1 test is preferably administered to women at about 20 weeks gestation and repeated at each antenatal visit (every two to four weeks) until at least week 37, preferably until delivery, if the test is negative.
- the test of the patient's IGFBP-1 level determines whether the membranes are intact. If the test for IGFBP-1 is negative, the patient can be treated to prolong the pregnancy. The test of IGFBP-1 levels can be repeated during the course of treatment as often as daily to verify that the membranes remain intact. In those patients with an increased level of IGFBP-1, the test indicates that delivery cannot be delayed.
- the present invention is an assay that rules out rupture of membranes in those patients with impending delivery, identifying those patients susceptible to treatments to delay delivery.
- the method comprises obtaining a cervicovaginal secretion sample from a patient determined to be at risk for impending delivery by detection of a biochemical marker for impending delivery in a cervicovaginal secretion sample from the patient and testing a cervicovaginal secretion sample from the patient for IGFBP-1. If the level of IGFBP-1 is elevated, the patient has rupture of membranes. If IGFBP-1 is not detected, the patient has intact membranes.
- a cervicovaginal secretion sample from a pregnant patient is tested for both
- the delivery marker is fetal fibronectin.
- the invention also provides a kit comprising an anti-insulin-like growth factor binding protein one antibody and an antibody specific for an impending delivery marker, preferably fetal fibronectin.
- the present method can be used on any pregnant woman who may be at risk for impending delivery.
- an assay of IGFBP-1 is performed on a cervicovaginal secretion from a patient who has tested positive for the presence of a biochemical indicator of risk for impending delivery to determine whether the membranes are intact.
- the method can be performed on any pregnant patient who satisfies the criteria for the impending delivery marker. For example, the presence of fetal fibronectin in cervicovaginal secretion samples is indicative of impending delivery after week 20 of gestation until delivery, whether delivery is early or post-term.
- the patients who should be tested for a delivery indicator are those patients with clinically intact membranes in a high risk category for preterm delivery, and preferably, all those women whose pregnancies are not sufficiently advanced to ensure delivery of a healthy fetus.
- Ninety percent of the fetal morbidity and 100 percent of the fetal mortality associated with preterm delivery is for those fetuses delivered prior to 32 to 34 weeks gestation. Therefore, 32 to 34 weeks gestation is an important cutoff for the health of the fetus, and women whose pregnancies are at least about 20 weeks and prior to 34 weeks in gestation should be tested.
- risk factors known to be associated with the risk of preterm delivery include multiple fetus gestations; incompetent cervix; uterine anomalies; polyhydramnios; nulliparity; previous preterm rupture of membranes or preterm labor; preeclampsia; first trimester vaginal bleeding; little or no antenatal care; and symptoms such as abdominal pain, low backache, passage of cervical mucus and contractions.
- Any pregnant woman at 12 or more weeks gestation with clinically intact membranes and having one or more risk factors for preterm delivery should be tested throughout the risk period; i.e., until about week 37.
- Risk factors for spontaneous abortion include gross fetal anomalies, abnormal placental formation, uterine anomalies and maternal infectious disease, endocrine disorder cardiovascular renal hypertension, autoimmune and other immunologic disease, and malnutrition. - 1 -
- the sample is obtained in the vicinity of posterior fornix, the ectocervix or external cervical os.
- the sample generally comprises fluid and particulate solids, and may contain vaginal or cervical mucus and other vaginal or cervical secretions. Such samples are referred to herein and in the claims as cervicovaginal secretion samples.
- the sample is preferably removed with a swab having a dacron or other fibrous tip.
- the sample can be obtained with a suction or lavage device. Calculations to account for any additional dilution of the samples collected using liquids can be performed as part of the interpretation of the assay procedure.
- a suitable solution for storage and transfer consists of 0.05 M Tris-HCl, pH 7.4; 0.15 M NaCl, 0.02% NaN 3 , 1% bovine serum albumin (BSA) , 500 Kallikrein
- home and office use devices for immediate processing of the sample can be used. If used, the sample is placed directly in the device and testing is performed within minutes of sample collection. In such cases, the need to stabilize the analyte is minimized and any solution which facilitates performing the assay and is not detrimental to analyte stability can be used.
- biochemical marker of impending delivery which is assayed in a cervicovaginal secretion can be used in the present method.
- Suitable markers include, for example, elastase, total fibronectin, and fetal fibronectin. Most preferred is fetal fibronectin.
- Other markers which are predictive of impending delivery in cervicovaginal secretion samples are known and are useful in this method.
- Elastase is an effective indicator of impending delivery in patients from about 12 weeks gestation to delivery.
- the marker is generally present in cervicovaginal secretion samples at levels about 30 units elastase per liter beginning about two to three weeks prior to delivery. Values less than 30 units per liter are considered negative.
- Total fibronectin is an effective indicator of impending delivery in patients from about 12 weeks gestation to delivery.
- the marker is generally present in cervicovaginal secretion samples beginning about two to three weeks prior to delivery.
- the presence of an elevated level of total fibronectin is indicative of impending delivery.
- the total fibronectin concentration in the sample is at least about 600 to 750 ng/ml of sample after week 20 of gestation. Between weeks 12 and 20 the threshold values vary. Values less than the specified threshold value are considered negative.
- Fetal fibronectin is an effective indicator of impending delivery in patients from about 20 weeks gestation to delivery.
- the marker is generally present at levels about 50 ng/ml in cervicovaginal secretion samples beginning about one to two weeks prior to delivery.
- the delivery marker is tested by any method that determines an increased risk of delivery. For example, a level of total fibronectin over a threshold value is indicative of impending delivery. However, a level of fetal fibronectin above background (e.g. the presence of fetal fibronectin) is indicative of impending delivery.
- IGFBP-1 is assayed by any quantitative or semi-quantitative procedure that can either determine the amount of IGFBP-1 in the sample or that the amount of IGFBP-1 is above a threshold amount that indicates rupture of membranes.
- the marker is assayed by any procedure that can either determine the amount of the marker in the sample or that the amount of the marker is above a threshold indicating imminent delivery.
- Immunoassays are preferred.
- the antibody affinity required for detection of the analytes using a particular immunoassay method will not differ from that required to detect other polypeptide analytes.
- the antibody composition can be polyclonal or monoclonal.
- Anti-IGFBP-1 antibodies can be produced by a number of methods. Polyclonal antibodies can be induced by administering an immunogenic composition comprising human IGFBP-1 to a host animal.
- amniotic fluid or another source of high levels of IGFBP-1 can be used as the immunogen and antibodies of the desired specificity can be identified.
- IGFBP-1 may vary depending on the host animal and is well known.
- IGFBP-1 or an antigenic portion thereof can be conjugated to an immunogenic substance such as KLH or BSA or provided in an adjuvant or the like.
- the induced antibodies can be tested to determine whether the composition is IGFBP-1-specific. If a polyclonal antibody composition does not provide the desired specificity, the antibodies can be purified to enhance specificity by a variety of conventional methods.
- the composition can be purified to reduce binding to other substances by contacting the composition with IGFBP-1 affixed to a solid substrate. Those antibodies which bind to the substrate are retained. Purification techniques using antigens affixed to a variety of solid substrates such as affinity chromatography materials including Sephadex, Sepharose and the like are well known.
- Monoclonal IGFBP-1-specific antibodies can also be prepared by conventional methods.
- a mouse can be injected with an immunogenic composition comprising IGFBP-1, and spleen cells obtained. Those spleen cells can be fused with a fusion partner to prepare hybridomas.
- Antibodies secreted by the hybridomas can be screened to select a hybridoma wherein the antibodies react with IGFBP-1 and exhibit substantially no reaction with the other proteins which may be present in a sample.
- Hybridomas that produce antibodies of the desired specificity are cultured by standard techniques. Hybridoma preparation techniques and culture methods are well known and constitute no part of the present invention.
- immunoassays are well known using a variety of protocols and labels.
- the assay conditions and reagents may be any of a variety found in the prior art.
- the assay may be heterogeneous or homogeneous, conveniently a sandwich assay.
- the assay usually employs solid phase-affixed anti-IGFBP-1 antibodies.
- the antibodies may be polyclonal or monoclonal, preferably monoclonal.
- the solid phase-affixed antibodies are combined with the sample. Binding between the antibodies and sample can be determined in a number of ways. Complex formation can be determined by use of soluble antibodies specific for IGFBP-1.
- the antibodies can be labeled directly or can be detected using labeled second antibodies specific for the species of the soluble antibodies.
- Various labels include radionuclides, enzymes, fluorescers, colloidal metals or the like.
- the assay will be a quantitative enzyme-linked immunosorbent assay (ELISA) in which antibodies specific for IGFBP-1 are used as the solid phase-affixed and enzyme-labeled, soluble antibodies.
- the assay can be based on competitive inhibition, where IGFBP-1 in the sample competes with a known amount of IGFBP-1 for a predetermined amount of anti-IGFBP-1 antibody.
- any IGFBP-1 present in the sample can compete with a known amount of the labeled IGFBP-1 or IGFBP-1 analogue for antibody binding sites.
- the amount of labeled IGFBP-1 affixed to the solid phase or remaining in solution can be determined.
- IGFBP-1 levels below 20-50 ng/ml are considered background and are negative.
- the cut-off of choice for the background level depends upon whether a high sensitivity or high specificity test is desired. For example, as described in the examples, when 42 cervicovaginal secretion specimens which exhibited a positive fetal fibronectin test (> 50 ng/ml) for impending delivery and were ferning pooling and nitrazine negative for rupture of membranes were tested for IGFBP-1, one of these specimens demonstrated 42 ng/ml IGFBP-1. If a cut-off of 20 ng/ml were to be used, the demonstrated specificity of the test to rule out rupture would be 97%.
- the cutoff of 20-50 ng/ml was determined for the assay described in the examples.
- other assays using different reagents may have different cutoff values.
- IGFBP-1 antibodies which differ in their antigen binding characteristics may produce assay results with different optimal cut off values.
- background values may vary when different reagents are used and will understand how to determine the proper background level for the desired specificity and sensitivity for a selected assay.
- IGFBP-1 in a cervicovaginal secretion sample from a patient who is positive for a marker that indicates increased risk of delivery indicates that the membranes have ruptured. If IGFBP-1 is less than 20-50 ng/ml or undetectable (background for the assay) , the membranes remain intact. When IGFBP-1 is positive (> 20-50 ng/ml) and the delivery marker is negative, then amniotic membranes may have ruptured, although most patients who have ruptured membranes will exhibit both positive IGFBP-1 and the delivery marker simultaneously.
- the test can be administered to any pregnant woman who has tested positive for a marker that indicates increased risk of delivery.
- the delivery marker and IGFBP-1 are tested in the same cervicovaginal secretion sample.
- Such tests can be performed on any pregnant patient in the gestational age range for which the delivery marker is effective. Preferably, it is administered to all women with any known risk factor following 12 weeks gestation until delivery. If the delivery marker test is negative, the woman is not at risk for impending delivery. The test can be repeated throughout gestation at regular antenatal visits or more frequently if the patient is high risk. If the delivery marker test is positive (above the threshold value) , the patient is tested for presence of IGFBP-1 in her cervicovaginal secretions. If IGFBP-1 is present in the secretions, the patient has ruptured membranes. If IGFBP-1 is negative, the membranes are intact.
- the IGFBP-1 test can be repeated, preferably daily, until the sample is positive for IGFBP-1.
- a marker such as fibronectin which can be positive as much as weeks earlier than fetal fibronectin has been used, the marker which appears closest to delivery can be tested. If the delivery marker is positive and IGFBP-1 is not present in the sample, measures to determine or enhance fetal lung maturity can be undertaken. For example, an amniotic fluid sample can be analyzed for phospholipids. In general, patients at risk for preterm delivery are examined every two weeks from about 22 to 36 weeks, rather than every four weeks as for patients in a low risk category. All patients are examined weekly from about week 36.
- EXAMPLE 1 Quantitation of Fetal Fibronectin in a Vaginal Swab Sample An immunoassay to determine fetal fibronectin in a vaginal sample used the reagents and procedures described below.
- the hybridoma was cultured by growth in RPMI 1640 tissue culture medium supplemented with 10% fetal bovine serum. Additionally, the hybridoma was cultured in mice by the injection of the hybrid cells according to the procedure of Mishell and Shiigi (Selected Methods in Cellular Immunology. W.H. Freeman & Co, San Francisco p 368, 1980).
- the monoclonal antibody designated FDC-6 and produced by the hybridoma was prepared for use in an immunoassay by the following procedure.
- the IgG fraction of the culture supernatant or the ascites was precipitated by ammonium sulfate fractionation.
- the antibody was redissolved and dialyzed into the appropriate buffer for purification by affinity chromatography on Protein-G Fast Flow (Pharmacia Fine Chemicals) according to the manufacturer's directions.
- Microtiter plates were coated with FDC-6 monoclonal antibody by the procedure described below.
- Monoclonal antibody FDC-6 prepared as described above was diluted to 10 ⁇ g/ml in phosphate buffer, pH 7.2 and 100 ⁇ l/well was dispersed into a polystyrene microtiter plate (Costar) . The plates were incubated for 2 hours at room temperature or overnight at 4°C. The contents of the wells were aspirated and the wells washed 3 to 4 times with wash buffer (0.02 M Tris HC1, 0.15 M NaCl, 0.05% TWEEN-20) . 200 ⁇ l/well of blocking/stabilizing solution (4% sucrose, 1% mannitol, 0.5% casein,
- Human plasma fibronectin was purified from human plasma as described by Engvall and Ruoslahti, Int . J. Cancer 20:1-5 (1977).
- the anti-human plasma fibronectin antibodies were elicited in goats using the immunization techniques and schedules described in the literature, e.g., Stollar, Meth . Enzym . 70:70 (1980) , immunizing the goats with the human plasma fibronectin antigen.
- the antiserum was screened in a solid phase assay similar to that used for monoclonal antibodies, e.g., as described by Lange et al, Clin . E ⁇ p. Immunol . 25:191 (1976) and Pisetsky et al, J.
- the IgG fraction of the antiserum was purified further by affinity chromatography using CNBr-Sepharose 4B (Pharmacia Fine Chemicals) to which has been coupled human plasma fibronectin according to the method recommended by the manufacturer (AFFINITY CHROMATOGRAPHY, Pharmacia Fine Chemicals Catalogue 1990), pp 15-18.
- the column was equilibrated with from 2 to 3 volumes of buffer (0.01 M PBS, pH 7.2), and the anti-human fibronectin antibody-containing solution was then applied to the column. The absorbency of the effluent was monitored at 280 nm until protein no longer passed from the column. The column was then washed with equilibration buffer until a baseline absorbance at 280 nm was obtained. The immunoaffinity bound anti-human plasma fibronectin antibody was eluted with 0.1 M glycine buffer, pH 2.5. Peak protein fractions were collected, pooled and dialyzed against 0.01 M PBS, pH 7.2, for 24-36 hr at 4°C with multiple buffer changes.
- Anti-human plasma fibronectin antibody prepared as described above was conjugated with alkaline phosphatase following the one-step glutaraldehyde procedure of Avrameas, J-m-rau-noc ⁇ e- . 6:43 (1969).
- the assay was performed using the following additional reagents.
- the stock antibody conjugate was appropriately diluted in conjugate diluent (0.05 M Tris Buffer pH 7.2, 2% D-Sorbitol, 2% BSA, 0.1% Sodium Azide, 0.01% Tween-20, 1 mM Magnesium Chloride, and 0.1% Zinc Chloride) and 10 ml placed in a polyethylene dropper bottle container.
- conjugate diluent 0.05 M Tris Buffer pH 7.2, 2% D-Sorbitol, 2% BSA, 0.1% Sodium Azide, 0.01% Tween-20, 1 mM Magnesium Chloride, and 0.1% Zinc Chloride
- the enzyme substrate (10 ml in a polyethylene dropper bottle container) was phenolphthalein monophosphate (1 mg/ml) dissolved in 0.4 M a inomethylpropanediol buffer, pH 10 with 0.1 mM magnesium chloride and 0.2% sodium azide.
- the positive control (2.5 ml in a polyethylene dropper bottle container) was amniotic fluid containing fetal fibronectin diluted to a concentration of fetal fibronectin of 50 ng/ml in sample diluent solution (0.05 M Tris buffer pH 7.4, 1 % BSA, 0.15 M sodium chloride, 0.02% Sodium Azide, 5 mM ethylenediamine tetraacetic acid (EDTA) , l mM phenylmethylsulfonyl fluoride (PMSF) , and 500 Kallikrein Units/ml of Aprotinin) .
- sample diluent solution is described in U.S. Patent No. 4,919,889 to Jones et al, issued April 24, 1990, which patent is incorporated herein by reference in its entirety.
- the negative control (2.5 ml in a polyethylene dropper bottle container) was the sample diluent solution used for the positive control without fetal fibronectin.
- the rinse buffer (10 ml in a polyethylene dropper bottle container) was a 50X concentrate containing 1.0 M Tris buffer pH 7.4, 4.0 M sodium chloride, 2.5% Tween-20, and 1% sodium azide.
- the rinse buffer was diluted with water to a final concentration of 0.02 M Tris, 0.08 M sodium chloride, 0.05% Tween-20, and 0.02% sodium azide for use in the assay.
- 5 ⁇ pore size polyethylene sample filters (Porex Technologies, Fairburn, Georgia) were used to filter the samples prior to assay. All of the dropper bottles used to perform the assay were polyethylene bottles designed to dispense approximately 50 ⁇ l drops of the reagent. All of the assay steps performed following sample collection utilized the reagents and materials described above.
- the assay was performed as follows. All samples were collected in the vicinity of the posterior fornix or cervical os using dacron swabs. Swab samples were immersed in 1.0 ml of sample diluent in a collection vial. The swabs were removed from the solution leaving as such liquid as possible in the collection tube. The samples were incubated at 37°C along with the controls for 15 minutes prior to the assay, either before or after filtration. A sample filter was snapped in place on each sample tube. Duplicate 100 ⁇ l aliquots of each sample and the positive and negative controls were placed in separate wells of the microtiter plate and incubated for 1 hour at room temperature.
- the plates were gently agitated by hand or with an orbital shaker to mix the well contents.
- the frame of strips was placed in an ELISA plate reader.
- the absorbance of each well at 550 nm was determined.
- the average absorbance of the duplicate wells for each sample and control was calculated.
- the fetal fibronectin concentration for the samples was calculated by preparing a standard curve and estimating that the samples were diluted to about one-tenth of their original concentration (collection of about 0.1 ml of sample combined with 1.0 ml of diluent). For this study, a cutoff of approximately 50 ng/ml was used as a positive sample. Samples below 50 ng/ml were considered to be background and negative.
- the N-terminus of the protein was sequenced using a single paper disk punched out with a conventional paper hole puncher containing 100 picomoles protein amino acid by Edman degradation amino acid sequencer using an Applied Biosystems, Inc. Model 477A amino acid sequencer.
- the N-terminal sequence was determined to be APWQCAPCSAEKLALCPPVPASCSEVTRSA, (SEQ ID NO. 1) which identified the protein as IGFBP-1 using GenBank.
- the monoclonal antibody designated AF127 and produced by the hybridoma was prepared for use in an immunoassay by the following procedure.
- the IgG fraction of the culture supernatant or the ascites was purified using Avid Al affinity gel purification for immunoglobulins, according to the manufacturer ⁇ s directions (Bioprobe International, Inc. Tustin, CA) .
- Monoclonal antibody IGFBP-1 prepared as described above was diluted to 10 ⁇ g/ l in PBS (0.01 M phosphate buffer, 0.15 M NaCl, pH 7.4, 0.02% NaN 3 ) , and 100 ⁇ l/well was dispersed into a polystyrene microtiter plate (Costar) . The plates were incubated overnight at 4°C. The contents of the wells were aspirated and the wells washed once with wash buffer (0.02 M Tris HC1, pH 7.9, 0.15 M NaCl) .
- IGFBP-1 was purified from baboon amniotic fluid using gel electrophoresis followed by electroelution/electrotransfer.
- the anti-baboon IGFBP-1 antibodies were elicited in goats using the standard immunization techniques and schedules, by immunizing the goats with the baboon amniotic fluid (which contained IGFBP-1) .
- the antiserum was screened in a solid phase assay similar to that used for monoclonal antibodies, e.g., as described by Lange et al, Clin . Exp.
- the assay was performed using the following additional reagents.
- conjugate diluent 0.02 M Tris buffer, pH 7.9, 1% BSA, 0.1% sodium azide, 0.05% TWEEN-20
- the enzyme substrate was phenolphthalein monophosphate (1 mg/ml) dissolved in 0.4 M a inomethylpropanediol buffer, pH 10 with 0.1 mM MgCl 2 and 0.2% sodium azide.
- the positive control was human amniotic fluid diluted to a concentration of IGFBP-1 of 50 ng/ml in sample diluent solution (0.02 M Tris buffer, pH 7.9, 0.5 % BSA, 0.15 M sodium chloride, 0.02% sodium azide.
- sample diluent solution 0.02 M Tris buffer, pH 7.9, 0.5 % BSA, 0.15 M sodium chloride, 0.02% sodium azide.
- the negative control was the sample diluent solution used for the positive control without IGFBP-1.
- Cervicovaginal secretion samples were prepared as described in Example 1. Duplicate 100 ⁇ l aliquots of each sample or a dilution thereof, and the positive and negative controls were placed in separate wells of the microtiter plate and incubated for 2 hours at room temperature.
- the average absorbance of the duplicate wells for each sample and control was calculated.
- the IGFBP-1 concentration for the samples was calculated by preparing a standard curve using amniotic fluid with known concentrations of IGFBP-1.
- EXAMPLE 3 Study of a Panel of Patients A panel of cervical secretion specimens from second and third trimester patients was tested for fetal fibronectin as described in Example 1. The panel was tested for rupture of membranes using conventional ferning, pooling, and nitrazine. The same panel was then tested for IGFBP-1.
- IGFBP-1 was not detectable ( ⁇ 10 ng/ml) below 20 to 40 ng/ml in specimens that were negative for rupture of membranes by ferning, pooling, and nitrazine. Furthermore, IGFBP-1 was negative in specimens from women who were fetal fibronectin positive (> 50 ng/ml) , rupture of membranes negative (by ferning, pooling, and nitrazine) and either pre-term delivery positive or negative as determined by outcome (whether the patient delivered at or before 37 weeks gestation) . Most patients who were rupture of membranes positive by ferning, pooling, and nitrazine were also positive for IGFBP-1 (range 30 to > 5000 ng/ml) .
- the circulating levels of IGFBP-1 in maternal plasma were examined to determine if blood contamination of cervicovaginal secretions interfered with the test for IGFBP-1.
- the levels of IGFBP-1 in maternal plasma ranged from less than 10 ng/ml to
- EXAMPLE 4 Study of a Panel of Patients
- four groups of pregnant women were tested for fetal fibronectin and IGFBP-1 in cervical secretions.
- the groups were: (Group 1) those patients who were pre-term delivery positive (PTD+; delivery before 37 weeks) and fetal fibronectin positive (fFN+; > 50 ng/ml) but negative for rupture of membranes (ROM-) by ferning, pooling and nitrazine; (Group 2) those who were PTD- (delivery after 37 weeks) but who exhibited an fFN+ test (> 50 ng/ml) and were ROM- by ferning, pooling, and nitrazine; (Group 3) those who were PTD- (delivery after 37 weeks) and fFN- ( ⁇ 50 ng/ml) and ROM- by ferning, pooling, and nitrazine; and (Group 4) those that were rupture of membranes positive (ROM+) by ferning pooling and nitrazine testing regardless of
- IGFBP-l test 24 out of 30 specimens exhibited greater than 20 ng/ml IGFBP-l.
- the IGFBP-l test was 80% specific at diagnosing ROM.
- one of the six IGFBP-l negative patients also exhibited a negative fetal fibronectin test ( ⁇ 50 ng/ml) which should have been positive if amniotic fluid is present since fetal fibronectin present in amniotic fluid.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Pregnancy & Childbirth (AREA)
- Biotechnology (AREA)
- Cell Biology (AREA)
- Gynecology & Obstetrics (AREA)
- Microbiology (AREA)
- Reproductive Health (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US743293A | 1993-01-22 | 1993-01-22 | |
| US7432 | 1993-01-22 | ||
| PCT/US1994/000455 WO1994017405A1 (en) | 1993-01-22 | 1994-01-21 | Assay method to rule out rupture of membranes in women at risk for imminent delivery |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP0680607A1 true EP0680607A1 (de) | 1995-11-08 |
| EP0680607A4 EP0680607A4 (de) | 1997-06-04 |
Family
ID=21726119
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP94906621A Withdrawn EP0680607A4 (de) | 1993-01-22 | 1994-01-21 | Testverfahren zur ausschluss von membranrissen als risiko bei kurz vor der entbindung stehenden frauen. |
Country Status (4)
| Country | Link |
|---|---|
| EP (1) | EP0680607A4 (de) |
| JP (3) | JP3742649B2 (de) |
| CA (1) | CA2152676A1 (de) |
| WO (1) | WO1994017405A1 (de) |
Families Citing this family (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ283658A (en) * | 1994-04-04 | 1999-09-29 | William R Freeman | Compositions and treatment of increased intraocular pressure with phosphonyl-alkyloxy-pyrimidines/purines (nucleosides) |
| US5597700A (en) * | 1994-04-28 | 1997-01-28 | California Research, Llc | Method for detecting free insulin-like growth-factor-binding protein 1 and a test device for detecting the ruptures of fetal membranes using the above method |
| US6678669B2 (en) | 1996-02-09 | 2004-01-13 | Adeza Biomedical Corporation | Method for selecting medical and biochemical diagnostic tests using neural network-related applications |
| HUP0002459A3 (en) | 1997-05-30 | 2002-10-28 | Sankyo Co | Salts of optically active sulfoxide derivative, pharmaceutical compositions containing them and use thereof |
| RU2156469C1 (ru) * | 1999-04-02 | 2000-09-20 | Уральский НИИ охраны материнства и младенчества | Способ прогноза развития геморрагических осложнений в родах по данным системы гемостаза во второй половине беременности |
| ATE553378T1 (de) | 2003-02-06 | 2012-04-15 | Hologic Inc | Screening und behandlungsverfahren zur vorbeugung von frühgeburten |
| US20060024722A1 (en) | 2004-07-30 | 2006-02-02 | Mark Fischer-Colbrie | Samples for detection of oncofetal fibronectin and uses thereof |
| EP1937709A4 (de) * | 2005-09-15 | 2011-06-08 | Swiss Asian Property Ltd | Marker für vorzeitigen blasensprung (prom) |
| JP4952164B2 (ja) * | 2006-09-20 | 2012-06-13 | 株式会社デンソー | 流量計測素子、質量流量計 |
| CN103543273A (zh) * | 2013-11-04 | 2014-01-29 | 无锡博慧斯生物医药科技有限公司 | 一种孕妇早产胎儿纤维连接蛋白和磷酸化胰岛素样生长因子结合蛋白-1联检试剂盒 |
| US20190094215A1 (en) * | 2016-03-31 | 2019-03-28 | Sekisui Medical Co., Ltd. | Oncofetal fibronectin detection method using simple immunoassay |
| WO2023032925A1 (ja) * | 2021-08-30 | 2023-03-09 | 国立大学法人京都大学 | 検査方法及び検査試薬 |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA1337394C (en) * | 1987-11-17 | 1995-10-24 | Nelson N. H. Teng | Vaginal sample test and reagents |
| US5096830A (en) * | 1987-11-17 | 1992-03-17 | Adeza Biomedical Corporation | Preterm labor and membrane rupture test |
| FI86777C (fi) * | 1990-12-31 | 1992-10-12 | Medix Biochemica Ab Oy | Foerfarande foer diagnosticering av bristningen av fosterhinnorna samt reagensfoerpackning foer anvaendning daervid |
-
1994
- 1994-01-21 JP JP51709594A patent/JP3742649B2/ja not_active Expired - Fee Related
- 1994-01-21 CA CA 2152676 patent/CA2152676A1/en not_active Abandoned
- 1994-01-21 EP EP94906621A patent/EP0680607A4/de not_active Withdrawn
- 1994-01-21 WO PCT/US1994/000455 patent/WO1994017405A1/en not_active Ceased
-
2003
- 2003-12-10 JP JP2003412234A patent/JP2004125807A/ja not_active Withdrawn
-
2005
- 2005-06-15 JP JP2005175366A patent/JP3943575B2/ja not_active Expired - Fee Related
Non-Patent Citations (4)
| Title |
|---|
| BRITISH JOURNAL OF OBSTETRICS AND GYNAECOLOGY, vol. 100, no. 5, 1 May 1993, OXFORD UK, pages 472-475, XP000646845 H.S. WANG ET AL.: "Levels of insulin-like growth factor-I and insulin-like growth factor-binding protein-1 in pregnancy with preterm delivery" * |
| JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, vol. 59, no. 5, 1984, WASHINGTON DC USA, pages 899-907, XP000646852 S.L.S. DROP ET AL.: "Isolation of a somatomedin-binding protein from preterm amniotic fluid. " * |
| PLACENTA, vol. 11, no. 2, 1990, DALLAS TY USA, pages 123-133, XP000646849 M. FANT: "Insulin-like growth factor binding proteins (BP) from human placenta are immunologically related to the growth hormone dependent binding protein in adult human serum (BP-53)." * |
| See also references of WO9417405A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| JP3742649B2 (ja) | 2006-02-08 |
| WO1994017405A1 (en) | 1994-08-04 |
| EP0680607A4 (de) | 1997-06-04 |
| JP3943575B2 (ja) | 2007-07-11 |
| JP2004125807A (ja) | 2004-04-22 |
| CA2152676A1 (en) | 1994-08-04 |
| JP2005326427A (ja) | 2005-11-24 |
| JPH08506658A (ja) | 1996-07-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US5516702A (en) | Screening method for identifying women at increased risk for imminent delivery | |
| EP0642667B1 (de) | Screeningverfahren zur identifizierung von frauen mit erhöhtem frühgeburtsrisiko | |
| EP1936376B1 (de) | Screening und Behandlungsverfahren zur Vorbeugung von Frühgeburten | |
| US5281522A (en) | Reagents and kits for determination of fetal fibronectin in a vaginal sample | |
| US5096830A (en) | Preterm labor and membrane rupture test | |
| US7892774B2 (en) | Diagnostic method for determining the susceptibility to delivery and reagent kit for use therefor | |
| US5468619A (en) | Screening method for identifying women at increased risk for imminent delivery | |
| Klentzrics et al. | Placental protein 14 in cycles with normal and retarded endometrial differentiation | |
| JP3742649B2 (ja) | 切迫分娩についての危険にある女性における膜の破裂を決定するための検定方法 | |
| Seif et al. | A novel approach for monitoring the endometrial cycle and detecting ovulation | |
| EP1914553A1 (de) | Verfahren zur Erkennung von Frauen mit erhöhtem fötalem Wachstumshemmungsrisiko | |
| WO1993024836A1 (en) | Screening method for identifying women at increased risk for preterm delivery | |
| WO1993024838A1 (en) | Screening method for identifying women at increased risk for preterm delivery | |
| WO1999058974A1 (en) | Method and test device for assessing cervical ripeness at term with highly phosphorylated isoforms of igfbp-1 | |
| EP1756584A2 (de) | Angereicherte pag-55-fraktion und verfahren zur früherkennung der trächtigkeit bei huftieren | |
| AU620351B2 (en) | Vaginal sample test and reagents | |
| HK1119248B (en) | Screening and treatment methods for prevention of preterm delivery | |
| HK1119248A1 (en) | Screening and treatment methods for prevention of preterm delivery |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 19950811 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): DE ES FR GB IT |
|
| RHK1 | Main classification (correction) |
Ipc: G01N 33/53 |
|
| A4 | Supplementary search report drawn up and despatched |
Effective date: 19970416 |
|
| AK | Designated contracting states |
Kind code of ref document: A4 Designated state(s): DE ES FR GB IT |
|
| 17Q | First examination report despatched |
Effective date: 19991028 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20000308 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: WD Ref document number: 1014576 Country of ref document: HK |