EA046518B1 - DEVICE FOR COLLECTING THERMAL AND VIBRATION ENERGY OF THE ENVIRONMENT - Google Patents
DEVICE FOR COLLECTING THERMAL AND VIBRATION ENERGY OF THE ENVIRONMENT Download PDFInfo
- Publication number
- EA046518B1 EA046518B1 EA202293013 EA046518B1 EA 046518 B1 EA046518 B1 EA 046518B1 EA 202293013 EA202293013 EA 202293013 EA 046518 B1 EA046518 B1 EA 046518B1
- Authority
- EA
- Eurasian Patent Office
- Prior art keywords
- melarv
- cells
- isd
- pix
- env
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 claims description 56
- 108090000623 proteins and genes Proteins 0.000 claims description 50
- 210000004027 cell Anatomy 0.000 claims description 46
- 102000004169 proteins and genes Human genes 0.000 claims description 46
- 239000013598 vector Substances 0.000 claims description 41
- 201000011510 cancer Diseases 0.000 claims description 37
- 230000014509 gene expression Effects 0.000 claims description 31
- 229960005486 vaccine Drugs 0.000 claims description 28
- 241001135569 Human adenovirus 5 Species 0.000 claims description 26
- 241000699670 Mus sp. Species 0.000 claims description 26
- 241000700605 Viruses Species 0.000 claims description 26
- 238000002255 vaccination Methods 0.000 claims description 23
- 108010078428 env Gene Products Proteins 0.000 claims description 20
- 102100034353 Integrase Human genes 0.000 claims description 19
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 19
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 18
- 210000004881 tumor cell Anatomy 0.000 claims description 18
- 239000002245 particle Substances 0.000 claims description 16
- 241000701161 unidentified adenovirus Species 0.000 claims description 15
- 210000002966 serum Anatomy 0.000 claims description 12
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 230000008348 humoral response Effects 0.000 claims description 10
- 208000015181 infectious disease Diseases 0.000 claims description 10
- 238000002965 ELISA Methods 0.000 claims description 9
- 101710177291 Gag polyprotein Proteins 0.000 claims description 9
- 101710125418 Major capsid protein Proteins 0.000 claims description 9
- 206010027476 Metastases Diseases 0.000 claims description 9
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 8
- 102000004127 Cytokines Human genes 0.000 claims description 7
- 108090000695 Cytokines Proteins 0.000 claims description 7
- 101800001467 Envelope glycoprotein E2 Proteins 0.000 claims description 7
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 7
- 101800001271 Surface protein Proteins 0.000 claims description 7
- 230000005867 T cell response Effects 0.000 claims description 6
- 210000005220 cytoplasmic tail Anatomy 0.000 claims description 6
- 210000002865 immune cell Anatomy 0.000 claims description 6
- 210000003501 vero cell Anatomy 0.000 claims description 6
- 241000699666 Mus <mouse, genus> Species 0.000 claims description 5
- 238000000684 flow cytometry Methods 0.000 claims description 5
- 230000008685 targeting Effects 0.000 claims description 5
- 238000005829 trimerization reaction Methods 0.000 claims description 4
- 238000011740 C57BL/6 mouse Methods 0.000 claims description 3
- 238000004458 analytical method Methods 0.000 claims description 3
- 230000004048 modification Effects 0.000 claims description 3
- 238000012986 modification Methods 0.000 claims description 3
- 239000013612 plasmid Substances 0.000 claims description 3
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 claims description 2
- 101710154606 Hemagglutinin Proteins 0.000 claims description 2
- 241000134304 Influenza A virus H3N2 Species 0.000 claims description 2
- 108060001084 Luciferase Proteins 0.000 claims description 2
- 239000005089 Luciferase Substances 0.000 claims description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims description 2
- 101710176177 Protein A56 Proteins 0.000 claims description 2
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 claims description 2
- 239000000185 hemagglutinin Substances 0.000 claims description 2
- 230000010354 integration Effects 0.000 claims description 2
- 230000003287 optical effect Effects 0.000 claims description 2
- 230000000638 stimulation Effects 0.000 claims description 2
- 239000013642 negative control Substances 0.000 claims 7
- 238000001262 western blot Methods 0.000 claims 5
- 108700012920 TNF Proteins 0.000 claims 3
- 239000013592 cell lysate Substances 0.000 claims 3
- 238000010212 intracellular staining Methods 0.000 claims 3
- 210000004988 splenocyte Anatomy 0.000 claims 3
- 239000006228 supernatant Substances 0.000 claims 3
- 239000003795 chemical substances by application Substances 0.000 claims 2
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 claims 2
- 239000013641 positive control Substances 0.000 claims 2
- 210000000952 spleen Anatomy 0.000 claims 2
- 102100032912 CD44 antigen Human genes 0.000 claims 1
- 238000011238 DNA vaccination Methods 0.000 claims 1
- 238000011510 Elispot assay Methods 0.000 claims 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 claims 1
- 206010027458 Metastases to lung Diseases 0.000 claims 1
- 238000002835 absorbance Methods 0.000 claims 1
- 230000036436 anti-hiv Effects 0.000 claims 1
- 238000003556 assay Methods 0.000 claims 1
- 210000004369 blood Anatomy 0.000 claims 1
- 239000008280 blood Substances 0.000 claims 1
- 238000012512 characterization method Methods 0.000 claims 1
- 239000011248 coating agent Substances 0.000 claims 1
- 238000000576 coating method Methods 0.000 claims 1
- 239000012634 fragment Substances 0.000 claims 1
- 230000006872 improvement Effects 0.000 claims 1
- 230000028327 secretion Effects 0.000 claims 1
- 238000013207 serial dilution Methods 0.000 claims 1
- 230000035772 mutation Effects 0.000 description 37
- 241000192019 Human endogenous retrovirus K Species 0.000 description 32
- 230000001506 immunosuppresive effect Effects 0.000 description 31
- 235000018102 proteins Nutrition 0.000 description 31
- 239000000427 antigen Substances 0.000 description 28
- 108091007433 antigens Proteins 0.000 description 27
- 102000036639 antigens Human genes 0.000 description 27
- 235000001014 amino acid Nutrition 0.000 description 19
- 102100034349 Integrase Human genes 0.000 description 17
- 108020004707 nucleic acids Proteins 0.000 description 17
- 102000039446 nucleic acids Human genes 0.000 description 17
- 150000007523 nucleic acids Chemical class 0.000 description 17
- 230000003612 virological effect Effects 0.000 description 17
- 150000001413 amino acids Chemical class 0.000 description 16
- 101710091045 Envelope protein Proteins 0.000 description 15
- 101710188315 Protein X Proteins 0.000 description 15
- 108020004437 Endogenous Retroviruses Proteins 0.000 description 13
- 230000028993 immune response Effects 0.000 description 13
- 230000001177 retroviral effect Effects 0.000 description 13
- 108020004414 DNA Proteins 0.000 description 12
- 201000010099 disease Diseases 0.000 description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 12
- 238000011282 treatment Methods 0.000 description 12
- 241001430294 unidentified retrovirus Species 0.000 description 12
- 206010062016 Immunosuppression Diseases 0.000 description 11
- 210000000987 immune system Anatomy 0.000 description 11
- 230000002265 prevention Effects 0.000 description 11
- 230000000694 effects Effects 0.000 description 10
- 230000007246 mechanism Effects 0.000 description 10
- 238000000034 method Methods 0.000 description 10
- 230000002163 immunogen Effects 0.000 description 9
- 241000713887 Human endogenous retrovirus Species 0.000 description 8
- 241001529936 Murinae Species 0.000 description 8
- 241000714177 Murine leukemia virus Species 0.000 description 8
- 102100021696 Syncytin-1 Human genes 0.000 description 8
- 241000598171 Human adenovirus sp. Species 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 201000001441 melanoma Diseases 0.000 description 7
- 241000725303 Human immunodeficiency virus Species 0.000 description 6
- 230000004913 activation Effects 0.000 description 6
- 210000000612 antigen-presenting cell Anatomy 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 241000713800 Feline immunodeficiency virus Species 0.000 description 5
- 101000820777 Homo sapiens Syncytin-1 Proteins 0.000 description 5
- 241000005822 Human endogenous retrovirus W Species 0.000 description 5
- 102100021742 Syncytin-2 Human genes 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 206010006187 Breast cancer Diseases 0.000 description 4
- 206010025323 Lymphomas Diseases 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 description 4
- 208000036142 Viral infection Diseases 0.000 description 4
- 241000713893 Xenotropic murine leukemia virus Species 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 210000000170 cell membrane Anatomy 0.000 description 4
- 210000004443 dendritic cell Anatomy 0.000 description 4
- 238000009169 immunotherapy Methods 0.000 description 4
- 238000011065 in-situ storage Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000000822 natural killer cell Anatomy 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- 108091008875 B cell receptors Proteins 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 101000820789 Homo sapiens Syncytin-2 Proteins 0.000 description 3
- 241000578472 Human endogenous retrovirus H Species 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 206010038997 Retroviral infections Diseases 0.000 description 3
- 208000024313 Testicular Neoplasms Diseases 0.000 description 3
- 206010057644 Testis cancer Diseases 0.000 description 3
- 108010067390 Viral Proteins Proteins 0.000 description 3
- 230000033289 adaptive immune response Effects 0.000 description 3
- 210000005006 adaptive immune system Anatomy 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 3
- 244000309457 enveloped RNA virus Species 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 208000032839 leukemia Diseases 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 230000003211 malignant effect Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 210000003289 regulatory T cell Anatomy 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 108010037253 syncytin Proteins 0.000 description 3
- 201000003120 testicular cancer Diseases 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- RESSROXEVCGJLA-DFNTYYFDSA-N 99273-04-8 Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 RESSROXEVCGJLA-DFNTYYFDSA-N 0.000 description 2
- 108010034572 CKS 17 Proteins 0.000 description 2
- 108090000565 Capsid Proteins Proteins 0.000 description 2
- 102100023321 Ceruloplasmin Human genes 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- 241001217856 Chimpanzee adenovirus Species 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 102100038537 Endogenous retrovirus group K member 24 Pro protein Human genes 0.000 description 2
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- -1 HERVK113 Proteins 0.000 description 2
- 229940033330 HIV vaccine Drugs 0.000 description 2
- 101001064122 Homo sapiens Endogenous retrovirus group K member 18 Env polyprotein Proteins 0.000 description 2
- 101000956193 Homo sapiens Endogenous retrovirus group K member 18 Pro protein Proteins 0.000 description 2
- 101001064121 Homo sapiens Endogenous retrovirus group K member 24 Env polyprotein Proteins 0.000 description 2
- 101000893923 Homo sapiens Endogenous retrovirus group K member 24 Gag polyprotein Proteins 0.000 description 2
- 101000995911 Homo sapiens Endogenous retrovirus group K member 24 Np9 protein Proteins 0.000 description 2
- 101000956196 Homo sapiens Endogenous retrovirus group K member 24 Pro protein Proteins 0.000 description 2
- 101001064117 Homo sapiens Endogenous retrovirus group K member 6 Env polyprotein Proteins 0.000 description 2
- 101000886139 Homo sapiens Endogenous retrovirus group K member 6 Gag polyprotein Proteins 0.000 description 2
- 101000743323 Homo sapiens Endogenous retrovirus group K member 6 Pro protein Proteins 0.000 description 2
- 101000580925 Homo sapiens Endogenous retrovirus group K member 6 Rec protein Proteins 0.000 description 2
- 101001064115 Homo sapiens Endogenous retrovirus group K member 7 Env polyprotein Proteins 0.000 description 2
- 101000886212 Homo sapiens Endogenous retrovirus group K member 7 Gag polyprotein Proteins 0.000 description 2
- 101000634511 Homo sapiens Endogenous retrovirus group K member 7 Np9 protein Proteins 0.000 description 2
- 101000743328 Homo sapiens Endogenous retrovirus group K member 7 Pro protein Proteins 0.000 description 2
- 101001064116 Homo sapiens Endogenous retrovirus group K member 8 Env polyprotein Proteins 0.000 description 2
- 101000886211 Homo sapiens Endogenous retrovirus group K member 8 Gag polyprotein Proteins 0.000 description 2
- 101000743327 Homo sapiens Endogenous retrovirus group K member 8 Pro protein Proteins 0.000 description 2
- 101000710019 Homo sapiens Endogenous retrovirus group K member 8 Rec protein Proteins 0.000 description 2
- 101001066676 Homo sapiens Integrase Proteins 0.000 description 2
- 101001066686 Homo sapiens Integrase Proteins 0.000 description 2
- 101001066687 Homo sapiens Integrase Proteins 0.000 description 2
- 101001066690 Homo sapiens Ribonuclease H Proteins 0.000 description 2
- 241000701124 Human adenovirus 35 Species 0.000 description 2
- 102100034348 Integrase Human genes 0.000 description 2
- 102100034352 Integrase Human genes 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 102100034344 Ribonuclease H Human genes 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 101710091284 Syncytin-2 Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 108020005202 Viral DNA Proteins 0.000 description 2
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 2
- 108020000999 Viral RNA Proteins 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 210000000234 capsid Anatomy 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 230000037451 immune surveillance Effects 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 210000005007 innate immune system Anatomy 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 230000001566 pro-viral effect Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 238000011640 AKR mouse Methods 0.000 description 1
- 102100032532 C-type lectin domain family 10 member A Human genes 0.000 description 1
- 101100113692 Caenorhabditis elegans clk-2 gene Proteins 0.000 description 1
- 206010008874 Chronic Fatigue Syndrome Diseases 0.000 description 1
- 230000007067 DNA methylation Effects 0.000 description 1
- 102100038540 Endogenous retrovirus group K member 21 Pro protein Human genes 0.000 description 1
- 101100279830 Friend murine leukemia virus env gene Proteins 0.000 description 1
- 102000004961 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 241000963438 Gaussia <copepod> Species 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 101000942296 Homo sapiens C-type lectin domain family 10 member A Proteins 0.000 description 1
- 101001064123 Homo sapiens Endogenous retrovirus group K member 19 Env polyprotein Proteins 0.000 description 1
- 101000893974 Homo sapiens Endogenous retrovirus group K member 19 Gag polyprotein Proteins 0.000 description 1
- 101000956190 Homo sapiens Endogenous retrovirus group K member 19 Pro protein Proteins 0.000 description 1
- 101000580915 Homo sapiens Endogenous retrovirus group K member 19 Rec protein Proteins 0.000 description 1
- 101001064120 Homo sapiens Endogenous retrovirus group K member 21 Env polyprotein Proteins 0.000 description 1
- 101000893981 Homo sapiens Endogenous retrovirus group K member 21 Gag polyprotein Proteins 0.000 description 1
- 101000956191 Homo sapiens Endogenous retrovirus group K member 21 Pro protein Proteins 0.000 description 1
- 101000580918 Homo sapiens Endogenous retrovirus group K member 21 Rec protein Proteins 0.000 description 1
- 101001064113 Homo sapiens Endogenous retrovirus group K member 9 Env polyprotein Proteins 0.000 description 1
- 101000886210 Homo sapiens Endogenous retrovirus group K member 9 Gag polyprotein Proteins 0.000 description 1
- 101000743318 Homo sapiens Endogenous retrovirus group K member 9 Pro protein Proteins 0.000 description 1
- 101001099304 Homo sapiens Endogenous retrovirus group K member 9 Rec protein Proteins 0.000 description 1
- 101001066689 Homo sapiens Integrase Proteins 0.000 description 1
- 101000959820 Homo sapiens Interferon alpha-1/13 Proteins 0.000 description 1
- 101000738977 Homo sapiens Reverse transcriptase/ribonuclease H Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241001213909 Human endogenous retroviruses Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 229940125581 ImmunityBio COVID-19 vaccine Drugs 0.000 description 1
- 101900159346 Influenza A virus Hemagglutinin Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 102100040019 Interferon alpha-1/13 Human genes 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 206010061309 Neoplasm progression Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 229940124650 anti-cancer therapies Drugs 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000009613 breast lymphoma Diseases 0.000 description 1
- 230000000981 bystander Effects 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 241001233037 catfish Species 0.000 description 1
- 230000034303 cell budding Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000001447 compensatory effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 238000011577 humanized mouse model Methods 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 230000008975 immunomodulatory function Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 230000001678 irradiating effect Effects 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 1
- 230000004719 natural immunity Effects 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 231100000617 superantigen Toxicity 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 230000005751 tumor progression Effects 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 230000007923 virulence factor Effects 0.000 description 1
- 239000000304 virulence factor Substances 0.000 description 1
Description
046517046517
Область техникиTechnical field
Настоящее изобретение относится к вакцине для применения в профилактике и/или лечении заболевания. Следует отметить, что заболевание, то есть, такое как рак, может быть вызвано эндогенным ретровирусом. Вакцина согласно изобретению, в частности, относится к вирусам, способным образовывать вирусоподобные частицы в эукариотических клетках. В некоторых вариантах осуществления изобретения, вирусоподобные частицы, кодируемые вирусом (VE-VLP), продуцируются в организме пациента с развитием иммуногенного ответа на эндогенный ретровирус.The present invention relates to a vaccine for use in the prevention and/or treatment of a disease. It should be noted that a disease, such as cancer, can be caused by an endogenous retrovirus. The vaccine according to the invention, in particular, relates to viruses capable of forming virus-like particles in eukaryotic cells. In some embodiments, virus-encoded virus-like particles (VE-VLPs) are produced in the patient's body to develop an immunogenic response to the endogenous retrovirus.
Предпосылки к созданию изобретенияPrerequisites for creating an invention
Более ста лет назад наблюдения показали, что развитие рака тесно связано с иммунной системой, и в настоящее время хорошо известно, что иммунная система защищает организм от новых видов рака на регулярной основе. С другой стороны, злокачественные клетки действуют по механизму ускользания от иммунного надзора, что приводит к летальному исходу.More than a hundred years ago, observations showed that the development of cancer is closely related to the immune system, and it is now well known that the immune system protects the body from new cancers on a regular basis. On the other hand, malignant cells act by a mechanism of evasion from immune surveillance, which leads to death.
Хотя иммунные клетки способны обнаруживать и уничтожать опухолевые клетки, однако эта система не всегда функциональна, и это очевидно из того факта, что ежегодно во всем мире от рака умирает почти 9 млн человек. Вакцинация, направленная на индуцирование специфических иммунных ответов против опухолевых клеток, является относительно старым методом иммунотерапии рака, но все еще находится на стадии разработки, и только недавно она начала давать соответствующие результаты. Одна из стратегий вакцинации включает вакцинацию с использованием аттенюированных опухолевых клеток, например, путем облучения аутологичных опухолей или аллогенных опухолевых клеточных линий, часто секретирующих гранулоцитарный-макрофагальный колониестимулирующий фактор (GM-CSF). В обоих случаях инъецируемый материал включает раковые антигены, которые могут присутствовать в реальной опухоли. Другие стратегии вакцинации включают введение пептидов или белков для индуцирования специфических иммунных ответов. Эти антигены вводят непосредственно в комбинации с адъювантом или в виде антигенов, кодируемых плазмидными ДНК или вирусными векторами.Although immune cells are capable of detecting and destroying tumor cells, this system is not always functional, as is evident from the fact that almost 9 million people die from cancer every year worldwide. Vaccination, aimed at inducing specific immune responses against tumor cells, is a relatively old method of cancer immunotherapy, but is still in development and has only recently begun to show relevant results. One vaccination strategy involves vaccination using attenuated tumor cells, for example by irradiating autologous tumors or allogeneic tumor cell lines, often secreting granulocyte-macrophage colony-stimulating factor (GM-CSF). In both cases, the injected material includes cancer antigens that may be present in the actual tumor. Other vaccination strategies include administration of peptides or proteins to induce specific immune responses. These antigens are administered directly in combination with an adjuvant or as antigens encoded by plasmid DNA or viral vectors.
Хотя методы иммунотерапии постоянно совершенствуются, однако пока еще не существует вакцин широкого спектра действия и высокоэффективных вакцин. Главной причиной этого является описанная ранее иммуносупрессия опухолевыми клетками.Although immunotherapy methods are constantly being improved, there are still no broad-spectrum or highly effective vaccines. The main reason for this is the previously described immunosuppression by tumor cells.
Эндогенные ретровирусы (ERV) являются свидетельством того, что такими древними ретровирусными инфекциями страдали и наши далекие предки. При инфицировании, вирусная РНК подвергается обратной транскрипции в провирусную ДНК, которая была интегрирована в геном хозяина. В конечном счете, провирус был интегрирован в клетки зародышевой линии и стал наследуемым, в результате чего возникли эндогенные ретровирусы. За миллионы лет вирусная ДНК передавалась из поколения в поколение и сохранялась у всего населения. В настоящее время известно, что каждый геном человека приблизительно на 8% состоит из эндогенных ретровирусных ДНК, но эти ДНК являются просто останками бывшего ретровируса. Из-за мутаций, делеций и инсерций, большинство ретровирусных генов становились инактивированными или полностью исчезали из генома. В настоящее время, в организме человека больше не присутствует ни один функциональный, полноразмерный эндогенный ретровирус. Тем не мение, ERV прошли процессы дупликации, которые привели к интеграции нескольких копий в геноме хозяина с различными функциональными белками. Таким образом, в некоторых случаях, множество гомологичных ERV еще обладают способностью продуцировать вирусные частицы. Человеческий ERV типа K (HERV-K, HML2) является одним из совсем недавно обнаруженных ERV в геноме человека, и члены этого семейства сохраняют полноразмерные открытые рамки считывания почти для всех вирусных белков.Endogenous retroviruses (ERVs) provide evidence that our distant ancestors also suffered from such ancient retroviral infections. Upon infection, viral RNA is reverse transcribed into proviral DNA that has been integrated into the host genome. Ultimately, the provirus was integrated into germline cells and became heritable, resulting in the emergence of endogenous retroviruses. Over millions of years, viral DNA has been passed down from generation to generation and persisted throughout the population. It is now known that approximately 8% of each human genome consists of endogenous retroviral DNA, but this DNA is simply the remains of a former retrovirus. Due to mutations, deletions and insertions, most retroviral genes became inactivated or completely disappeared from the genome. Currently, no functional, full-length endogenous retrovirus is anymore present in the human body. However, ERVs have undergone duplication processes that have resulted in the integration of multiple copies in the host genome with different functional proteins. Thus, in some cases, multiple homologous ERVs still have the ability to produce viral particles. Human ERV type K (HERV-K, HML2) is one of the most recently discovered ERVs in the human genome, and members of this family retain full-length open reading frames for almost all viral proteins.
Различные исследования выявили взаимосвязь между экспрессией ERV и развитием и прогрессированием рака. Обнаружение ERV в человеческих опухолях открыли новые перспективы в разработке противораковой терапии с использованием новых стратегий вакцинации. Ярким примером человеческого ERV (HERV) является HERV типа K (HERV-K), который ассоциируется с раком предстательной железы, раком молочной железы, раком яичника, лимфомой, меланомой, лейкозом и саркомой. Другими примерами являются HERV-H, экспрессирующийся при раке прямой и ободочной кишки, и синцитин-1, экспрессирующийся при раке яичек, раке яичника, раке молочной железы, лимфоме и лейкозе.Various studies have revealed a relationship between ERV expression and cancer development and progression. The discovery of ERVs in human tumors has opened new perspectives in the development of anticancer therapies using new vaccination strategies. A prominent example of a human ERV (HERV) is HERV type K (HERV-K), which is associated with prostate cancer, breast cancer, ovarian cancer, lymphoma, melanoma, leukemia, and sarcoma. Other examples are HERV-H, expressed in colorectal cancer, and syncytin-1, expressed in testicular cancer, ovarian cancer, breast cancer, lymphoma and leukemia.
Не всегда легко определить, является ли экспрессия белков ERV причиной или следствием развивающейся опухоли. Тем не менее, известно, что условия внутри раковой клетки являются благоприятными для экспрессии ERV. Общее состояние гипометилирования в опухолевых клетках способствует активации генов ERV, которые обычно являются молчащими в здоровых клетках, благодаря метилированию ДНК (Downey, R.F., et al., Human endogenous retrovirus K and cancer: Innocent bystander or tumorigenic accomplice? Int. J. Cancer, 2015. 137(6): p. 1249-57. and Gimenez, J., et al., Custom human endogenous retroviruses dedicated microarray identifies self-induced HERV-W family elements reactivated in testicular cancer upon methylation control. Nucleic Acids Res, 2010. 38(7): p. 2229-46. Кроме того, экспрессию ERV могут стимулировать экзогенные факторы. Активация человеческих ERV наблюдается, например, при вирусных инфекциях. Экспрессия HERV-W была обнаружена после инфицирования вирусом гриппа и вирусом простого герпеса (Nellaker, С, et al., Transactivation of elements in the human endogenous retrovirus W family by viral infection. Retrovirology, 2006. 3: p. 44), a HERV-K наблюдался после инфицирования вируIt is not always easy to determine whether the expression of ERV proteins is a cause or a consequence of a developing tumor. However, conditions within a cancer cell are known to be favorable for ERV expression. The general hypomethylation state in tumor cells promotes the activation of ERV genes that are normally silent in healthy cells through DNA methylation (Downey, R.F., et al., Human endogenous retrovirus K and cancer: Innocent bystander or tumorigenic accomplice? Int. J. Cancer, 2015. 137(6): pp. 1249-57. and Gimenez, J., et al., Custom human endogenous retroviruses dedicated microarray identifies self-induced HERV-W family elements reactivated in testicular cancer upon methylation control. Nucleic Acids Res. 2010. 38(7): p. 2229-46. In addition, exogenous factors can stimulate ERV expression. Activation of human ERVs has been observed, for example, during viral infections. HERV-W expression has been detected after infection with influenza virus and herpes simplex virus (Nellaker , C, et al., Transactivation of elements in the human endogenous retrovirus W family by viral infection. Retrovirology, 2006. 3: p. 44), and HERV-K was observed after viral infection
- 1 046517 сом Эпштейна-Барра (Sutkowski, N., et al., Epstein-Barr virus transactivates the human endogenous retrovirus HERV-K18 that encodes a superantigen. Immunity, 2001. 15(4): p. 579-89). Независимо от механизма, приводящего к экспрессии ERV, раковые клетки поддерживают активацию этих белков посредством давления отбора, что указывает на благоприятный эффект ERV в опухолях (Leong, S.P., et al., Expression and modulation of a retrovirus-associated antigen by murine melanoma cells. Cancer Res, 1988. 48(17): p. 4954-8).- 1 046517 Epstein-Barr catfish (Sutkowski, N., et al., Epstein-Barr virus transactivates the human endogenous retrovirus HERV-K18 that encodes a superantigen. Immunity, 2001. 15(4): p. 579-89). Regardless of the mechanism leading to ERV expression, cancer cells maintain the activation of these proteins through selection pressure, indicating a beneficial effect of ERV in tumors (Leong, S.P., et al., Expression and modulation of a retrovirus-associated antigen by murine melanoma cells. Cancer Res, 1988. 48(17): p. 4954-8).
Однако не только человеческие опухоли ассоциируются с белками ERV, но также и мышиные раковые клетки экспрессируют ERV. Это обеспечивает идеальную модель организма для изучения влияния ERV на прогрессирование опухоли и для испытания методов терапии путем нацеливания на ERV. Одной из моделей ERV является ретровирус, ассоциированный с меланомой (MelARV), который происходит от провируса вируса мышиного лейкоза (MuLV), присутствующего в мышином геноме. Большинство инбредных мышиных линий содержат один или две неактивных копии MuLV (Li, M., et al., Sequence and insertion sites of murine melanoma-associated retrovirus. J Virol, 1999. 73(11): p. 9178-86). Тем не менее, мышиная линия AKR имеет три инсерции в геноме и характеризуется высокой продуктивностью MuLV в начале жизни, что вызывает частые случаи возникновения спонтанных лимфом. Другие мышиные линии, такие как C57BL/6, спонтанно продуцируют частицы MULV только в конце жизни. Некоторые другие модели мышиного рака также экспрессируют MULV/MelARV, по аналогии с человеческими ERV.However, not only do human tumors associate with ERV proteins, but also murine cancer cells express ERV. This provides an ideal model organism for studying the effect of ERV on tumor progression and for testing ERV-targeting therapies. One model of ERV is melanoma-associated retrovirus (MelARV), which is derived from the murine leukemia virus (MuLV) provirus present in the mouse genome. Most inbred mouse strains contain one or two inactive copies of MuLV (Li, M., et al., Sequence and insertion sites of murine melanoma-associated retrovirus. J Virol, 1999. 73(11): p. 9178-86). However, the AKR mouse line has three insertions in the genome and is characterized by high MuLV productivity early in life, which causes frequent cases of spontaneous lymphomas. Other mouse strains, such as C57BL/6, spontaneously produce MULV particles only late in life. Several other murine cancer models also express MULV/MelARV, similar to human ERVs.
Поскольку иммунная система вирусного хозяина является естественным механизмом защиты от инфекций, однако, многие вирусы, а особенно ретровирусы, действуют по механизму ускольнания от иммунного надзора. Одним из механизмов, которые можно наблюдать для всех различных вирусных семейств [Duch et al., WO2013/050048], является индуцирование иммуносупрессорного домена в белках оболочки (ENV), что вызывает подавление иммунной системы на различных уровнях. Иммунные клетки, включая природные киллеры (NK), CD8-Т-клетки или регуляторные Т-клетки (Treg), могут оказаться под воздействием вирусов, содержащих ISD [Schlecht-Louf et al. (2010)].Since the immune system of the viral host is a natural mechanism of defense against infections, however, many viruses, and especially retroviruses, act by the mechanism of evading immune surveillance. One mechanism that can be observed across all different viral families [Duch et al., WO2013/050048] is the induction of an immunosuppressive domain in envelope proteins (ENVs), which causes suppression of the immune system at various levels. Immune cells, including natural killer (NK) cells, CD8 T cells, or regulatory T cells (Tregs), may be affected by viruses containing ISD [Schlecht-Louf et al. (2010)].
Многие ERV содержат белки с иммуносупрессорными доменами (ISD), и такой домен, может также присутствовать в белке Env MelARV (Schlecht-Louf, G., et al., Retroviral infection in vivo requires an immune escape virulence factor encrypted in the envelope protein of oncoretroviruses. Proc Natl Acad Sci USA, 2010. 107(8): p. 3782-7, и Mangeney, M. and T. Heidmann, Tumor cells expressing a retroviral envelope escape immune rejection in vivo. Proc Natl Acad Sci USA, 1998. 95(25): p. 14920-5). Важное значение ISD в MuLV или MelARV было обнаружено благодаря введению белков Env вируса мышиного лейкоза в опухолевые клетки, которые обычно отторгаются иммунными клетками (Mangeney, M. and T. Heidmann, Tumor cells expressing a retroviral envelope escape immune rejection in vivo. Proc Natl Acad Sci USA, 1998. 95(25): p. 14920-5). Env-трансдуцированные опухолевые клетки растут быстрее, несмотря на присутствие дополнительного экзогенного антигена. Это наблюдение можно объяснить локальным иммуносупрессорным эффектом, опосредуемым белком Env. ISD влияет как на врожденную, так и на адаптивную иммунную систему, на что указывает ингибирование макрофагов, NK-клеток и Т-клеток (Lang, M.S., et al., Immunotherapy with monoclonal antibodies directed against the immunosuppressive domain of pl5E inhibits tumour growth. Clin Exp Immunol, 1995. 102(3): p. 468-75). Кроме того, влияние на субпополяцию регуляторных Т-клеток также позволяет предположить, что, они, в свою очередь, подавляют другие иммунные клетки (Mangeney, M., et al., Endogenous retrovirus expression is required for murine melanoma tumor growth in vivo. Cancer Res, 2005. 65(7): p. 2588-91). Механизм иммуносупрессии под действием ISD пока еще полностью не изучен, но вероятно, что такой эффект, в основном, опосредуется пептидом CKS-17 в ISD. CKS-17 оказывает различное влияние на иммунную систему, в основном, посредством модификации экспрессии цитокинов (Haraguchi, S., R.A. Good, and N.K. Day-Good, A potent immunosuppressive retroviral peptide: cytokine patterns and signaling pathways. Immunol Res, 2008. 41(1): p. 46-55.). Детальный механизм (Haraguchi, S., R.A. Good, and N.K. Day-Good, A potent immunosuppressive retroviral peptide: cytokine patterns and signaling pathways. Immunol Res, 2008. 41(1): p. 46-55).Many ERVs contain proteins with immunosuppressive domains (ISDs), and such a domain may also be present in the MelARV Env protein (Schlecht-Louf, G., et al., Retroviral infection in vivo requires an immune escape virulence factor encrypted in the envelope protein of oncoretroviruses. Proc Natl Acad Sci USA, 2010. 107(8): p. 3782-7, and Mangeney, M. and T. Heidmann, Tumor cells expressing a retroviral envelope escape immune rejection in vivo. Proc Natl Acad Sci USA, 1998 95(25): p.14920-5). The importance of ISD in MuLV or MelARV was discovered by introducing murine leukemia virus Env proteins into tumor cells that are normally rejected by immune cells (Mangeney, M. and T. Heidmann, Tumor cells expressing a retroviral envelope escape immune rejection in vivo. Proc Natl Acad Sci USA, 1998. 95(25): p. 14920-5). Env-transduced tumor cells grow faster despite the presence of additional exogenous antigen. This observation may be explained by a local immunosuppressive effect mediated by the Env protein. ISD affects both the innate and adaptive immune systems, as indicated by inhibition of macrophages, NK cells, and T cells (Lang, M.S., et al., Immunotherapy with monoclonal antibodies directed against the immunosuppressive domain of pl5E inhibits tumor growth. Clin Exp Immunol, 1995. 102(3): p. 468-75). In addition, the effect on a subpopulation of regulatory T cells also suggests that they, in turn, suppress other immune cells (Mangeney, M., et al., Endogenous retrovirus expression is required for murine melanoma tumor growth in vivo. Cancer Res, 2005. 65(7): pp. 2588-91). The mechanism of immunosuppression by ISD is not yet fully understood, but it is likely that such an effect is mainly mediated by the CKS-17 peptide in ISD. CKS-17 has various effects on the immune system, mainly through modifying cytokine expression (Haraguchi, S., R.A. Good, and N.K. Day-Good, A potent immunosuppressive retroviral peptide: cytokine patterns and signaling pathways. Immunol Res, 2008. 41 (1): pp. 46-55.). Detailed mechanism (Haraguchi, S., R.A. Good, and N.K. Day-Good, A potent immunosuppressive retroviral peptide: cytokine patterns and signaling pathways. Immunol Res, 2008. 41(1): p. 46-55).
Один из первых терапевтических методов нацеливания на ERV-экспрессирующие опухолевые клетки включает введение моноклональных антител. Таким образом, антитела, нацеленные на Env HERV-K, способны снижать рост опухолевых клеточных линий рака молочной железы. Wang-Johanning et al. показали, что наблюдаемый эффект моноклональных антител против Env HERV-K опосредуется изменением клеточного цикла раковых клеток и увеличением их апоптоза. Другой возможный эффект таких антител, который не был протестирован Wang-Johanning et al. (Wang-Johanning, F., et al., Immunotherapeutic potential of anti-human endogenous retrovirus-K envelope protein antibodies in targeting breast tumors. J Natl Cancer Inst, 2012. 104(3): p. 189-210), может представлять собой предотвращение иммуносупрессии. Белок Env HERV-K, подобно Env MelARV, содержит ISD и обладает иммуномодулирующими функциями (Morozov, V.A., V.L. Dao Thi, and J. Denner, The transmembrane protein of the human endogenous retrovirus-K (HERV-K) modulates cytokine release and gene expression. PLoS One, 2013. 8(8): p. e70399). Метод, протестированный Wang-Johanning et al., включает введение опухолевых ксенотрансплантатов иммунодефицитным бестимусным мышам. Таким образом, эффект HERV-K может быть направлен только на природные иммунные клетки, такие как NK-клетки.One of the first therapeutic methods to target ERV-expressing tumor cells involves the administration of monoclonal antibodies. Thus, antibodies targeting HERV-K Env are able to reduce the growth of breast cancer tumor cell lines. Wang-Johanning et al. showed that the observed effect of monoclonal antibodies against HERV-K Env is mediated by altering the cell cycle of cancer cells and increasing their apoptosis. Another possible effect of such antibodies, which was not tested by Wang-Johanning et al. (Wang-Johanning, F., et al., Immunotherapeutic potential of anti-human endogenous retrovirus-K envelope protein antibodies in targeting breast tumors. J Natl Cancer Inst, 2012. 104(3): p. 189-210), may represent the prevention of immunosuppression. The HERV-K Env protein, like MelARV Env, contains an ISD and has immunomodulatory functions (Morozov, V.A., V.L. Dao Thi, and J. Denner, The transmembrane protein of the human endogenous retrovirus-K (HERV-K) modulates cytokine release and gene expression. PLoS One, 2013. 8(8): p. e70399). The method tested by Wang-Johanning et al involves administering tumor xenografts to immunodeficient nude mice. Thus, the effect of HERV-K may only be directed at natural immune cells such as NK cells.
Другая часть адаптивного иммунного ответа, который может способствовать уничтожению опухолей посредством нацеливания на ERV, включает Т-клетки. Так, например, адоптивно перенесенные ТAnother part of the adaptive immune response that may contribute to tumor killing by targeting ERVs involves T cells. For example, adoptively transferred T
- 2 046517 клетки против эпитопа Env MuLV в комбинации с IL-2 способны уничтожать метастазы клеток меланомы в легких (Yang, J.C. and D. Perry-Lalley, The envelope protein of an endogenous murine retrovirus is a tumor-associated T-cell antigen for multiple murine tumors. J Immunother, 2000. 23(2): p. 177-83). Аналогичные эксперименты были проведены на гуманизованных мышиных моделях для HERV-K. T-клетки были генетически модифицированы так, чтобы они экспрессировали на своей поверхности химерный антигенный рецептор (CAR), который распознает Env HERV-K на раковых клетках. Цитотоксические САЕ.'-Тклетки были способны лизировать опухолевые клетки и предотвращать метастазы, а также рост опухоли.- 2 046517 cells against the MuLV Env epitope in combination with IL-2 are able to destroy metastases of melanoma cells in the lungs (Yang, J.C. and D. Perry-Lalley, The envelope protein of an endogenous murine retrovirus is a tumor-associated T-cell antigen for multiple murine tumors. J Immunother, 2000. 23(2): p. 177-83). Similar experiments were performed in humanized mouse models for HERV-K. The T cells have been genetically modified to express a chimeric antigen receptor (CAR) on their surface that recognizes HERV-K Env on cancer cells. Cytotoxic CAE'-T cells were able to lyse tumor cells and prevent metastasis as well as tumor growth.
В дополнение к прямой инъекции антител или Т-клеток, более практичной, дешевой и эффективной стратегией является индукция иммунных ответов путем вакцинации. Простой подход представляет собой вакцинацию антигенами, кодируемыми вирусом. Однако, этот метод является довольно трудоемким, поскольку сначала необходимо выделить ДК и провести культивирование клеток, а затем провести импульсную обработку определенным HLA-рестриктированным пептидом, и только затем снова ввести их мышам или пациентам.In addition to direct injection of antibodies or T cells, a more practical, cheaper and more effective strategy is to induce immune responses through vaccination. A simple approach is vaccination with antigens encoded by the virus. However, this method is quite labor-intensive because DCs must first be isolated and cultured, then pulsed with a specific HLA-restricted peptide before reintroducing them into mice or patients.
Более тонкая стратегия вакцинации представляет собой презентацию антигенов (например, белков вирусной оболочки) иммунной системе на вирусоподобных частицах (VLP), которые кодируются рекомбинантным аденовирусом (фиг. 1). Эти частицы не содержат вирусных нуклеиновых кислот, а поэтому являются неинфекционными. Тем не менее, VLP являются достаточно иммуногенными, и представленные белки были презентированы в естественных условиях. Так, например, вирусный белок Env, интегрированный в VLP, был презентирован на вирусоподобной поверхности, что способствует правильной укладке и конформации. Помимо преимущества, заключающегося в сильной иммуногенности, стратегия вакцинации VLP также имеет практическую выгоду. Таким образом, VLP могут быть относительно легко получены, поскольку их выделяют только из одного или нескольких белков, и такое продуцирование может быть осуществлено в клеточных культурах.A more subtle vaccination strategy involves the presentation of antigens (eg, viral envelope proteins) to the immune system on virus-like particles (VLPs) that are encoded by a recombinant adenovirus (Fig. 1). These particles do not contain viral nucleic acids and are therefore non-infectious. However, VLPs are quite immunogenic and the proteins shown have been presented in vivo. For example, the viral Env protein integrated into the VLP was presented on a virus-like surface to promote proper folding and conformation. In addition to the advantage of being highly immunogenic, the VLP vaccination strategy also has practical benefits. Thus, VLPs can be produced relatively easily since they are isolated from only one or a few proteins, and such production can be carried out in cell cultures.
Для вакцинации против вирусов или вирусного заболевания (например, ERV-экспрессирующего рака), весь белок Env в идеале должен быть представлен иммунной системе для гарантии иммунного ответа против полноразмерного белка-мишени. Однако, поскольку белок Env содержит ISD, то сама вакцина обладает иммуносупрессорной активностью, что нежелательно для иммунизации. Для решения этой проблемы, мутации были введены в ISD в целях сохранения природной конформации белкамишени, и в то же время предотвращения иммуносупрессии.For vaccination against viruses or a viral disease (eg, ERV-expressing cancer), the entire Env protein should ideally be presented to the immune system to ensure an immune response against the full-length target protein. However, since the Env protein contains ISD, the vaccine itself has immunosuppressive activity, which is undesirable for immunization. To address this problem, mutations have been introduced into the ISD in order to preserve the natural conformation of the target proteins while at the same time preventing immunosuppression.
Один из первых тестов на инактивирующие мутации в ISD вирусных белков был проведен SchlechtLouf et al. [Schlecht-Louf et al. (2010)]. Исходя из исследований по сравнению иммуносупрессорного синцитина-2 и неиммуносупрессорного синцитина-1 [Mangeney et al. (2007)], Schlecht-Louf et al. идентифицировали мутации, которые отключают активность ISD без нарушения общей структуры и функциональных свойств белка Env. Эта стратегия с введением мутации была применена к белкам другого вирусного происхождения (например, HTLV и XMRV), и было проведено более тщательное тестирование на вирус мышиного лейкоза Фрейнда (F-MLV). Это исследование не только выявило подавление обоих NK- и Т-клеток под действием ISD, но также показало, что живой аттенюированный вирус F-MLV, включающий мутантный ISD в белке Env, служит в качестве вакцины против того же самого вируса с последовательностью ISD дикого типа. Защита была обеспечена повышением уровня антител, а также Тклеточных ответов против эпитопов F-MLV. Это открытие было, наконец, опубликовано в заявке на патент WO 2011/092199, где особое внимание уделяется вирусу, который являются родственным ксенотропному вирусу мышиного лейкоза (XMRV), и который ассоциируется с раком предстательной железы человека и синдромом хронической усталости. Следовательно, WO 2011/092199 относится к специфическим мутациям ISD в XMRV и к применению таких вирусов с мутированным ISD для разработки стратегий вакцинации.One of the first tests for inactivating mutations in the ISD of viral proteins was performed by SchlechtLouf et al. [Schlecht-Louf et al. (2010)]. Based on studies comparing immunosuppressive syncytin-2 and non-immunosuppressive syncytin-1 [Mangeney et al. (2007)], Schlecht-Louf et al. identified mutations that disable ISD activity without disrupting the overall structure and functional properties of the Env protein. This mutation strategy has been applied to proteins of other viral origins (eg, HTLV and XMRV), and more extensive testing has been done for Freund's murine leukemia virus (F-MLV). This study not only revealed the suppression of both NK and T cells by ISD, but also showed that a live attenuated F-MLV virus, including a mutant ISD in the Env protein, serves as a vaccine against the same virus with a wild-type ISD sequence . Protection was provided by increased levels of antibodies as well as T-cell responses against F-MLV epitopes. This discovery was finally published in patent application WO 2011/092199, which focused on a virus that is related to xenotropic murine leukemia virus (XMRV) and which is associated with human prostate cancer and chronic fatigue syndrome. Therefore, WO 2011/092199 relates to specific ISD mutations in XMRV and the use of such mutated ISD viruses for the development of vaccination strategies.
Другое применение мутации ISD было описано в заявке на патент WO 2014/195510. В этом случае, мутация ISD была введена в кошачий вирус иммунодефицита (FIV) в целях снижения иммуносупрессии под действием вируса с сохранением природной конформации. В WO 2014/195510 описано, что специфические мутации приводят к повышению уровней гуморальных ответов против белка Env FIV при его введении в способе вакцинации в форме, связанной с МВР, или в форме, трансдуцированной в трансплантированные опухолевые клетки. Таким образом, WO 2014/195510 относится к мутациям в ISD Env FIV и к применению таких мутантных белков в стратегиях вакцинации против инфекции, вызываемой FIV или другими лентивирусами.Another application of the ISD mutation was described in patent application WO 2014/195510. In this case, the ISD mutation was introduced into the feline immunodeficiency virus (FIV) in order to reduce the immunosuppression caused by the virus while maintaining the natural conformation. WO 2014/195510 describes that specific mutations lead to increased levels of humoral responses against the FIV Env protein when administered in a vaccination method in an MBP-associated form or in a form transduced into transplanted tumor cells. Thus, WO 2014/195510 relates to mutations in the FIV Env ISD and the use of such mutant proteins in vaccination strategies against infection by FIV or other lentiviruses.
Другой подход, относящийся к более широкому спектру мутаций ISD в вирусном белке Env, описан в заявке на патент WO 2013/050048. В частности, WO 2013/050048 относится к получению антигенов сначала путем идентификации ISD в оболочечных РНК-вирусах, а затем мутации этих доменов для снижения иммуносупрессии в процессе вакцинации. Стратегия идентификации ISD основана на 4-х параметрах, которые заключаются в том, что: 1) пептид находится в гибридном белке оболочечных РНКвирусов, 2) пептид способен взаимодействовать с мембранами, 3) высокая степень гомологии в первичной структуре (последовательности) пептида наблюдается для отряда, семейства, подсемейства, рода или вида вирусов, 4) положение на поверхности гибридного белка в данной конформации является отличительным признаком иммуносупрессорных доменов, на что указывает 3D-структура или окрашиваниеAnother approach addressing a broader range of ISD mutations in the viral Env protein is described in patent application WO 2013/050048. In particular, WO 2013/050048 relates to the production of antigens by first identifying ISDs in enveloped RNA viruses and then mutating these domains to reduce immunosuppression during the vaccination process. The ISD identification strategy is based on 4 parameters, which are that: 1) the peptide is located in the hybrid protein of enveloped RNA viruses, 2) the peptide is able to interact with membranes, 3) a high degree of homology in the primary structure (sequence) of the peptide is observed for the order , family, subfamily, genus or species of viruses, 4) the position on the surface of the hybrid protein in a given conformation is a distinctive feature of the immunosuppressive domains, as indicated by the 3D structure or staining
- 3 046517 антителом. После идентификации потенциального ISD в представляющем интерес вирусном Env, была подтверждена иммуносупрессорная функция, а затем в ISD были введены мутации, и было подтверждено снижение иммуносупрессии по меньшей мере на 25%. В целом, в WO 2013/050048 описаны идентификация ISD в оболочечных РНК-вирусах, поколение пептидов с мутированным ISD, а также применение указанных пептидов в качестве вакцин и получение антител.- 3 046517 antibody. After identifying a potential ISD in the viral Env of interest, the immunosuppressive function was confirmed, and then mutations were introduced into the ISD and a reduction in immunosuppression of at least 25% was confirmed. In general, WO 2013/050048 describes the identification of ISDs in enveloped RNA viruses, the generation of peptides with mutated ISDs, and the use of these peptides as vaccines and the production of antibodies.
Важное значение презентации кодируемого антигена одновременно в аденовирусном векторе и на поверхности вирусного капсида было показано Bayer et al. [Bayer et al. (2010)]. Преимущество презентации антигенов в упорядоченной структуре, которая стимулирует перекрестное связывание В-клеточных рецепторов, было известно и ранее. Однако, описанное Bayer et al. кодирование различных белков FMLV, таких как субъединицы Gag и Env gp70 и р15Е, с одновременным представлением таких антигенов на аденовирусном капсидном белке PIX, показало, что только комбинация кодируемых и презентированных на капсиде антигенов способна повышать уровень функциональных антител. Это наблюдение можно объяснить тем, что несмотря на презентацию на аденовирусном капсиде, стимулирующую перекрестное связывание В-клеточных рецепторов, для достижения значимых CD4+-Т-клеточных ответов, стимулирующих аффинное созревание В-клеток, необходимы кодируемые антигены. С применением такой стратегии вакцинации Bayer et al. удалось снизить вирусную нагрузку F-MLV после заражения. Однако, не существует каких-либо данных, указывающих на повышение CD8+-Т-клеточных ответов против антигена-мишени.The importance of presentation of the encoded antigen simultaneously in the adenoviral vector and on the surface of the viral capsid was shown by Bayer et al. [Bayer et al. (2010)]. The advantage of presenting antigens in an ordered structure, which stimulates cross-linking of B cell receptors, has been previously known. However, as described by Bayer et al. encoding of various FMLV proteins, such as the Gag and Env subunits gp70 and p15E, with the simultaneous presentation of such antigens on the adenoviral capsid protein PIX, showed that only the combination of encoded and capsid-presented antigens is capable of increasing the level of functional antibodies. This observation may be explained by the fact that despite presentation on the adenoviral capsid to stimulate cross-linking of B cell receptors, encoded antigens are required to achieve significant CD4 + T cell responses that stimulate B cell affinity maturation. Using this vaccination strategy, Bayer et al. succeeded in reducing the F-MLV viral load after infection. However, there is no data indicating an increase in CD8 + T-cell responses against the target antigen.
Shoji et al. сосредоточили свое внимание в первую очередь на оптимизацию вакцины против ВИЧ на основе аденовирусов. Несмотря на стратегии оптимизации по кодонам и использование различных промоторов, было осуществено совместное кодирование белка Gag и Env в аденовирусе посредством расщепляемого сайта фурина (F2A). Это позволило осуществлять одновременную экспрессию обоих белков и, таким образом, получить in situ VLP на основе Gag. В этом исследовании были обнаружены самые высокие иммунные ответы по сравнению с другими стратегиями презентации, которые не стимулировали образование VLP in situ [Shoji et al., 2012].Shoji et al. focused primarily on optimizing an adenovirus-based HIV vaccine. Despite codon optimization strategies and the use of different promoters, co-coding of Gag and Env protein in adenovirus via the furin cleavage site (F2A) has been achieved. This allowed the simultaneous expression of both proteins and thus the in situ generation of Gag-based VLPs. This study found the highest immune responses compared to other presentation strategies that did not stimulate VLP formation in situ [Shoji et al., 2012].
Duch et al., 2011 (US20110305749A1) получили ретровирусные вакцины против ВИЧ на основе VLP и продемонстрировали повышение иммуногенности белков оболочки ВИЧ с мутированным ISD. Иммуногены VLP были получены и очищены ex vivo.Duch et al., 2011 (US20110305749A1) produced VLP-based retroviral HIV vaccines and demonstrated increased immunogenicity of HIV envelope proteins with mutated ISD. VLP immunogens were produced and purified ex vivo.
US 2012189647 относится к мутантному оболочечному белку, полученному в результате мутации иммуносупрессорного домена трансмембранной субъединицы белка оболочки дикого типа. US2009324553 относится к химерным политропным полипептидам вирусной оболочки, применяемым для нацеленного таргентинга и регулируемого слияния вирусных частиц с другими клеточными мембранами.US 2012189647 refers to a mutant envelope protein resulting from mutation of the immunosuppressive domain of the wild-type envelope protein transmembrane subunit. US2009324553 refers to chimeric polytropic viral envelope polypeptides used for targeted targeting and controlled fusion of viral particles with other cellular membranes.
Кроме того, в публикации Hohn et al. [Hohn et al., 2014] описано, что, при экспрессии оптимизированного по кодонам варианта HERV-K113 под контролем промотора CMV тип сборки вируса и его морфология были изменены. В частности, VLP сохранялся на клеточной поверхности и не содержал Env.In addition, Hohn et al. [Hohn et al., 2014] described that upon expression of the codon-optimized HERV-K113 variant under the control of the CMV promoter, the type of virus assembly and its morphology were changed. In particular, the VLP was retained on the cell surface and did not contain Env.
Несмотря на использование предыдущих стратегий мутации ISD в вирусных белках Env и использование аденовируса для кодирования и презентации вирусных антигенов, разработанные ранее стратегии вакцинации с использованием мутаций ISD были направлены исключительно на предотвращение вирусных инфекций [Schlecht-louf et al. 2010; WO 2011/092199; WO 2014/195510; US 20110305749; WO 2014/195510]. Следовательно, все еще существует необходимость в нарушении толерантности к собственным антигенам. Кроме того, система синтеза вирусоподобных частиц in situ была использована ранее [Luo et al. (2003); Sohji et al. (2011); Andersson et al. (2016); Andersson & Hoist (2016); Andersson et al. (2017)] для антигенов Env ВИЧ и малярийных антигенов, но не для презентации Env ERV с мутированным ISD на синтезированных VLP in situ. Кроме того, как было показано Hohn et al., существует также необходимость в разработке эффективной системы, позволяющей получать VLP, а в частности, VLP HERV-K.Despite the use of previous strategies for mutating ISD in viral Env proteins and using adenovirus to encode and present viral antigens, previously developed vaccination strategies using ISD mutations were aimed solely at preventing viral infections [Schlecht-louf et al. 2010; WO 2011/092199; WO 2014/195510; US 20110305749; WO 2014/195510]. Therefore, there is still a need to break tolerance to self-antigens. In addition, an in situ synthesis system for virus-like particles has been used previously [Luo et al. (2003); Sohji et al. (2011); Andersson et al. (2016); Andersson & Hoist (2016); Andersson et al. (2017)] for HIV Env and malaria antigens, but not for presentation of ERV Env with mutated ISD on in situ synthesized VLPs. In addition, as shown by Hohn et al., there is also a need to develop an efficient system that allows the production of VLPs, and in particular, HERV-K VLPs.
Целью настоящего изобретения является получение эффективной вакцины для профилактики и/или лечения заболевания, вызываемого эндогенным ретровирусом. Вакцина согласно изобретению дает повышенный иммунный ответ посредством любого из путей вырабатывания ответа, инициированных CD4T-клетками или CD8-Т-клетками.The purpose of the present invention is to obtain an effective vaccine for the prevention and/or treatment of a disease caused by an endogenous retrovirus. The vaccine of the invention produces an enhanced immune response through either the CD4T cell or CD8 T cell-initiated response pathway.
Сущность изобретенияThe essence of the invention
Настоящее изобретение относится к вакцине для применения в профилактике и/или лечении заболевания, где указанная вакцина включает аденовирусный вектор, способный кодировать вирусоподобные частицы (VLP), где указанные VLP презентируют неактивный иммуносупрессорный домен (ISD).The present invention relates to a vaccine for use in the prevention and/or treatment of a disease, wherein said vaccine comprises an adenoviral vector capable of encoding virus-like particles (VLPs), wherein said VLPs present an inactive immunosuppressive domain (ISD).
Для разработки вакцин для продуцирования VLP используется ряд вирусных векторов, включая ВИЧ, бакуловирусы, лентивирусы и аденовирусы. Авторами настоящего изобретения было показано, что аденовирусный вектор, кодирующий ERV с инактивированным ISD, неожиданно оказался более эффективным, чем, например, ВИЧ-вектор в комбинации с инактивированным ISD. Таким образом, настоящее изобретение позволяет достичь неожиданно высокого иммунного ответа, приводящего к стимуляции иммуносупрессии в опухолях.A number of viral vectors have been used to develop vaccines to produce VLPs, including HIV, baculoviruses, lentiviruses, and adenoviruses. The present inventors have shown that an adenoviral vector encoding an ERV with an inactivated ISD is surprisingly more effective than, for example, an HIV vector in combination with an inactivated ISD. Thus, the present invention makes it possible to achieve an unexpectedly high immune response leading to stimulation of immunosuppression in tumors.
Хотя предполагается, что в настоящем изобретении для получения удовлетворительного результатаAlthough it is contemplated that in the present invention, to obtain a satisfactory result
- 4 046517 могут быть использованы любые аденовирусные векторы, однако, в настоящее время существует мнение, что наилучший результат может быть достигнут в том случае, если аденовирусный вектор происходит от аденовирусов млекопитающих, а именно, аденовируса человека, аденовируса шимпанзе или аденовируса гориллы. Человеческие аденовирусные векторы имеют по меньшей мере 52 различных серотипа, например, типа 1, 2, 5, 19, 28, 35 и 40. В случае выбора человеческого аденовируса, человеческим аденовирусным вектором является вектор, происходящий от векторов группы D, человеческого аденовируса серотипа Ad5, человеческого аденовируса серотипа Ad19а, человеческого аденовируса серотипа Ad26 или аденовируса шимпанзе. Авторы настоящего изобретения использовали аденовирус типа 5 (Ad5) в качестве исходного материала для получения вакцинного вектора благодаря хорошим доклиническим результатам иммунизации. Причиной, по которой Ad5 индуцирует достаточно сильные иммунные ответы против белка-мишени, является не только эффективный транспорт в антигенпрезентирующие клетки (АПК), но также и адъювантное свойство самого вектора, которое стимулирует природный иммунитет. Кроме того, были индуцированы транскрипция и высвобождение иммуностимулирующих цитокинов, таких как IFN, IL-6, IL-12, IL-15 и TNF-α. Эти цитокины играют важную роль в иммунной системе и служат в качестве активаторов для клеток адаптивного иммунного ответа. Особым преимуществом Ad5 является то, что иммунные ответы против вектора являются не очень сильными, так как в противном случае это могло бы препятствовать экспрессии трансгена. Ad5 уравновешивает врожденный иммунитет до уровня, который позволяет экспрессировать трансгены и в то же время активировать адаптивные иммунные ответы. Что касается публикации Matthew J. Johnson et al. (J. Immunol 2012; 188: 6109-6118), где показано, что рекомбинантный аденовирус серотипа 28 и рекомбинантный аденовирус серотипа 35 инфицирует и приводит к in vitro созреванию и активации человеческих и мышиных дендритных клеток более эффективно по сравнению с рекомбинантным аденовирусом серотипа 5, то было неожиданно обнаружено, что Ad5 дает желаемый ответ в описанных здесь экспериментах. Кроме того, в другой работе Matthew J. Johnson et al. (Vaccine 32 (2014) 717-724) показано, что рекомбинантный аденовирус серотипа 28 и рекомбинантный аденовирус серотипа 35 повышают апоптоз антигенпрезентирующих клеток (АПК), таких как моноциты, по сравнению с rAd5 и ложноинфицированным контролем.- 4 046517 any adenoviral vectors can be used, however, it is currently believed that the best result can be achieved if the adenoviral vector is derived from mammalian adenoviruses, namely human adenovirus, chimpanzee adenovirus or gorilla adenovirus. Human adenovirus vectors have at least 52 different serotypes, for example, types 1, 2, 5, 19, 28, 35 and 40. In the case of selecting a human adenovirus, a human adenovirus vector is a vector derived from group D vectors, human adenovirus serotype Ad5 , human adenovirus serotype Ad19a, human adenovirus serotype Ad26 or chimpanzee adenovirus. The inventors of the present invention used adenovirus type 5 (Ad5) as a starting material to produce a vaccine vector due to good preclinical immunization results. The reason why Ad5 induces quite strong immune responses against the target protein is not only its efficient transport into antigen presenting cells (APCs), but also the adjuvant property of the vector itself, which stimulates natural immunity. In addition, the transcription and release of immunostimulatory cytokines such as IFN, IL-6, IL-12, IL-15 and TNF-α were induced. These cytokines play an important role in the immune system and serve as activators of adaptive immune response cells. A particular advantage of Ad5 is that immune responses against the vector are not very strong, as this would otherwise prevent transgene expression. Ad5 balances innate immunity to a level that allows transgene expression and at the same time activates adaptive immune responses. Regarding the publication of Matthew J. Johnson et al. (J. Immunol 2012; 188: 6109-6118), where recombinant adenovirus serotype 28 and recombinant adenovirus serotype 35 were shown to infect and lead to in vitro maturation and activation of human and murine dendritic cells more efficiently compared to recombinant adenovirus serotype 5, it was unexpectedly found that Ad5 gives the desired response in the experiments described here. Additionally, in another work, Matthew J. Johnson et al. (Vaccine 32 (2014) 717-724) showed that recombinant adenovirus serotype 28 and recombinant adenovirus serotype 35 increased apoptosis of antigen-presenting cells (APCs), such as monocytes, compared to rAd5 and mock-infected controls.
Иммуносупрессорный домен (ISD) можно рассматривать в качестве механизма для опухолей, позволяющего сбалансировать противоопухолевые иммунные ответы при одновременном сохранении опухоль-стимулирующей воспалительной среды, индуцированной активацией ERV, аналогично природной инфекции. ISD влияет на врожденную и адаптивную иммунную систему за счет ингибирования макрофагов, NK-клеток и Т-клеток. Однако точный механизм иммуносупрессии под действием ISD пока еще полностью не изучен. Как показано в настоящем изобретении, инактивация ISD приводит к значительному повышению ответа.The immunosuppressive domain (ISD) can be considered as a mechanism for tumors to balance antitumor immune responses while maintaining a tumor-promoting inflammatory environment induced by ERV activation, similar to natural infection. ISD affects the innate and adaptive immune system by inhibiting macrophages, NK cells, and T cells. However, the exact mechanism of immunosuppression by ISD is not yet fully understood. As shown in the present invention, inactivation of ISD leads to a significant increase in response.
Сегмент ISD может быть инактивирован путем мутации или делеции одной или более аминокислот. В случае проведения инактивации посредством мутации, одну или более аминокислот заменяют другой аминокислотой, обычно, выбранной из других 19 природных аминокислот. В случае делеции, любая одна или более аминокислот в области ISD могут быть делетированы. Специалист в данной области обладает достаточными знаними или опытом по замене аминокислот для достижения удовлетворительного иммунного ответа посредством проведения, но необязательно, оценки результатов начальных испытаний.The ISD segment can be inactivated by mutation or deletion of one or more amino acids. In the case of inactivation by mutation, one or more amino acids are replaced by another amino acid, usually selected from the other 19 naturally occurring amino acids. In the case of a deletion, any one or more amino acids in the ISD region may be deleted. One skilled in the art will have sufficient knowledge or experience in amino acid substitution to achieve a satisfactory immune response by, but not necessarily evaluating, the results of initial trials.
В определенном варианте осуществления изобретения, ISD имеет пептидную последовательность LANQINDLRQTVIW (SEQ ID NO: 1), LASQINDLRQTVIW (SEQ ID NO: 2), LQNRRGLDLLTAEKGGL (SEQ ID NO: 3), LQNRRALDLLTAERGGT (SEQ ID NO: 4), LQNRRGLDMLTAAQGGI (SEQ ID NO: 5) или YQNRLALDYLLAAEGGV (SEQ ID NO: 6), имеющие делеции или замены по меньшей мере одной из аминокислот другой аминокислотой. Предпочтительно, чтобы аминокислота, отличающаяся от исходной аминокислоты, была выбрана из природных аминокислот. Сегмент ISD ERV, кодируемый в Ad5 и используемый в примерах настоящей заявки, имеет следующую аминокислотную последовательность: LQNRRGLDLLFLKEGGL (SEQ ID No: 7). ISD может быть инактивирован путем введения одной или более мутаций в аминокислотную последовательность. Специалист в данной области может модифицировать аминокислотную последовательность путем мутаций или делеции в любом количестве или в любой форме, подходящей для замены отдельных аминокислот, то есть ISD, предпочтительно используемый в настоящем изобретении, имеет следующую последовательность: LQNRRGLDLLFLKRGGL (SEQ ID NO: 8).In a certain embodiment of the invention, the ISD has the peptide sequence LANQINDLRQTVIW (SEQ ID NO: 1), LASQINDLRQTVIW (SEQ ID NO: 2), LQNRRGLDLLTAEKGGL (SEQ ID NO: 3), LQNRRALDLLTAERGGT (SEQ ID NO: 4), LQNRRGLDMLTAAQGGI (SEQ ID NO: 5) or YQNRLALDYLLAAEGGV (SEQ ID NO: 6) having deletions or substitutions of at least one of the amino acids with another amino acid. Preferably, the amino acid different from the parent amino acid is selected from naturally occurring amino acids. The ERV ISD segment encoded in Ad5 and used in the examples of this application has the following amino acid sequence: LQNRRGLDLLFLKEGGL (SEQ ID No: 7). ISD can be inactivated by introducing one or more mutations in the amino acid sequence. One skilled in the art can modify the amino acid sequence by mutation or deletion in any amount or form suitable for replacing individual amino acids, that is, the ISD preferably used in the present invention has the following sequence: LQNRRGLDLLFLKRGGL (SEQ ID NO: 8).
Может оказаться предпочтительной замена одной или более аминокислот в области, расположенной выше или ниже сегмента ISD. Мутацией является компенсирующая мутация, введенная для сохранения структуры домена, так, чтобы она могла действовать еще и для инфекционного вируса. Таким образом, в определенном варианте осуществления изобретения по меньшей мере одна из аминокислот в области из 10 аминокислот, расположенной выше или ниже ISD, была заменена другой аминокислотой. В конкретном варианте, представленном на фиг. 3, 3-я аминокислота, фланкирующая область ISD, была заменена путем мутации А ^ F.It may be preferable to replace one or more amino acids in the region located upstream or downstream of the ISD segment. A mutation is a compensatory mutation introduced to preserve the structure of a domain so that it can also work for an infectious virus. Thus, in a certain embodiment of the invention, at least one of the amino acids in the 10 amino acid region located upstream or downstream of the ISD has been replaced by another amino acid. In the specific embodiment shown in FIG. 3, The 3rd amino acid flanking the ISD region was replaced by an A^F mutation.
- 5 046517- 5 046517
Для инактивации ISD согласно изобретению, необходимо, чтобы иммуносупрессорная активность снижалась на 70% или более по сравнению с иммуносупрессорной активностью, достигаемой под действием исходного ISD. В предпочтительном варианте осуществления изобретения, ISD инактивируется на 80% или более, например, на 90% или более, например, на 95% или более, например на 99% или более по сравнению с иммуносупрессией, достигаемой под действием исходного ISD.To inactivate an ISD according to the invention, the immunosuppressive activity must be reduced by 70% or more compared to the immunosuppressive activity achieved by the original ISD. In a preferred embodiment of the invention, the ISD is inactivated by 80% or more, eg 90% or more, eg 95% or more, eg 99% or more, of the immunosuppression achieved by the original ISD.
Настоящее изобретение относится к общей платформе для презентации антигенов иммунной системе организма. Таким образом, в принципе, при кодировании белка любого типа желательно, чтобы он был включен в аденовирусный вектор для вырабатывания иммунного ответа против этого вируса. В предпочтительном аспекте изобретения антиген представляет собой эндогенные белки ретровирусной оболочки (Env ERV) или иммуногенные белки, происходящие от таких белков. Обычно считается, что вакцина на основе вирусоподобных частиц, кодируемых вирусом, направляет Env ERV в дендритные клетки (ДК) для презентации антигенов клеткам адаптивной иммунной системы. Презентация на МНС класса I индуцирует активацию и пролиферацию CD8+-Т-клеток. Эти цитотоксические Т-лимфоциты (ЦТЛ), специфичные к антигенам Env ERV, инфильтрируются в опухоли и уничтожают клетки, презентирующие соответствующий антиген. Презентация антигенов на МНС класса II специальными антигенпрезентирующими клетками (АПК) активирует CD4+-Т-клеткu, которые ко-активируют В-клетки. Активированные В-клетки, которые взаимодействуют с белком-мишенью Env ERV в кровотоке, или антигены, презентированные на VLP, высвобождают антитела, специфичные к Env ERV. Эти антитела способны связываться со своей мишенью на раковых клетках, что будет приводить к разрушению и фагоцитозу злокачественных клеток. Таким образом, ERV-специфические антитела способны предотвращать рост опухоли и метастазы. Восстановленная иммуногенность опухолевых клеток позволяет примировать серию различных опухолеспецифических Т-клеток, распознающих различные опухолеассоциированные и опухоль-специфические антигены. Эти только что примированные и размноженные ЦТЛ проникают в опухоль и уничтожают злокачественные клетки.The present invention relates to a general platform for presenting antigens to the body's immune system. Thus, in principle, when encoding a protein of any type, it is desirable that it be included in an adenoviral vector to generate an immune response against that virus. In a preferred aspect of the invention, the antigen is endogenous retroviral envelope proteins (ERV Env) or immunogenic proteins derived from such proteins. A vaccine based on virus-encoded virus-like particles is generally thought to target ERV Env to dendritic cells (DCs) for presentation of antigens to cells of the adaptive immune system. Presentation on MHC class I induces activation and proliferation of CD8 + T cells. These cytotoxic T lymphocytes (CTLs), specific for ERV Env antigens, infiltrate into tumors and kill cells presenting the corresponding antigen. The presentation of antigens to MHC class II by dedicated antigen presenting cells (APCs) activates CD4 + T cells, which co-activate B cells. Activated B cells that interact with the ERV Env target protein in the bloodstream or antigens presented on the VLP release antibodies specific to ERV Env. These antibodies are able to bind to their target on cancer cells, which will lead to the destruction and phagocytosis of malignant cells. Thus, ERV-specific antibodies are able to prevent tumor growth and metastasis. The restored immunogenicity of tumor cells allows the priming of a series of different tumor-specific T cells that recognize various tumor-associated and tumor-specific antigens. These newly primed and expanded CTLs enter the tumor and destroy malignant cells.
Хотя вакцина согласно изобретению, в принципе, может быть использована для иммунизации млекопитающих ряда видов, а реально была разработана с использованием мышей-моделей, однако, в предпочтительном аспекте изобретения, белок ERV представляет собой человеческий эндогенный ретровирусный белок (HERV) или его иммуногенную часть. Было определено, что каждый человеческий геном приблизительно на 8% состоит из эндогенных ретровирусных ДНК. Тем не менее, большая часть эндогенных ретровирусных ДНК являются лишь останками бывшего ретровируса. ERV являются свидетельством того, что такими древними ретровирусными инфекциями страдали и наши далекие предки. При инфицировании, вирусная РНК подвергается обратной транскрипции в провирусную ДНК, которая была интегрирована в геном хозяина. В конечном счете провирус был интегрирован в клетки зародышевой линии и стал наследуемым, в результате чего возникли эндогенные ретровирусы. За миллионы лет, вирусная ДНК передавалась последующим поколениям и сохранялась у всего населения. Из этого следует, что большая часть человеческого генома может быть использована в качестве антиген-кодирую щей части аденовирусного вектора. В настоящее время HERV предпочтительно выбирают из группы, состоящей из HERV-K, HERV-H, HERV-W, HERV-FRD, и HERV-E. Более конкретно, HERV-K может быть выбран из группы, состоящей из HERV-K108 (=ERVK-6), ERVK-19, HERV-K115 (=ERVK-8), ERVK-9, HERVK113, ERVK-21, ERVK-25, HERV-K102 (=ERVK-7), HERV-K101 (=ERVK-24), HERV-K110 (=ERVK-18); HERV-H может быть выбран из группы, состоящей из HERV-HI9 (=HERV-H_2q24.3), HERV-H_2q24.1; HERV-W может быть выбран в качестве ERVW-1 (=синцитина-1); a HERV-FRD может быть выбран в качестве ERVFRD-1 (=синцитина-2).Although the vaccine of the invention can, in principle, be used to immunize mammals of a number of species, and has actually been developed using mouse models, in a preferred aspect of the invention, the ERV protein is a human endogenous retroviral protein (HERV) or an immunogenic portion thereof. It has been determined that each human genome consists of approximately 8% endogenous retroviral DNA. However, most endogenous retroviral DNA is only the remains of a former retrovirus. ERVs are evidence that our distant ancestors also suffered from such ancient retroviral infections. Upon infection, viral RNA is reverse transcribed into proviral DNA that has been integrated into the host genome. Ultimately, the provirus was integrated into germline cells and became heritable, resulting in the emergence of endogenous retroviruses. Over millions of years, viral DNA was passed on to subsequent generations and persisted throughout the population. It follows that most of the human genome can be used as the antigen-coding part of the adenoviral vector. Currently, the HERV is preferably selected from the group consisting of HERV-K, HERV-H, HERV-W, HERV-FRD, and HERV-E. More specifically, HERV-K may be selected from the group consisting of HERV-K108 (=ERVK-6), ERVK-19, HERV-K115 (=ERVK-8), ERVK-9, HERVK113, ERVK-21, ERVK- 25, HERV-K102 (=ERVK-7), HERV-K101 (=ERVK-24), HERV-K110 (=ERVK-18); HERV-H may be selected from the group consisting of HERV-HI9 (=HERV-H_2q24.3), HERV-H_2q24.1; HERV-W can be selected as ERVW-1 (=syncytin-1); a HERV-FRD can be selected as ERVFRD-1 (=syncytin-2).
Аденовирусный вектор был сконструирован так, чтобы кодируемый белок ERV мог быть презентирован иммунной системе с вырабатыванием подходящего иммунологического ответа. В подходящем аспекте изобретения, эпитоп белка ERV или его иммуногенная часть расположены между трансмембранным доменом и ISD.The adenoviral vector was designed so that the encoded ERV protein could be presented to the immune system to generate an appropriate immunological response. In a suitable aspect of the invention, the ERV protein epitope or immunogenic portion thereof is located between the transmembrane domain and the ISD.
Описанные здесь эксперименты показали, что кодируемые аденовирусом VLP HERV-K с мутированным ISD могут быть использованы не только в Ad5, но также и в аденовирусе другого серотипа, т.е. Ad19 (см., Примеры 15-17). Как показано ранее, HERV-K ассоциируются с раком, и было обнаружено, что он содержит функциональный оболочечный домен ISD с активностью in vitro, аналогичной активности ВИЧ ((Morozov et al., 2013). У мышей HERV-K представляет собой чужеродный антиген с активностью домена ISD, аналогичной активности доменов ISD с мутациями, которые априори не будут усиливать иммунные ответы. Однако было неожиданно обнаружено, что мутация ISD повышает гуморальные ответы против белков р15Е Env HERV-K и доменов SU, Т-клеточные ответы и защиту от рака. Мутации в HERV-K отличаются от мутаций, описанных здесь для MelARV, поскольку вирусные семейства различаются последовательностями ISD. Однако, исходя из представленной здесь информации и общих знаний, специалист в данной области может самостоятельно идентифицировать подходящие мутации, инактивирующие ISD также и в других семействах вирусов. Используемая здесь мутация HERV-K была выявлена по мутациям ISD в ВИЧ, и было показано, что эти мутации сохраняют инфекционность вируса и сайт-специфическую консервативность между HERV-K и ВИЧ-1 (Morozov et al., 2012). После анализа трансфецированых вектором клеток было обнаружено повышение уровня экспрессии мутаций HERV-KThe experiments described here show that adenovirus-encoded HERV-K VLPs with a mutated ISD can be used not only in Ad5, but also in another adenovirus serotype, i.e. Ad19 (see Examples 15-17). HERV-K has previously been shown to be associated with cancer and has been found to contain a functional ISD envelope domain with in vitro activity similar to that of HIV ((Morozov et al., 2013). In mice, HERV-K is a foreign antigen with The activity of the ISD domain is similar to that of ISD domains with mutations, which a priori would not enhance immune responses.However, the ISD mutation was unexpectedly found to enhance humoral responses against the HERV-K p15E Env proteins and SU domains, T-cell responses and protection against cancer. The mutations in HERV-K differ from the mutations described here for MelARV because viral families differ in ISD sequences.However, based on the information presented here and general knowledge, one skilled in the art can independently identify suitable ISD-inactivating mutations in other virus families as well The HERV-K mutation used here was identified from ISD mutations in HIV, and these mutations have been shown to maintain viral infectivity and site-specific conservation between HERV-K and HIV-1 (Morozov et al., 2012). After analysis of vector-transfected cells, an increase in the expression level of HERV-K mutations was detected
- 6 046517 внутри клеток и на их поверхности (см. Пример 15 и фиг. 24), что позволяет объяснить повышенную иммуногенность и на этой основе разработать дополнительную механистическую стратегию введения мутаций ISD в белки Env семейства HERV-K с применением любого метода генетической экспрессии и конструкций, которые могут образовывать, а могут и не образовывать, VLP.- 6 046517 inside cells and on their surface (see Example 15 and Fig. 24), which allows us to explain the increased immunogenicity and on this basis to develop an additional mechanistic strategy for introducing ISD mutations into the Env proteins of the HERV-K family using any method of genetic expression and structures that may or may not form VLPs.
Таким образом, настоящее изобретение также относится к молекуле нуклеиновой кислоты, кодирующей белок оболочки ERV или иммуногенную часть, где ISD указанного белка содержит мутации, которые делают ISD неактивным. Предпочтительно ERV представляет собой человеческий эндогенный ретровирус (HERV), а более предпочтительно, HERV представляет собой HERV-K. Кроме того, предпочтительно, чтобы мутация в ISD представляла собой замену Q525 на аланин так, чтобы последовательность мутантного ISD представляла собой NSQSSIDQKLANAINDLRQT (SEQ ID NO: 50) (вместо NSQSSIDQKLANQINDLRQT; SEQ ID NO: 49). Следует отметить, что также рассматриваются соответствующие мутации в ISD с заменой другой последовательностью. В другом предпочтительном варианте осуществления изобретения, молекула нуклеиновой кислоты содержится в аденовирусном векторе. Более предпочтительно, аденовирусным вектором является аденовирусный вектор типа 19 (Ad19). Кроме того, предпочтительно, чтобы аденовирусный вектор, содержащий нуклеиновую кислоту, кодировал VLP. Кроме того, настоящее изобретение также относится к белку, кодируемому указанной молекулой нуклеиновой кислоты или указанным вектором. Молекула нуклеиновой кислоты, вектор или кодируемый им белок могут быть использованы для лечения или профилактики заболевания, где указанным заболеванием, предпочтительно, является рак. Раковым заболеванием, подвергаемым лечению, является рак, при котором экспрессируется соответствующий ERV. Предпочтительно лечение включает схему праймбуст, где сначала вводят аденовирус или молекулу нуклеиновой кислоты, а затем вводят MVA, аденовирус или ДНК. Предпочтительно, чтобы бустер-дозой являлась бустер-доза MVA. Рассматриваются также различные периоды времени между введением первой дозы и бустер-дозы. В частности, у онкологических больных с минимально резидуальной болезнью могут быть длинные промежутки между первым введением и введением бустер-дозы. В предпочтительной схеме введения, бустер-дозу вводят через 4-8 недель после введения первой дозы.Thus, the present invention also provides a nucleic acid molecule encoding an ERV envelope protein or immunogenic portion, wherein the ISD of said protein contains mutations that render the ISD inactive. Preferably, the ERV is a human endogenous retrovirus (HERV), and more preferably, the HERV is HERV-K. It is further preferred that the mutation in the ISD is a substitution of Q525 for alanine such that the sequence of the mutant ISD is NSQSSIDQKLANAINDLRQT (SEQ ID NO: 50) (instead of NSQSSIDQKLANQINDLRQT; SEQ ID NO: 49). It should be noted that corresponding mutations in ISD with replacement by another sequence are also considered. In another preferred embodiment of the invention, the nucleic acid molecule is contained in an adenoviral vector. More preferably, the adenoviral vector is adenoviral vector type 19 (Ad19). It is further preferred that the adenoviral vector containing the nucleic acid encodes a VLP. In addition, the present invention also relates to a protein encoded by said nucleic acid molecule or said vector. The nucleic acid molecule, vector, or the protein it encodes can be used for the treatment or prevention of a disease, where the disease is preferably cancer. The cancer being treated is one that expresses the corresponding ERV. Preferably, the treatment includes a prime boost regimen, where an adenovirus or nucleic acid molecule is first administered, followed by MVA, adenovirus, or DNA. Preferably, the booster dose is an MVA booster dose. Various periods of time between the first dose and the booster dose are also considered. In particular, cancer patients with minimally residual disease may have long intervals between the first dose and the booster dose. In the preferred dosing regimen, the booster dose is administered 4 to 8 weeks after the first dose.
В предпочтительном аспекте вакцины согласно изобретению, белковый продукт аденовирусного вектора включает белок gag, пептид 2А и белок оболочки (Env). Кроме того, белок Env может содержать поверхностную единицу (gp70), сайт расщепления и трансмембранную единицу (р15Е). Кроме того, трансмембранная единица (р15Е) может содержать гибридный пептид, иммуносупрессорный домен (ISD), трансмембранный якорь и цитоплазматический хвост.In a preferred aspect of the vaccine according to the invention, the protein product of the adenoviral vector includes a gag protein, a 2A peptide, and an envelope protein (Env). In addition, the Env protein may contain a surface unit (gp70), a cleavage site, and a transmembrane unit (p15E). In addition, the transmembrane unit (p15E) may contain a fusion peptide, an immunosuppressive domain (ISD), a transmembrane anchor, and a cytoplasmic tail.
Для повышения иммуносупрессии вакцины может оказаться желательным, чтобы р15Е или ее иммуногенная часть были связаны с аденовирусным капсидным белком pIX. Для достижения этой цели, р15Е своим N-концом была присоединена к С-концу pIX. В высокой степени упорядоченная структура pIX и связанного с ним антигена на аденовирусной поверхности способствует перекрестному связыванию с В-клеточными рецепторами. Другим преимуществом является то, что pIX обычно презентируется как тример и может также стимулировать презентацию связанного антигена р15Е в природной тримерной форме. Было показано, что такая модификация повышает уровень индуцирования специфических антител у мышей CD 1.To enhance the immunosuppression of the vaccine, it may be desirable for p15E or an immunogenic portion thereof to be associated with the adenoviral capsid protein pIX. To achieve this goal, p15E was attached at its N-terminus to the C-terminus of pIX. The highly ordered structure of pIX and its associated antigen on the adenoviral surface facilitates cross-binding with B cell receptors. Another advantage is that pIX is typically presented as a trimer and can also stimulate presentation of the associated p15E antigen in its native trimeric form. This modification has been shown to increase the level of specific antibody induction in CD 1 mice.
В определенном аспекте настоящего изобретения, сигнальный пептид, кодируемый аденовирусным вектором, заменяют сигнальным пептидом люциферазы Gaussia (LucSP). Этот сигнальный пептид усиливает трнаспорт белков во внешнюю клеточную мембрану без изменения статуса гликозилирования. Таким образом, этот сигнальный пептид, включенный вместо нативной последовательности, способствует переносу синтезированных белков в мембрану, где они интегрируются в VLP.In a certain aspect of the present invention, the signal peptide encoded by the adenoviral vector is replaced with a Gaussia luciferase signal peptide (LucSP). This signal peptide enhances the transport of proteins into the outer cell membrane without changing the glycosylation status. Thus, this signal peptide, inserted in place of the native sequence, promotes the transport of synthesized proteins into the membrane, where they are integrated into the VLP.
В другом аспекте настоящего изобретения, трансмембранный якорь и цитоплазматический хвост, кодируемые аденовирусным вектором, заменяют трансмембранным доменом и цитоплазматическим хвостом гемагглютинина вируса гриппа А. Встраивание способствует повышению уровня экспрессии рекомбинантных белков на клеточной поверхности и на VLP, что приводит к вырабатыванию сильных гуморальных ответов широкого ряда. В предпочтительном варианте осуществления изобретения трансмембранный якорь и цитоплазматический хвост, кодируемые аденовирусным вектором, заменяют трансмембранным доменом и цитоплазматическим хвостом гемагглютинина H3N2 вируса гриппа А (НАТМСТ).In another aspect of the present invention, the transmembrane anchor and cytoplasmic tail encoded by the adenoviral vector are replaced with the transmembrane domain and cytoplasmic tail of influenza A virus hemagglutinin. The insertion increases the level of expression of recombinant proteins on the cell surface and on VLPs, which leads to the production of strong humoral responses of a wide range . In a preferred embodiment of the invention, the transmembrane anchor and cytoplasmic tail encoded by the adenoviral vector are replaced with the transmembrane domain and cytoplasmic tail of influenza A virus H3N2 hemagglutinin (HATMCT).
В другом аспекте изобретения последовательность тримеризации вводят рядом с сигнальным пептидом. Последовательность тримеризации может быть присоединена к белку для облегчения природной презентации. В предпочтительном аспекте изобретения последовательностью тримеризации является GCN4.In another aspect of the invention, the trimerization sequence is introduced adjacent to the signal peptide. A trimerization sequence can be attached to the protein to facilitate natural presentation. In a preferred aspect of the invention, the trimerization sequence is GCN4.
Белковый продукт аденовирусного вектора обычно включает белок gag, где белок gag представляет собой экзогенный ретровирусный белок gag или эндогенный ретровирусный белок gag.The protein product of an adenoviral vector typically includes a gag protein, where the gag protein is an exogenous retroviral gag protein or an endogenous retroviral gag protein.
Аденовирусный вектор обычно необходим клетке для продуцирования вирусоподобной частицы. Таким образом, аденовирусный вектор инфицирует клетку и продуцирует компоненты для VLP. В определенном аспекте изобретения, VLP продуцируется в изолированной клеточной линии. Подходящими примерами являются клетки Sf9, клетки Vero, клетки HeLa и т.п. Однако в настоящее время желательно,An adenoviral vector is usually required by a cell to produce a virus-like particle. Thus, the adenoviral vector infects the cell and produces components for the VLP. In a certain aspect of the invention, the VLP is produced in an isolated cell line. Suitable examples are Sf9 cells, Vero cells, HeLa cells and the like. However, at present it is desirable
- 7 046517 чтобы VLP продуцировалась в клетке организма пациента, инфицированного аденовирусным вектором. Такой продукт также называется вирусоподобными частицами, кодируемыми вирусом (VE-VLP) и имеет то преимущество, что он позволяет исключть промежуточного хозяина для продуцирования VLP.- 7 046517 so that the VLP is produced in a cell of the patient's body infected with the adenoviral vector. Such a product is also called virus-encoded virus-like particles (VE-VLPs) and has the advantage of eliminating the intermediate host for VLP production.
Настоящее изобретение также относится к конструкции нуклеиновой кислоты, кодирующей белокмишень, способный образовывать вирусоподобную частицу (VLP), где белок-мишень содержит иммуносупрессорный домен (ISD), где указанный ISD является неактивным.The present invention also relates to a nucleic acid construct encoding a target protein capable of forming a virus-like particle (VLP), wherein the target protein contains an immunosuppressive domain (ISD), wherein the ISD is inactive.
Настоящее изобретение является особенно подходящим для профилактики и/или лечения рака. Типы рака, подвергаемого лечению в соответствии с настоящим изобретением, не имеют конкретных ограничений, и включают рак предстательной железы, рак молочной железы, рак яичника, лимфому, меланому, лейкоз, саркому, рак прямой и ободочной кишки, рак яичек, рак яичника, рак молочной железы, лимфому, рак легких и рак печени.The present invention is particularly suitable for the prevention and/or treatment of cancer. The types of cancer treated in accordance with the present invention are not particularly limited and include prostate cancer, breast cancer, ovarian cancer, lymphoma, melanoma, leukemia, sarcoma, colorectal cancer, testicular cancer, ovarian cancer, cancer breast, lymphoma, lung cancer and liver cancer.
При определенных условиях может оказаться предпочтительным лечение пациента по схеме прайм-буст. Таким образом, одним из вариантов осуществления изобретения является применение вакцины для профилактики и/или лечения рака, где указанное применение включает стадию примирования пациента вышеописанной конструкцией нуклеиновой кислоты по меньшей мере за 5 дней до введения бустер-дозы вакцины, описанной выше.Under certain conditions, it may be preferable to treat a patient with a prime-boost regimen. Thus, one embodiment of the invention is the use of a vaccine for the prevention and/or treatment of cancer, wherein said use includes the step of priming a patient with the above-described nucleic acid construct at least 5 days prior to administration of a booster dose of the vaccine described above.
Настоящее изобретение также относится к вакцине для применения в профилактике и/или лечении рака, где указанное применение включает стадию последующего лечения пациента через 5 дней или более после лечения пациента вышеописанной вакциной, содержащей кодируемые вирусом VLP, отличающиеся от VLP, происходящих от аденовирусного вектора. В определенном варианте осуществления изобретения, кодируемые вирусом VLP, отличающиеся от VLP, происходящих от аденовирусного вектора, представляют собой VLP, происходящие от модифицированной осповакцины Анкара (MVA).The present invention also provides a vaccine for use in the prevention and/or treatment of cancer, wherein said use includes the step of subsequently treating a patient 5 days or more after treatment of the patient with the above-described vaccine containing virus-encoded VLPs other than VLPs derived from an adenoviral vector. In a certain embodiment of the invention, the virus-encoded VLPs other than the adenoviral vector-derived VLPs are modified vaccinia Ankara (MVA)-derived VLPs.
Кроме того, неожиданно было обнаружено, что, вопреки сообщению Hohn et al. 2014, касающемуся оптимизированного по кодонам HERV-K113 под контролем промотора CMV, используемй экспрессионный кластер, то есть, Gag-P2A-ENV вместе с Env, экспрессируемым в отношении 1:1 с Gag под контролем сильного промотора, не удерживался в клеточной мембране. Вместо этого, экспрессировались VLP, которые (опять же в отличие от результатов, представленных Hohn et al.) также содержали Env. Это указывает на то, что генетическая платформа с Gag-p2a-Env работает лучше по сравнению с конструкцией без р2а (или соответствующего функционально присоединенного линкера).In addition, it was unexpectedly found that, contrary to the report of Hohn et al. 2014, regarding codon-optimized HERV-K113 under the control of a CMV promoter, the expression cluster used, that is, Gag-P2A-ENV together with Env expressed in a 1:1 ratio with Gag under the control of a strong promoter, was not retained in the cell membrane. Instead, VLPs were expressed that (again in contrast to the results reported by Hohn et al.) also contained Env. This indicates that the genetic platform with Gag-p2a-Env performs better compared to the construct without p2a (or the corresponding operably linked linker).
Таким образом, настоящее изобретение также относится к молекуле нуклеиновой кислоте, кодирующей белок Gag и белок оболочки ERV (Env) или его иммуногенную часть, где нативная геномная структура, соединяющая Gag и Env, была заменена функционально присоединенным линкером. Предпочтительно указанный функционально присоединенный линкер представляет собой р2А. Другими словами, настоящее изобретение также относится к молекуле нуклеиновой кислоты, содержащей экспрессионный кластер Gag-функционально присоединенный линкер - Env, a предпочтительно кластер Gagp2A-Env. Предпочтительно ERV представляет собой HERV-K. Более предпочтительно ERV представляет собой HERV-K113. Кроме того, предпочтительно, чтобы последовательность HERV-K представляла собой консенсусную последовательность HERV-K, а более предпочтительно оптимизированную по кодонам консенсусную последовательность. Еще более предпочтительно, оптимизированная по кодонам консенсусная последовательность HERV-K представляет собой нижеследующую аминокислотную последовательность (SEQ ID NO: 55):Thus, the present invention also provides a nucleic acid molecule encoding a Gag protein and an ERV envelope protein (Env) or an immunogenic portion thereof, wherein the native genomic structure connecting Gag and Env has been replaced by an operably attached linker. Preferably, said operably attached linker is p2A. In other words, the present invention also provides a nucleic acid molecule comprising a Gag expression cluster operably linked to an Env linker, preferably a Gagp2A-Env cluster. Preferably the ERV is HERV-K. More preferably, the ERV is HERV-K113. Furthermore, it is preferred that the HERV-K sequence is a HERV-K consensus sequence, and more preferably a codon optimized consensus sequence. Even more preferably, the codon optimized HERV-K consensus sequence is the following amino acid sequence (SEQ ID NO: 55):
- 8 046517- 8 046517
MGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDL KDWMGQTKSKIKSKYASYLSFIKILLKRGGVKVSTKNLIKLFQIIEQFCPWFPEQGTLDL KDW
KRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEEDSVSVSDAPGSCIIDCNKRIGKELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTEEDSVSVSDAPGSCIIDCN
ENTRENTR
KKSQKETEGLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPSKKSQKETEGLHCEYVAEPVMAQSTQNVDYNQLQEVIYPETLKLEGKGPELVGPS
ESKPRGESKPRG
TSPLPAGQVPVTLQPQKQVKENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMPTSPLPAGQVPVTLQPQKQVKENKTQPPVAYQYWPPAELQYRPPPESQYGYPGMP
PAPQGRPAPQGR
APYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQAPYPQPPTRRLNPTAPPSRQGSELHEIIDKSRKEGDTEAWQFPVTLEPMPPGEGAQ
EGEPEGEP
PTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILAPTVEARYKSFSIKMLKDMKEGVKQYGPNSPYMRTLLDSIAHGHRLIPYDWEILA
KSSLSPKSSLSP
SQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQNSQFLQFKTWWIDGVQEQVRRNRAANPPVNIDADQLLGIGQNWSTISQQALMQN
EAIEQVREAIEQVR
AICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVIAICLRAWEKIQDPGSTCPSFNTVRQGSKEPYPDFVARLQDVAQKSIADEKARKVI
VELMAVELMA
YENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAMLMAQAITGVYENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAMLMAQAITGV
VLGGQVRVLGGQVR
TFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQTFGGKCYNCGQIGHLKKNCPVLNKQNITIQATTTGREPPDLCPRCKKGKHWASQ
CRSKFDCRSKFD
KNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYNKNGQPLSGNEQRGQPQAPQQTGAFPIQPFVPQGFQGQQPPLSQVFQGISQLPQYN
NCPPPNCPPP
QAAVQQGSGATNFSLLKQAGDVEENPGPMNPSEMQRKAPPRRRRHRNRAPLTHQAAVQQGSGATNFSLLKQAGDVEENPGPMNPSEMQRKAPPRRRRHRNRAPLTH
KMNKMVTKMNKMVT
SEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSM
VVSLPMVVSLPM
PAGAAAANYTYWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVPGPIDDRCPAKPPAGAAAANYTYWAYVPFPPLIRAVTWMDNPIEVYVNDSVWVPGPIDDRCPAKP
EEEGMMIEEEGMMI
NISIGYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYHMVSGMSLRPRVNNISIGYRYPPICLGRAPGCLMPAVQNWLVEVPTVSPISRFTYHMVSGMSLRPRVN
YLQDFYLQDF
SYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAP
RGQFYRGQFY
HNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPKIHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPKI
VSPVSVSPVS
GPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTVPLQSCVKPPYGPEHPELWRLTVASHHIRIWSGNQTLETRDRKPFYTVDLNSSLTVPLQSCVKPPY
MLVVGMLVVG
NIVIKPDSQTITCENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSMDRPWEASPSNIVIKPDSQTITCENCRLLTCIDSTFNWQHRILLVRAREGVWIPVSMDRPWEASPS
VHILVHIL
TEVLKGVLNRSKRFIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNDWQKTEVLKGVLNRSKRFIFTLIAVIMGLIAVTATAAVAGVALHSSVQSVNFVNDWQK
NSTRLWNSTRLW
NSOSSIDOKLANOINDLRQTVIWMGDRLMSLEHRFOLOCDWNTSDFCITPOIYNNSOSSIDOKLANOINDLRQTVIWMGDRLMSLEHRFOLOCDWNTSDFCITPOIYN
ESEHHWESEHHW
DMVRRHLQGREDNLTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPDMVRRHLQGREDNLLTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNP
VTWVKTVTWVKT
IGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVGIGSTTIINLILILVCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVG
KSKRDKSKRD
QIVTVSV.QIVTVSV.
Кроме того, предпочтительно, чтобы HERV-K содержал мутацию в своем ISD (который подчеркнут и выделен жирным шрифтом в приведенной выше последовательности). Особенно предпочтительная последовательность, содержащая такую мутацию, показана в SEQ ID NO: 48.Additionally, it is preferred that HERV-K contains a mutation in its ISD (which is underlined and in bold in the above sequence). A particularly preferred sequence containing such a mutation is shown in SEQ ID NO: 48.
Кроме того, предпочтительно, чтобы молекула нуклеиновой кислоты представляла собой аденовирусный вектор. Предполагается, что нуклеиновая кислота может быть использована в качестве генетической вакцины, а в частности, для профилактики и/или лечения заболевания, предпочтительно рака. Альтернативно, молекула нуклеиновой кислоты может быть также использована для продуцирования VLP, а в частности, HERV-К VLP in vitro. Затем полученные VLP могут быть использованы в иммунотерапии, а в частности, для профилактики и/или лечения заболевания, предпочтительно рака. Следует отметить, что в этом контексте рак, подлежащий лечению, представляет собой рак, при котором экспрессируется ERV.It is further preferred that the nucleic acid molecule is an adenoviral vector. It is contemplated that the nucleic acid may be used as a genetic vaccine, and in particular for the prevention and/or treatment of a disease, preferably cancer. Alternatively, the nucleic acid molecule can also be used to produce VLPs, and in particular HERV-K VLPs in vitro. The resulting VLPs can then be used in immunotherapy, and in particular for the prevention and/or treatment of a disease, preferably cancer. It should be noted that in this context, the cancer to be treated is a cancer that expresses ERV.
Кроме того, настоящее изобретение также относится к VLP, кодируемой молекулой нуклеиновой кислоты, кодирующей белок Gag и белок оболочки ERV (Env) или его иммуногенную часть, где нативная геномная структура, соединяющая Gag и Env, была заменена функционально присоединенным линIn addition, the present invention also relates to a VLP encoded by a nucleic acid molecule encoding a Gag protein and an ERV envelope protein (Env) or an immunogenic portion thereof, where the native genomic structure connecting Gag and Env has been replaced by an operably linked line
- 9 046517 кером. Предпочтительно указанный функционально присоединенный линкер представляет собой р2А. Также предпочтительно, чтобы ERV представлял собой HERV-K. Более предпочтительно, ERV представляет собой HERV-K113. Предпочтительно указанные VLP содержат большее количество Env по сравнению с VLP HERV-K113, продуцируемыми методом, описанным Hohn et al. Как уже упоминалось выше, рассматривается также применение таких VLP в иммунотерапии. Кроме того, настоящее изобретение относится к молекуле нуклеиновой кислоты или VLP в целях их применения для профилактики и/или лечения заболевания. Предпочтительным заболеванием является рак. Следует отметить, что рак представляет собой рак, при котором экспрессируется соответствующий ERV.- 9 046517 ceramic. Preferably, said operably attached linker is p2A. It is also preferred that the ERV is HERV-K. More preferably, the ERV is HERV-K113. Preferably, said VLPs contain a greater amount of Env compared to HERV-K113 VLPs produced by the method described by Hohn et al. As mentioned above, the use of such VLPs in immunotherapy is also being considered. In addition, the present invention relates to a nucleic acid molecule or VLP for use in the prevention and/or treatment of a disease. The preferred disease is cancer. It should be noted that a cancer is a cancer in which the corresponding ERV is expressed.
Краткое описание чертежейBrief description of drawings
В последующей подробной части настоящего изобретения, аспекты, варианты осуществления и применения будут объяснены более подробно со ссылкой на примеры осуществления вариантов изобретения, представленные на чертежах, где на фиг. 1 раскрывается механизм действия вирусоподобных частиц, кодируемых вирусным вектором. Вакцина содержит рекомбинантный аденовирус (Ad5), кодирующий вирусные белки Gag и Env. После инъекции, Ad5 инфицирует клетки и индуцирует экспрессию кодируемых белков. Gag и Env связываются посредством саморасщепляющегося пептида (р2А), что будет гарантировать не только эквимолярную экспрессию обоих белков, но также и их разделение после трансляции. Одного структурного белка Gag достаточно для индуцирования почкования из клеточной мембраны и образования вирусоподобных частиц (VLP). Во время образования VLP, Env ассоциируется с Gag и интегрируется в высвобождаемые VLP. Таким образом, вакцинация вектором Ad5 индуцирует продуцирование VLP, которые на своей поверхности презентируют белок-мишень Env иммунной системе.In the following detailed portion of the present invention, aspects, embodiments and applications will be explained in more detail with reference to exemplary embodiments of the invention shown in the drawings, in which: FIG. 1 reveals the mechanism of action of virus-like particles encoded by a viral vector. The vaccine contains a recombinant adenovirus (Ad5) encoding the viral proteins Gag and Env. Once injected, Ad5 infects cells and induces expression of the encoded proteins. Gag and Env are linked via a self-cleaving peptide (p2A), which will ensure not only equimolar expression of both proteins, but also their separation after translation. The Gag structural protein alone is sufficient to induce budding from the cell membrane and the formation of virus-like particles (VLPs). During VLP formation, Env associates with Gag and is integrated into the released VLPs. Thus, vaccination with the Ad5 vector induces the production of VLPs, which present the Env target protein to the immune system on their surface.
На фиг. 2 схематически показана структура белка оболочки MuLV/MelARV. Белок оболочки (Env) состоит из двух субъединиц, (слева): Трансмембранная субъединица р15Е (ТМ) заякорена в клеточной мембране и содержит иммуносупрессорный домен (ISD) и гибридный пептид. р15Е ковалентно связан посредством дисульфидных мостиков с поверхностной субъединицей gp70 (SU). р15Е, а особенно ISD, экранированы субъединицей gp70 для предотвращения связывания с антителом. (справа): Белковые субъединицы экспрессируются как белкок-предшественник, который расщепляется во время процессинга и транспортируется в мембрану. Эта фигура взята из публикации Mangeney et al., 2007 с изменениями.In fig. Figure 2 schematically shows the structure of the MuLV/MelARV envelope protein. The envelope protein (Env) consists of two subunits, (left): The p15E transmembrane subunit (TM) is anchored in the cell membrane and contains an immunosuppressive domain (ISD) and a fusion peptide. p15E is covalently linked via disulfide bridges to the surface subunit gp70 (SU). p15E, and especially ISD, are shielded by the gp70 subunit to prevent binding to the antibody. (right): Protein subunits are expressed as a precursor protein, which is cleaved during processing and transported to the membrane. This figure is adapted from Mangeney et al., 2007.
На фиг. 3 показаны мутации в ISD кодируемого вакциной Env MelARV (p15E). Две аминокислоты в ISD р15Е были заменены для инактивации иммуносупрессорного механизма. Таким образом, были сделаны следующие аминокислотные замены: Е14 ^ R|4 и А20 ^ F20.In fig. Figure 3 shows mutations in the ISD of the vaccine-encoded MelARV Env (p15E). Two amino acids in the p15E ISD were changed to inactivate the immunosuppressive mechanism. Thus, the following amino acid substitutions were made: E 14 ^ R| 4 and A 20 ^ F20.
На фиг. 4 показаны векторные карты 768tet и Capture-pBGH. Показаны также ДНК-векторы 768tet (А) и Capture-pBGH (В) с соответствующими генами. На векторной карте, дополнительные гены, присутствующие в плазмидах, не показаны. Белки-мишени были сначала клонированы в экспрессионный вектор 768tet (А). Экспрессионный кластер, включающий белок-мишень, был затем клонирован в геномный вектор человеческого Ad5 (hAd5) Capture-pBGH (В) с помощью гомологичной рекомбинации для получения рекомбинантных вирусов в клеточных линиях-продуцентах.In fig. Figure 4 shows the vector maps of 768tet and Capture-pBGH. DNA vectors 768tet (A) and Capture-pBGH (B) with the corresponding genes are also shown. In the vector map, additional genes present on the plasmids are not shown. Target proteins were first cloned into the 768tet expression vector (A). The expression cluster comprising the target protein was then cloned into the human Ad5 (hAd5) Capture-pBGH (B) genomic vector by homologous recombination to produce recombinant viruses in producer cell lines.
На фиг. 5 описаны стадии продуцирования рекомбинантного Ad5. На схеме показан процесс клонирования белка-мишени в Capture-pBGH с последующим продуцированием вируса. Продуцирование рекомбинантного Ad5 включает последовательные стадии получения вирусного лизата, 3-дневного лизата и крупномасштабного лизата, содержащих рекомбинантный вирус.In fig. 5 describes the steps for producing recombinant Ad5. The diagram shows the process of cloning the target protein into Capture-pBGH followed by virus production. Production of recombinant Ad5 involves the sequential steps of producing a viral lysate, a 3-day lysate, and a large-scale lysate containing the recombinant virus.
Фиг. 6: Пептид, используемый для ELISA-анализа р15Е-специфических гуморальных ответов. Область Env MelARV, показанная стрелкой и обозначенная как ТМ (р15Е), была синтезирована как пептид и использована для ELISA-анализа проб сыворотки крови от вакцинированных мышей.Fig. 6: Peptide used for ELISA analysis of p15E-specific humoral responses. The MelARV Env region, indicated by the arrow and designated TM (p15E), was synthesized as a peptide and used for ELISA analysis of serum samples from vaccinated mice.
Фиг. 7: Гуморальные ответы, индуцированные Ad5-MelARV-ISD у мышей CD1. (А) р15Еспецифические антитела в сыворотке вакцинированных мышей CD1 (схема вакцинации IV). Мыши были вакцинированы сначала ДНК, кодирующей MelARV, MelARV-ISD или GFP (как описано под графиком), а затем путем введения другой бустер-дозы Ad5 (надписи). Вакцины, используемые для бустер-дозы, представляют собой Ad5-MelARV (темно-серый), Ad5-MelARV-ISD (светло-серый) или Ad5-GFP (белый). Связывание антител с р15Е анализировали с помощью ELISA. Столбики на гистограммах означают среднюю оптическую плотность по сравнению с контрольной сывороткой LEV76 ± ср. кв. ош. Размер выборки составлял n=5 в каждой группе. (В) B16F10-GP-специфuческие антитела. Клетки B16F10-GP инкубировали с сывороткой крови тех же мышей, как и в (А). Связывание антител детектировали с использованием АРС-конъюгированного второго антитела против мышиного IgG с помощью проточной цитометрии. Средняя интенсивность флуоресценции для каждой вакцинированной группы представлены как среднее ± ср. кв. ош. Звездочки указывают на значимые различия между группами, * (Р < 0,05); ** (Р < 0,01); *** (Р < 0,001).Fig. 7: Humoral responses induced by Ad5-MelARV-ISD in CD1 mice. (A) p15E-specific antibodies in the serum of vaccinated CD1 mice (vaccination schedule IV). Mice were vaccinated first with DNA encoding MelARV, MelARV-ISD, or GFP (as described below the graph) and then with another boost dose of Ad5 (labels). The vaccines used for the booster dose are Ad5-MelARV (dark grey), Ad5-MelARV-ISD (light grey) or Ad5-GFP (white). Antibody binding to p15E was analyzed by ELISA. The bars in the histograms indicate the average optical density compared to control serum LEV76 ± avg. sq. osh. The sample size was n=5 in each group. (B) B16F10-GP-specific antibodies. B16F10-GP cells were incubated with serum from the same mice as in (A). Antibody binding was detected using an APC-conjugated anti-mouse IgG secondary antibody by flow cytometry. The mean fluorescence intensity for each vaccinated group is presented as mean ± avg. sq. osh. Asterisks indicate significant differences between groups, * (P < 0.05); ** (P < 0.01); *** (P < 0.001).
Фиг. 8: Гуморальные ответы и число метастазов у Ad-MelARV-ISD-вакцинированых мышей C57BL/6. Мышей вакцинировали ДНК-MelARV и Ad5-MelARV (ДНК+Ad5-MelARV) или ДНК-MelARVISD и Ad5-MelARV-ISD (ДНК+Ad5-MelARV-ISD) по схеме прийм-буст в соответствии со схемой вакцинации III. (А) Связывание рак- специфических антител с клетками B16F10-GP. Антитела в сывороткеFig. 8: Humoral responses and number of metastases in Ad-MelARV-ISD-vaccinated C57BL/6 mice. Mice were vaccinated with DNA-MelARV and Ad5-MelARV (DNA+Ad5-MelARV) or DNA-MelARVISD and Ad5-MelARV-ISD (DNA+Ad5-MelARV-ISD) in a prime-boost schedule according to vaccination schedule III. (A) Binding of cancer-specific antibodies to B16F10-GP cells. Antibodies in serum
--
Claims (1)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US63/013,631 | 2020-04-22 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EA046518B1 true EA046518B1 (en) | 2024-03-22 |
Family
ID=
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6283005B2 (en) | Target-specific gene delivery for dendritic cell vaccine treatment | |
| JP6688535B2 (en) | Vaccine composition | |
| JP5427874B2 (en) | Chimpanzee adenovirus vaccine carrier | |
| JP7277466B2 (en) | Vaccines for use in the prevention and/or treatment of disease | |
| EA027236B1 (en) | Immunogenic compositions and methods of using the compositions for inducing humoral and cellular immune responses | |
| WO2006031996A2 (en) | Targeting viruses using a modified sindbis glycoprotein | |
| Uhlig et al. | Lentiviral protein transfer vectors are an efficient vaccine platform and induce a strong antigen-specific cytotoxic T cell response | |
| Neukirch et al. | Adenovirus based virus-like-vaccines targeting endogenous retroviruses can eliminate growing colorectal cancers in mice | |
| Lescaille et al. | Efficacy of DNA vaccines forming e7 recombinant retroviral virus-like particles for the treatment of human papillomavirus-induced cancers | |
| Neukirch et al. | The potential of adenoviral vaccine vectors with altered antigen presentation capabilities | |
| EA046518B1 (en) | DEVICE FOR COLLECTING THERMAL AND VIBRATION ENERGY OF THE ENVIRONMENT | |
| WO2023201201A1 (en) | Bicistronic lamp constructs comprising immune response enhancing genes and methods of use thereof | |
| CD et al. | Heterologous arenavirus vector prime-boost overrules self-tolerance for efficient tumor-specific CD8 T cell attack | |
| Wang | Prime and boost vaccination against HER2/neu in breast cancer |