EA045982B1 - STABLE LYOPHILIZED COMPOSITION BASED ON G-CSF FUSED WITH HYBRID Fc - Google Patents
STABLE LYOPHILIZED COMPOSITION BASED ON G-CSF FUSED WITH HYBRID Fc Download PDFInfo
- Publication number
- EA045982B1 EA045982B1 EA202193289 EA045982B1 EA 045982 B1 EA045982 B1 EA 045982B1 EA 202193289 EA202193289 EA 202193289 EA 045982 B1 EA045982 B1 EA 045982B1
- Authority
- EA
- Eurasian Patent Office
- Prior art keywords
- csf
- formulation
- concentration
- total volume
- fusion
- Prior art date
Links
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 title claims description 127
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 title claims description 127
- 239000000203 mixture Substances 0.000 title claims description 104
- 238000009472 formulation Methods 0.000 claims description 63
- 238000004108 freeze drying Methods 0.000 claims description 62
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 claims description 38
- 239000000600 sorbitol Substances 0.000 claims description 38
- 239000003381 stabilizer Substances 0.000 claims description 38
- 230000004927 fusion Effects 0.000 claims description 35
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 claims description 34
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 claims description 34
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 claims description 34
- 238000002360 preparation method Methods 0.000 claims description 31
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 24
- 102000004169 proteins and genes Human genes 0.000 claims description 23
- 108090000623 proteins and genes Proteins 0.000 claims description 23
- 239000012931 lyophilized formulation Substances 0.000 claims description 22
- 239000004094 surface-active agent Substances 0.000 claims description 20
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 claims description 15
- 239000013011 aqueous formulation Substances 0.000 claims description 15
- 229920001993 poloxamer 188 Polymers 0.000 claims description 15
- 229940044519 poloxamer 188 Drugs 0.000 claims description 14
- 239000008215 water for injection Substances 0.000 claims description 13
- 239000008351 acetate buffer Substances 0.000 claims description 10
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 claims description 7
- 230000000694 effects Effects 0.000 claims description 7
- 239000002736 nonionic surfactant Substances 0.000 claims description 5
- 229920001983 poloxamer Polymers 0.000 claims description 5
- 229960000502 poloxamer Drugs 0.000 claims description 5
- 238000011084 recovery Methods 0.000 claims description 4
- 239000000463 material Substances 0.000 claims 1
- 238000013112 stability test Methods 0.000 claims 1
- 235000010356 sorbitol Nutrition 0.000 description 30
- 229940074410 trehalose Drugs 0.000 description 26
- 108091006020 Fc-tagged proteins Proteins 0.000 description 25
- 235000018102 proteins Nutrition 0.000 description 21
- 229930006000 Sucrose Natural products 0.000 description 18
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 18
- 239000005720 sucrose Substances 0.000 description 18
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 15
- 238000004007 reversed phase HPLC Methods 0.000 description 15
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 14
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 14
- 239000000872 buffer Substances 0.000 description 13
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 13
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 12
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 description 12
- 229930195725 Mannitol Natural products 0.000 description 12
- 125000000539 amino acid group Chemical group 0.000 description 12
- 239000000594 mannitol Substances 0.000 description 12
- 235000010355 mannitol Nutrition 0.000 description 12
- 229940079593 drug Drugs 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 230000002776 aggregation Effects 0.000 description 10
- 238000004220 aggregation Methods 0.000 description 10
- 239000003795 chemical substances by application Substances 0.000 description 10
- 239000004480 active ingredient Substances 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 239000007853 buffer solution Substances 0.000 description 9
- 229940126534 drug product Drugs 0.000 description 9
- 239000012669 liquid formulation Substances 0.000 description 9
- 238000000034 method Methods 0.000 description 9
- 239000000825 pharmaceutical preparation Substances 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 230000027455 binding Effects 0.000 description 8
- 238000009739 binding Methods 0.000 description 8
- 230000015556 catabolic process Effects 0.000 description 8
- 238000006731 degradation reaction Methods 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 229920001184 polypeptide Polymers 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 229960000583 acetic acid Drugs 0.000 description 6
- 150000001413 amino acids Chemical group 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 239000012905 visible particle Substances 0.000 description 6
- 108010029961 Filgrastim Proteins 0.000 description 5
- 230000003013 cytotoxicity Effects 0.000 description 5
- 231100000135 cytotoxicity Toxicity 0.000 description 5
- 239000008367 deionised water Substances 0.000 description 5
- 229910021641 deionized water Inorganic materials 0.000 description 5
- 108010044644 pegfilgrastim Proteins 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 235000017281 sodium acetate Nutrition 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- DPVHGFAJLZWDOC-PVXXTIHASA-N (2r,3s,4s,5r,6r)-2-(hydroxymethyl)-6-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxane-3,4,5-triol;dihydrate Chemical group O.O.O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DPVHGFAJLZWDOC-PVXXTIHASA-N 0.000 description 4
- BDKLKNJTMLIAFE-UHFFFAOYSA-N 2-(3-fluorophenyl)-1,3-oxazole-4-carbaldehyde Chemical compound FC1=CC=CC(C=2OC=C(C=O)N=2)=C1 BDKLKNJTMLIAFE-UHFFFAOYSA-N 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 230000036425 denaturation Effects 0.000 description 4
- 238000004925 denaturation Methods 0.000 description 4
- 238000001035 drying Methods 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 229940087562 sodium acetate trihydrate Drugs 0.000 description 4
- 238000003860 storage Methods 0.000 description 4
- 229940074409 trehalose dihydrate Drugs 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 3
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 239000007979 citrate buffer Substances 0.000 description 3
- 239000003431 cross linking reagent Substances 0.000 description 3
- 229960004177 filgrastim Drugs 0.000 description 3
- 230000007062 hydrolysis Effects 0.000 description 3
- 238000006460 hydrolysis reaction Methods 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000012792 lyophilization process Methods 0.000 description 3
- HQQSBEDKMRHYME-UHFFFAOYSA-N pefloxacin mesylate Chemical compound [H+].CS([O-])(=O)=O.C1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCN(C)CC1 HQQSBEDKMRHYME-UHFFFAOYSA-N 0.000 description 3
- 229960001373 pegfilgrastim Drugs 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 230000000087 stabilizing effect Effects 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 239000004971 Cross linker Substances 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 2
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 2
- 238000003109 Karl Fischer titration Methods 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000004067 bulking agent Substances 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 238000007710 freezing Methods 0.000 description 2
- 230000008014 freezing Effects 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000001155 isoelectric focusing Methods 0.000 description 2
- 229940071846 neulasta Drugs 0.000 description 2
- 229940029345 neupogen Drugs 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 229940068977 polysorbate 20 Drugs 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 239000012723 sample buffer Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- GHCZTIFQWKKGSB-UHFFFAOYSA-N 2-hydroxypropane-1,2,3-tricarboxylic acid;phosphoric acid Chemical compound OP(O)(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O GHCZTIFQWKKGSB-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 1
- AYRXSINWFIIFAE-SCLMCMATSA-N Isomaltose Natural products OC[C@H]1O[C@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)[C@@H](O)[C@@H](O)[C@@H]1O AYRXSINWFIIFAE-SCLMCMATSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- AYRXSINWFIIFAE-UHFFFAOYSA-N O6-alpha-D-Galactopyranosyl-D-galactose Natural products OCC1OC(OCC(O)C(O)C(O)C(O)C=O)C(O)C(O)C1O AYRXSINWFIIFAE-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 150000007942 carboxylates Chemical group 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000010382 chemical cross-linking Methods 0.000 description 1
- 238000002144 chemical decomposition reaction Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000006240 deamidation Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229940088679 drug related substance Drugs 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 229940073621 enbrel Drugs 0.000 description 1
- HQPMKSGTIOYHJT-UHFFFAOYSA-N ethane-1,2-diol;propane-1,2-diol Chemical compound OCCO.CC(O)CO HQPMKSGTIOYHJT-UHFFFAOYSA-N 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000012537 formulation buffer Substances 0.000 description 1
- 238000012395 formulation development Methods 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- DLRVVLDZNNYCBX-CQUJWQHSSA-N gentiobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)C(O)O1 DLRVVLDZNNYCBX-CQUJWQHSSA-N 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- DLRVVLDZNNYCBX-RTPHMHGBSA-N isomaltose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)C(O)O1 DLRVVLDZNNYCBX-RTPHMHGBSA-N 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 229940045641 monobasic sodium phosphate Drugs 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 108010017584 romiplostim Proteins 0.000 description 1
- 229960004262 romiplostim Drugs 0.000 description 1
- WUWDLXZGHZSWQZ-WQLSENKSSA-N semaxanib Chemical compound N1C(C)=CC(C)=C1\C=C/1C2=CC=CC=C2NC\1=O WUWDLXZGHZSWQZ-WQLSENKSSA-N 0.000 description 1
- 238000009958 sewing Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- YBBXAUZMYYJYGV-UHFFFAOYSA-M sodium acetic acid acetate trihydrate Chemical compound O.O.O.[Na+].CC(O)=O.CC([O-])=O YBBXAUZMYYJYGV-UHFFFAOYSA-M 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Description
Область техникиField of technology
Настоящее изобретение относится к композициям на основе стабильного лиофилизированного состава, содержащим G-CSF 3-го поколения в молекулах гибридного Fc, слитого посредством пептидной связи с гранулоцитарным колониестимулирующим фактором (G-CSF), которые пригодны для введения, осуществляемого посредством подкожного (SC) пути.The present invention relates to compositions based on a stable lyophilized formulation containing 3rd generation G-CSF in hybrid Fc molecules fused via a peptide bond to granulocyte colony stimulating factor (G-CSF), which are suitable for administration via the subcutaneous (SC) route .
Уровень техникиState of the art
Рынок антител и Fc-слитых белков увеличивается с каждым днем. К настоящему времени 74 антитела или Fc-слитых белка одобрены по меньшей мере одним ведущим регулирующим органом, и при этом 11 из них являются Fc-слитыми (Strohl, W.R., Current progress in innovative engineered antibodies. Protein Cell, 2017). Fc-слитые белки состоят из активного ингредиента в структуре белка или пептида и Fc-домена. Таким образом короткий период полувыведения белка или пептида можно увеличить с часов до дней (Wu, В. and Y.N. Sun, Pharmacokinetics of Peptide-Fc fusion proteins. J Pharm Sci, 2014. 103(1): p. 53-64.). Первый коммерциализированный Fc-слитый белок Энбрел®, одобренный Управлением по санитарному надзору за качеством пищевых продуктов и медикаментов (FDA) в 1998 г. для терапевтического применения при ревматоидном артрите, вошел в 10 самых продаваемых лекарственных средств во всем мире с продажами на сумму 8874 миллиарда долларов в 2016 году. Предполагается, что Fc-слитые белки будут продолжать оказывать огромное влияние на фармацевтическую промышленность в предстоящие годы (Strohl, W.R., Current progress in innovative engineered antibodies. Protein Cell, 2017). При оценке лекарственных форм Fc-слитых белков видно, что четыре из Fc-слитых белков реализуются на рынке только в жидкой форме, а пять реализуются на рынке только в лиофилизированной форме. Остальные два получены в виде состава как в жидкой, так и в лиофилизированной формах. Указанное ясно демонстрирует то, что способ лиофилизации часто применяется для стабилизации Fc-слитых белков. Кроме того, во многих случаях было показано, что лиофилизированный состав и процесс лиофилизации также увеличивают стабильность белков (Siew, A., Freeze Drying Protein Formulations, Pharmaceutical Technology, Volume 38, Issue 5, 2014).The market for antibodies and Fc fusion proteins is increasing day by day. To date, 74 antibodies or Fc fusion proteins have been approved by at least one leading regulatory agency, and 11 of these are Fc fusion proteins (Strohl, W.R., Current progress in innovative engineered antibodies. Protein Cell, 2017). Fc fusion proteins consist of an active ingredient in a protein or peptide structure and an Fc domain. In this way, the short half-life of a protein or peptide can be extended from hours to days (Wu, B. and Y.N. Sun, Pharmacokinetics of Peptide-Fc fusion proteins. J Pharm Sci, 2014. 103(1): p. 53-64.). The first commercialized Fc fusion protein, Enbrel®, approved by the Food and Drug Administration (FDA) in 1998 for therapeutic use in rheumatoid arthritis, became one of the 10 best-selling drugs worldwide with sales of $8,874 billion. dollars in 2016. Fc fusion proteins are expected to continue to have a major impact on the pharmaceutical industry in the years to come (Strohl, W.R., Current progress in innovative engineered antibodies. Protein Cell, 2017). When evaluating the dosage forms of the Fc fusion proteins, it appears that four of the Fc fusion proteins are marketed only in liquid form, and five are marketed only in lyophilized form. The remaining two are obtained as a formulation in both liquid and lyophilized forms. This clearly demonstrates that the lyophilization method is often used to stabilize Fc fusion proteins. Additionally, in many cases, the lyophilized formulation and lyophilization process have also been shown to increase protein stability (Siew, A., Freeze Drying Protein Formulations, Pharmaceutical Technology, Volume 38, Issue 5, 2014).
В целом, белки характеризуются очень коротким периодом полувыведения и подвергаются денатурации (такой как агрегация, диссоциация и адсорбция на поверхности сосудов) под воздействием многих различных факторов, таких как неблагоприятные температуры, граница раздела вода-воздух, высокое давление, физическая/механическая нагрузка, органические растворители и загрязнение микроорганизмами.In general, proteins have a very short half-life and are subject to denaturation (such as aggregation, dissociation and adsorption on vascular surfaces) under the influence of many different factors, such as adverse temperatures, air-water interfaces, high pressure, physical/mechanical stress, organic solvents and microbial contamination.
Следовательно, денатурированный белок теряет присущие ему физико-химические свойства и физиологическую активность. Денатурация белков часто является необратимой, и вследствие этого белки, после того, как денатурируют, могут не восстановить свои природные свойства до исходного состояния и в конечном итоге оседают в виде агрегатов.Consequently, denatured protein loses its inherent physicochemical properties and physiological activity. Protein denaturation is often irreversible, and as a result, proteins, once denatured, may not recover their natural properties to their original state and end up precipitating as aggregates.
Обычный подход к минимизации агрегации представляет собой ограничение подвижности белков с целью уменьшения количества столкновений. Для преодоления нестабильности белков в водных составах терапевтическим белковым продуктам придают большую стабильность посредством лиофилизации (сублимационного высушивания). Лиофилизированные продукты обычно сопровождаются стерильной водной средой для восстановления.A common approach to minimizing aggregation is to restrict protein mobility to reduce the number of collisions. To overcome protein instability in aqueous formulations, therapeutic protein products are rendered more stable through lyophilization (freeze-drying). Lyophilized products are usually accompanied by a sterile aqueous reconstitution medium.
В ЕР 0674524 В1 описан стабильный лиофилизированный состав на основе G-CSF и способ его получения. Данный состав включает в себя G-CSF и стабилизирующее количество по меньшей мере одного стабилизирующего средства, выбранного из группы, состоящей из мальтозы, целлобиозы, генциобиозы, изомальтозы и сахарозы, где водный раствор характеризуется рН 7-8. В US 9283260 B2 описана стабильная лиофилизированная терапевтическая композиция на основе пептидного антитела, такая как композиция, содержащая от 1 до 100 мг/мл связывающего пептида Fc-Myo, содержащая 10 мМ гистидина в качестве буфера, 4% вес./об. маннита в качестве объемообразующего средства, 2% вес./об. сахарозы в качестве стабилизирующего средства и 0,004% вес./об. полисорбата-20 в качестве поверхностно-активного вещества. В ЕР 2945593 А4 описан способ получения лиофилизированной фармацевтической композиции, содержащей белок, а в ЕР 3125923 А2 описана лиофилизированная фармацевтическая композиция, содержащая ромиплостим, - буфер, который выбран из группы, состоящей из цитратного, фосфатного, аланинового, глицинового, аргининового буфера или их комбинации, полисорбата 20 в качестве поверхностно-активного вещества и объемообразующего средства, выбранного из сахарозы, трегалозы или их комбинации.EP 0674524 B1 describes a stable lyophilized formulation based on G-CSF and a method for its preparation. This composition includes G-CSF and a stabilizing amount of at least one stabilizing agent selected from the group consisting of maltose, cellobiose, gentiobiose, isomaltose and sucrose, where the aqueous solution has a pH of 7-8. US 9283260 B2 describes a stable lyophilized therapeutic composition based on a peptide antibody, such as a composition containing from 1 to 100 mg/ml Fc-Myo binding peptide, containing 10 mm histidine as a buffer, 4% w/v. mannitol as a bulking agent, 2% w/v. sucrose as a stabilizing agent and 0.004% w/v. polysorbate-20 as a surfactant. EP 2945593 A4 describes a method for preparing a lyophilized pharmaceutical composition containing a protein, and EP 3125923 A2 describes a lyophilized pharmaceutical composition containing romiplostim, a buffer that is selected from the group consisting of citrate, phosphate, alanine, glycine, arginine buffer or a combination thereof , polysorbate 20 as a surfactant and bulking agent selected from sucrose, trehalose or a combination thereof.
Платформа на основе гибридного Fc (hyFc), которая является молекулой, представляющей интерес, тестируемой в отношении лиофилизации и стабилизации в настоящем изобретении, была разработана как для дополнительного увеличения периода полувыведения конъюгированных лекарственных средств из плазмы крови, так и для минимизации цитотоксичности и иммуногенности (ЕР 20080766022, US 8586038 B2). Для данной цели генетически комбинировали два разных иммуноглобулина, характеризующиеся отсутствием ответов ADCC и CDC. Гибридный Fc получали из комбинаций подклассов IgG человека или из комбинаций IgD и IgG человека. Гибридный Fc, в случае если он присоединен к биологически активной молекуле, является эффективным в отношении увеличения периода полувыведения биологически активной молекулы в сыворотке крови, а также повышения уровня экспрессии полипептиThe hybrid Fc (hyFc) platform, which is the molecule of interest tested for lyophilization and stabilization in the present invention, was developed to both further increase the plasma half-life of conjugated drugs and to minimize cytotoxicity and immunogenicity (EP). 20080766022, US 8586038 B2). For this purpose, two different immunoglobulins characterized by the absence of ADCC and CDC responses were genetically combined. Hybrid Fc was prepared from combinations of human IgG subclasses or from combinations of IgD and human IgG. The hybrid Fc, when attached to a biologically active molecule, is effective in increasing the serum half-life of the biologically active molecule as well as increasing the expression level of the polypeptide
- 1 045982 да, в случае если экспрессируется нуклеотид, кодирующий полипептид Fc-слитого белка. Таким образом, G-CSF, слитый с гибридным Fc (hyFc), также характеризуется более продолжительным периодом полувыведения в плазме крови, эффективным уровнем экспрессии, элиминированной цитотоксичностью и сниженной иммуногенностью (US 8586048 В2). В данном отношении hy-Fc-слитый G-CSF является уникальной и оригинальной молекулой, где Fc-часть сама по себе представляет собой слияние двух молекул иммуноглобулина, и при этом эта первая слитая молекула является дополнительно слитой с активной молекулой. Поскольку данная структура требует внимания в отношении стабильности как части слитого Fc, так и G-CSF-части, то она отличается от других обычных Fc-слитых лекарственных средств и требует дополнительных отличающихся и уникальных растворов для обеспечения ее стабильности. В данном отношении для целей настоящего изобретения проводили изучение литературы, касающейся стабильности обычных Fc-слитых белков, однако само по себе настоящее изобретение было создано в соответствии с конкретными потребностями в отношении этого уникального hy-Fc-слитого G-CSF (US 8586048 В2).- 1 045982 yes, if the nucleotide encoding the polypeptide of the Fc fusion protein is expressed. Thus, G-CSF fused to a hybrid Fc (hyFc) is also characterized by a longer plasma half-life, effective expression level, eliminated cytotoxicity and reduced immunogenicity (US 8586048 B2). In this regard, the hy-Fc fusion G-CSF is a unique and original molecule, where the Fc portion itself is a fusion of two immunoglobulin molecules, and wherein this first fusion molecule is further fused to an active molecule. Since this structure requires attention to the stability of both the Fc fusion portion and the G-CSF portion, it is different from other conventional Fc fusion drugs and requires additional different and unique solutions to ensure its stability. In this regard, for the purposes of the present invention, the literature regarding the stability of conventional Fc fusion proteins was examined, but the present invention itself was made in accordance with the specific needs of this unique hy-Fc fusion G-CSF (US 8586048 B2).
В более ранней заявке на патент согласно РСТ, PCT/TR2018/050208, описан способ получения стабильного жидкого состава на основе G-CSF, слитого с гибридным Fc. Жидкая форма для введения характеризуется, в частности, содержанием G-CSF, слитого с гибридным Fc, с рН в диапазоне от 3,8 до 6,5, предпочтительно от 4,0 до 4,6.An earlier PCT patent application, PCT/TR2018/050208, describes a method for preparing a stable liquid formulation based on G-CSF fused with a hybrid Fc. The liquid administration form is characterized in particular by containing G-CSF fused to a hybrid Fc, with a pH ranging from 3.8 to 6.5, preferably from 4.0 to 4.6.
В настоящем изобретении был разработан и продемонстрирован на примерах стабильный лиофилизированный состав на основе hy-Fc-слитого G-CSF, описанного в US 8586048 B2.The present invention has developed and exemplified a stable lyophilized formulation based on the hy-Fc-fusion G-CSF described in US 8586048 B2.
Описание задачиDescription of the task
Было продемонстрировано, что многие Fc-слитые белки характеризуются нестабильностью в жидких составах. В то время как диапазон агрегации для жидких составов на основе рекомбинантных антител составляет 0,1-1% в год, агрегация Fc-слитых белков в жидких составах составляет 1-10% в год. Как показано Cao et al., в присутствии воды на стабильность Fc-слитых белков оказывалось значительное влияние, и при этом происходила химическая деградация (Cao, W. et al., Formulation, Drug Product, and Delivery: Considerations for Fc-Fusion Proteins. In Therapeutic Fc-Fusion Proteins (eds S. M. Chamow, T. Ryll, H. B. bowman and D. Farson), 2013).It has been demonstrated that many Fc fusion proteins are unstable in liquid formulations. While the aggregation range for liquid formulations based on recombinant antibodies is 0.1-1% per year, the aggregation of Fc-fusion proteins in liquid formulations is 1-10% per year. As shown by Cao et al., in the presence of water, the stability of Fc-fusion proteins was significantly affected and chemical degradation occurred (Cao, W. et al., Formulation, Drug Product, and Delivery: Considerations for Fc-Fusion Proteins. In Therapeutic Fc-Fusion Proteins (eds S. M. Chamow, T. Ryll, H. B. bowman and D. Farson), 2013).
В исследованиях стабильности, как и другие Fc-слитые белки, hy-Fc-слитый G-CSF также продемонстрировал более низкую стабильность в некоторых условиях по сравнению с рекомбинантными антителами, присутствующими в неслитой форме. В дополнение, структура hy-Fc-слитого G-CSF отличается от структуры других обычных Fc-гибридов. В частности, другие обычные Fc-платформы часто содержат Fc-область IgG2 или аналогичных иммуноглобулинов, и при этом лекарственное средство является непосредственно слитым с этой одной Fc-областью иммуноглобулина. Однако hy-Fc-платформа (ЕР 20080766022, US 8586038 B2) представляет собой комбинацию подклассов IgD и IgG, где сама по себе Fc-часть иммуноглобулина представляет собой слитую структуру, и слияние лекарственного средства с этой иммуноглобулиновой частью образует вторую слитую структуру. В данном отношении оригинальная уникальная молекула hy-Fc-G-CSF требует внимания в отношении стабильности как слитой структуры Fc-части, так и G-CSF-части, а следовательно, необходимы дополнительные различные и уникальные решения для сохранения ее стабильности. В рамках этого, хотя для жидкого состава на основе hy-Fcслитого G-CSF могут быть определены подходящие условия (PCT/TR2018/050208), было также решено обратиться ко второй форме состава, а именно, лиофилизированной форме, с целью достижения увеличения срока годности и облегчения хранения и распространения продукта по всему миру.In stability studies, like other Fc fusion proteins, the hy-Fc fusion G-CSF also demonstrated lower stability under some conditions compared to recombinant antibodies present in unfused form. In addition, the structure of the hy-Fc fusion G-CSF is different from that of other conventional Fc hybrids. In particular, other conventional Fc platforms often contain the Fc region of IgG2 or similar immunoglobulins, and the drug is directly fused to that one Fc region of the immunoglobulin. However, the hy-Fc platform (EP 20080766022, US 8586038 B2) is a combination of IgD and IgG subclasses, where the Fc part of the immunoglobulin itself is a fusion structure, and the fusion of the drug with this immunoglobulin part forms a second fusion structure. In this regard, the original unique hy-Fc-G-CSF molecule requires attention regarding the stability of both the fusion structure of the Fc part and the G-CSF part, and therefore additional different and unique solutions are required to maintain its stability. As part of this, although suitable conditions could be identified for a liquid formulation based on hy-Fc-fused G-CSF (PCT/TR2018/050208), it was also decided to turn to a second form of formulation, namely a lyophilized form, in order to achieve increased shelf life and facilitating product storage and distribution throughout the world.
Описание изобретенияDescription of the invention
Настоящее изобретение предусматривает стабильный лиофилизированный фармацевтический состав, полученный посредством лиофилизации водного препарата, содержащего (i) по меньшей мере 10 мг/мл G-CSF, слитого с гибридным Fc; (ii) по меньшей мере одно стабилизирующее средство в виде комбинации трегалозы и сорбита, где весовое соотношение трегалозы и сорбита составляет от 2:1 до 4:1; (iii) по меньшей мере одно неионогенное поверхностно-активное вещество на основе полоксамера; и (iv) ацетатный буфер; где значение рН водного препарата составляет от 3,8 до 5,2.The present invention provides a stable lyophilized pharmaceutical composition obtained by lyophilizing an aqueous preparation containing (i) at least 10 mg/ml G-CSF fused to a hybrid Fc; (ii) at least one stabilizing agent in the form of a combination of trehalose and sorbitol, where the weight ratio of trehalose and sorbitol is from 2:1 to 4:1; (iii) at least one poloxamer-based nonionic surfactant; and (iv) acetate buffer; where the pH value of the aqueous preparation is from 3.8 to 5.2.
В предпочтительном варианте осуществления значение рН водного препарата составляет от 4 до 5.In a preferred embodiment, the pH value of the aqueous preparation is between 4 and 5.
В еще одном предпочтительном варианте осуществления концентрация трегалозы в водном препарате составляет от 5,0 до 7,0% (вес./об.) в пересчете на общий объем водного препарата.In yet another preferred embodiment, the concentration of trehalose in the aqueous formulation is from 5.0 to 7.0% (w/v) based on the total volume of the aqueous formulation.
В еще одном предпочтительном варианте осуществления концентрация сорбита в водном препарате составляет от 1,5 до 2,5% (вес./об.) в пересчете на общий объем водного препарата.In yet another preferred embodiment, the concentration of sorbitol in the aqueous formulation is from 1.5 to 2.5% (w/v) based on the total volume of the aqueous formulation.
В еще одном предпочтительном варианте осуществления общая концентрация стабилизирующего средства составляет от 6,5 до 9,5% (вес./об.) в пересчете на общий объем водного препарата.In yet another preferred embodiment, the total concentration of the stabilizing agent is from 6.5 to 9.5% (w/v) based on the total volume of the aqueous formulation.
В еще одном предпочтительном варианте осуществления концентрация неионогенного поверхностно-активного вещества на основе полоксамера составляет от 0,08 до 0,15% (вес./об.) в пересчете на общий объем водного препарата.In yet another preferred embodiment, the concentration of the nonionic poloxamer surfactant is from 0.08 to 0.15% (w/v) based on the total volume of the aqueous formulation.
В еще одном предпочтительном варианте осуществления концентрация G-CSF, слитого с гибридным Fc, составляет от 10 до 80 мг/мл в пересчете на общий объем водного препарата.In yet another preferred embodiment, the concentration of G-CSF fused to the Fc fusion is from 10 to 80 mg/ml, based on the total volume of the aqueous formulation.
В еще одном предпочтительном варианте осуществления концентрация G-CSF, слитого с гибридIn yet another preferred embodiment, the concentration of G-CSF fused to the hybrid
- 2 045982 ным Fc, составляет от 20 до 40 мг/мл в пересчете на общий объем водного препарата.- 2 045982 num Fc, ranges from 20 to 40 mg/ml based on the total volume of the aqueous preparation.
В еще одном предпочтительном варианте осуществления водный препарат содержит:In yet another preferred embodiment, the aqueous preparation contains:
(i) G-CSF, слитый с гибридным Fc в концентрации 20 мг/мл;(i) G-CSF fused to Fc fusion at a concentration of 20 mg/ml;
(ii) комбинацию трегалозы и сорбита в качестве стабилизирующего средства, где трегалоза составляет от 5,0 до 7,0% (вес./об.) в пересчете на общий объем водного препарата, и сорбит составляет от 1,5 до 2,5% (вес./об.) в пересчете на общий объем водного препарата;(ii) a combination of trehalose and sorbitol as a stabilizing agent, wherein trehalose is from 5.0 to 7.0% (w/v) based on the total volume of the aqueous preparation, and sorbitol is from 1.5 to 2.5 % (w/v) based on the total volume of the aqueous preparation;
(iii) полоксамер 188 в качестве поверхностно-активного вещества в концентрации от 0,08 до 0,15% (вес./об.) в пересчете на общий объем водного препарата.(iii) Poloxamer 188 as a surfactant at a concentration of 0.08 to 0.15% (w/v) based on the total volume of the aqueous formulation.
Таким образом, целью настоящего изобретения является обеспечение лиофилизированной композиции, содержащей молекулы G-CSF пролонгированного действия, слитые посредством пептидной связи с подобной моноклональному антителу платформой в виде гибридного Fc (hy-Fc). Состав по настоящему изобретению, полученный посредством лиофилизации водного препарата на основе рекомбинантного GCSF-hyFc человека, должен характеризоваться особенно подходящим рН, стабилизирующими средствами и поверхностно-активным веществом, которые обеспечивают возможность лиофилизации hy-Fcслитого G-CSF и высокую стабильность.Thus, it is an object of the present invention to provide a lyophilized composition containing sustained release G-CSF molecules fused via peptide bond to a monoclonal antibody-like hybrid Fc (hy-Fc) platform. The composition of the present invention obtained by lyophilization of an aqueous preparation based on recombinant human GCSF-hyFc should be characterized by a particularly suitable pH, stabilizing agents and surfactant, which provide the ability to lyophilize the hy-Fc fusion G-CSF and high stability.
Стабильный состав или лекарственный продукт является таким, в котором содержащаяся молекула hy-Fc-слитого G-CSF по существу сохраняет свою биофизическую и химическую стабильность и целостность во время процесса лиофилизации и хранения. Стабильность составов на основе молекулы hyFc-слитого G-CSF можно измерять после восстановления лиофилизированного состава и воздействия на него различных температур в течение различных периодов времени. Изменение чистоты, биофизических свойств и эффективности молекулы Fc-слитого G-CSF является главным индикатором стабильности и, таким образом, их мониторинг должен осуществляться при выбранных температурах в определенные интервалы времени. В одном варианте осуществления в стабильном лиофилизированном составе на основе hy-Fc-слитого G-CSF может сохраняться более чем приблизительно 95% hy-Fc-слитого G-CSF после хранения при 2-8°C, 25°C-60% RH, 30°C-65% RH и 40°C-75% RH в течение 3 месяцев.A stable formulation or drug product is one in which the contained hy-Fc-fused G-CSF molecule substantially retains its biophysical and chemical stability and integrity during the lyophilization and storage process. The stability of hyFc-fusion G-CSF formulations can be measured after reconstituting the lyophilized formulation and exposing it to different temperatures for different periods of time. Changes in the purity, biophysical properties and potency of the Fc-fused G-CSF molecule are the main indicator of stability and thus should be monitored at selected temperatures at specific time intervals. In one embodiment, a stable hy-Fc-fusion G-CSF lyophilized formulation may retain more than about 95% of the hy-Fc-fusion G-CSF after storage at 2-8°C, 25°C-60% RH, 30°C-65% RH and 40°C-75% RH for 3 months.
Термин препарат относится к полученному водному составу перед лиофилизацией. Затем препарат, который содержит терапевтически эффективное количество G-CSF, слитого с гибридным Fc, по меньшей мере одно стабилизирующее средство, по меньшей мере одно поверхностно-активное вещество и буферную систему, используемую для регулирования рН раствора, подвергали лиофилизации с получением лиофилизированной фармацевтической композиции на основе G-CSF, слитого с гибридным Fc.The term drug refers to the resulting aqueous formulation before lyophilization. The formulation, which contains a therapeutically effective amount of G-CSF fused to a hybrid Fc, at least one stabilizing agent, at least one surfactant, and a buffer system used to adjust the pH of the solution is then lyophilized to obtain a lyophilized pharmaceutical composition at based on G-CSF fused with a hybrid Fc.
Термин терапевтически эффективное количество относится к количеству, которое при введении живому субъекту оказывает требуемый эффект в отношении живого субъекта. Как правило, терапевтически эффективное количество G-CSF (документ Neulasta EMA, Европейского агентства лекарственных средств) составляет 6 мг на одну процедуру применения. Для обеспечения такого же терапевтического эффекта концентрация стабильной формы G-CSF, слитого с гибридным Fc, в настоящем изобретении составляет по меньшей мере 10 мг/мл, в частности от примерно 10 до 80 мг/мл и предпочтительно от примерно 20 до 40 мг/мл.The term therapeutically effective amount refers to an amount that, when administered to a living subject, produces the desired effect in the living subject. Typically, the therapeutically effective amount of G-CSF (Neulasta EMA document, European Medicines Agency) is 6 mg per application. To provide the same therapeutic effect, the concentration of the stable form of G-CSF fused to the hybrid Fc in the present invention is at least 10 mg/ml, in particular from about 10 to 80 mg/ml and preferably from about 20 to 40 mg/ml .
Термин буферная система относится к одному или более компонентам, которые при добавлении к водному раствору способны защищать раствор от варьирования значений рН при добавлении кислоты или щелочи или при разбавлении с помощью растворителя. Таким образом, буферный раствор играет важную роль в стабилизации hy-Fc-G-CSF перед лиофилизацией и после восстановления. Можно использовать буферную систему, выбранную из группы, состоящей из цитратного, цитрат-фосфатного, аланинового, глицинового, аргининового, ацетатного, сукцинатного, гистидинового буфера по отдельности или их комбинации. В настоящем изобретении выбрана буферная система, содержащая ацетат натрия и уксусную кислоту/гидроксид натрия. В частности, можно использовать тригидрат ацетата натрия.The term buffer system refers to one or more components that, when added to an aqueous solution, are capable of protecting the solution from variations in pH values when an acid or alkali is added or when diluted with a solvent. Thus, the buffer solution plays an important role in stabilizing hy-Fc-G-CSF before lyophilization and after reconstitution. A buffer system selected from the group consisting of citrate, citrate phosphate, alanine, glycine, arginine, acetate, succinate, histidine buffers alone or a combination thereof may be used. In the present invention, a buffer system containing sodium acetate and acetic acid/sodium hydroxide is selected. In particular, sodium acetate trihydrate can be used.
Стабилизирующее средство способствует стабильности компонентов полипептида, сохраняя тем самым их терапевтическую эффективность во время процесса лиофилизации и хранения. В настоящем изобретении в состав также можно включать сахара, такие как глюкоза, трегалоза, сахароза или сахарные спирты, такие как маннит, сорбит и ксилит. В пересчете на общий объем восстановленного состава концентрация сахара или сахарного спирта предпочтительно составляет от приблизительно 1,0 до примерно 15,0% (вес./об.). В настоящем изобретении стабилизирующие средства представляют собой комбинацию трегалозы и сорбита, где весовое соотношение трегалозы и сорбита составляет от 2:1 до 4:1, и общая концентрация стабилизирующего средства составляет от 6,5 до 9,5% (вес./об.). Можно использовать гидрат трегалозы. Примером гидрата трегалозы может служить дигидрат трегалозы.The stabilizing agent promotes the stability of the polypeptide components, thereby maintaining their therapeutic effectiveness during the lyophilization process and storage. In the present invention, sugars such as glucose, trehalose, sucrose or sugar alcohols such as mannitol, sorbitol and xylitol can also be included in the composition. Based on the total volume of the reconstituted composition, the concentration of sugar or sugar alcohol is preferably from about 1.0 to about 15.0% (w/v). In the present invention, the stabilizing agents are a combination of trehalose and sorbitol, where the weight ratio of trehalose and sorbitol is from 2:1 to 4:1, and the total concentration of the stabilizing agent is from 6.5 to 9.5% (w/v). . Trehalose hydrate can be used. An example of trehalose hydrate is trehalose dihydrate.
Поверхностно-активное вещество представляет собой поверхностно-активную молекулу, содержащую как гидрофобную часть (например, алкильную цепь), так и гидрофильную часть (например, карбоксильную и карбоксилатную группы). Для предупреждения поверхностной денатурации и агрегации во время лиофилизации в составах на основе белка обычно используются неионогенные поверхностноактивные вещества (Cao, W. et al, Formulation, Drug Product, and Delivery: Considerations for Fc-Fusion Proteins. In Therapeutic Fc-Fusion Proteins (eds S. M. Chamow, T. Ryll, H. B. bowman and D. Farson), 2013). В настоящем изобретении неионогенное поверхностно-активное вещество на основе полоксамера используется в концентрации от 0,08 до 0,15% (вес./об.) в пересчете на общий объем состава.A surfactant is a surfactant molecule containing both a hydrophobic portion (eg, an alkyl chain) and a hydrophilic portion (eg, carboxyl and carboxylate groups). Nonionic surfactants are commonly used in protein formulations to prevent surface denaturation and aggregation during lyophilization (Cao, W. et al, Formulation, Drug Product, and Delivery: Considerations for Fc-Fusion Proteins. In Therapeutic Fc-Fusion Proteins (eds S. M. Chamow, T. Ryll, H. B. bowman and D. Farson), 2013). In the present invention, the poloxamer-based nonionic surfactant is used at a concentration of 0.08 to 0.15% (w/v) based on the total volume of the formulation.
- 3 045982- 3 045982
Все изобретения, раскрытые в данном документе, являются полностью специфическими в отношении описанного лекарственного средства на основе hy-Fc-G-CSF и разрабатывались с учетом конкретных требований по обеспечению стабильности этой уникальной оригинальной молекулы (US 8586048 В2). Настоящее изобретение отличается от предыдущего уровня техники тем, что представляет собой белок G-CSF третьего поколения, а именно, G-CSF, слитый с гибридным Fc (hy-Fc-G-CSF).All inventions disclosed herein are entirely specific to the disclosed hy-Fc-G-CSF drug and have been developed to meet the specific stability requirements of this unique original molecule (US 8586048 B2). The present invention differs from the prior art in that it is a third generation G-CSF protein, namely G-CSF fused to a hybrid Fc (hy-Fc-G-CSF).
Структура hy-Fc-G-CSF отличается как от ранее известных молекул G-CSF (филграстим и пэгфилграстим), так и от других Fc-слитых белков и моноклональных антител (mAb или MoAb). Принимая во внимание его отличающуюся структуру, ему требуются отличающиеся от предыдущих растворы для обеспечения его стабильности за счет надлежащего состава. Во-первых, hy-Fc-G-CSF содержит два неприродных участка соединения между IgD, IgG и G-CSF, в отличие от mAb или обычных гибридов Fc. Участки соединения hy-Fc-G-CSF представляют собой новые уязвимые участки, вызывающие нестабильность молекулы. Таким образом, растворы для конкретных составов на основе mAb или обычных Fc не предоставляют приемлемых решений для получения составов на основе hy-Fc-G-CSF.The structure of hy-Fc-G-CSF differs from both previously known G-CSF molecules (filgrastim and pegfilgrastim) and from other Fc fusion proteins and monoclonal antibodies (mAbs or MoAbs). Given its different structure, it requires different solutions to ensure its stability through proper composition. First, hy-Fc-G-CSF contains two unnatural junction sites between IgD, IgG and G-CSF, unlike mAbs or conventional Fc hybrids. The hy-Fc-G-CSF junction sites represent new vulnerable sites that cause instability of the molecule. Thus, solutions for specific mAb or conventional Fc formulations do not provide viable solutions for the preparation of hy-Fc-G-CSF formulations.
Во-вторых, поскольку hy-Fc-G-CSF представляет собой гибрид трех вышеупомянутых различных частей, то все они требуют отдельной поддержки в отношении их собственной стабильности. Следует обращать внимание как на стабильность Fc-части, происходящей из IgG и IgD, так и отдельно на стабильность G-CSF-части. Эти различные части требуют различных условий для поддержания стабильности, что создает более сложную проблему, требующую решения. Одним из примеров может являться возможность использования очень узкого диапазона рН, как указано в поданной заявке.Secondly, since hy-Fc-G-CSF is a hybrid of the above three different parts, they all require separate support regarding their own stability. Attention should be paid to both the stability of the Fc part derived from IgG and IgD, and separately to the stability of the G-CSF part. These different parts require different conditions to maintain stability, which creates a more complex problem to solve. One example would be the ability to use a very narrow pH range, as specified in the application.
В-третьих, обычные Fc-слитые структуры и hy-Fc-G-CSF отличаются еще в одном отношении. Обычные Fc-слитые структуры получают за две стадии, и они содержат по меньшей мере одно перекрестносшивающее химическое средство. На первой стадии Fc и активную молекулу получают с помощью генной инженерии, но отдельно, из двух отдельных генетических кодов. Затем на второй стадии две части конъюгируют химическими способами с использованием перекрестносшивающего средства. Напротив, hy-Fc-G-CSF получают непосредственно в ходе всего одной стадии получения с помощью генной инженерии с использованием одного единого теоретически слитого генетического кода. Что гораздо важнее, в его структуре отсутствуют и какие-либо небелковые соединения, и какие-либо химические перекрестносшивающие средства, как у обычных Fc-слитых белков. Эти важные структурные различия между hy-Fc-G-CSF и обычными Fc-слитыми структурами создают потребность в различных стабилизирующих условиях.Third, conventional Fc fusion structures and hy-Fc-G-CSF differ in yet another respect. Conventional Fc-fusion structures are prepared in two steps and contain at least one cross-linking chemical. In the first step, the Fc and the active molecule are genetically engineered, but separately, from two separate genetic codes. Then, in a second step, the two parts are conjugated chemically using a cross-linker. In contrast, hy-Fc-G-CSF is produced directly in just one step of genetic engineering using a single theoretically fused genetic code. More importantly, its structure does not contain any non-protein compounds and any chemical cross-linking agents, like conventional Fc-fusion proteins. These important structural differences between hy-Fc-G-CSF and conventional Fc-fusion structures create the need for different stabilizing conditions.
В целом, поскольку hy-Fc-G-CSF структурно полностью отличается от других G-CSF, mAb или обычных Fc-гибридов, то требуется совершенно иной подход для разработки состава на его основе, приемлемого для стабильности этой отличающейся структуры.In general, since hy-Fc-G-CSF is structurally completely different from other G-CSFs, mAbs or conventional Fc hybrids, a completely different approach is required to develop a composition based on it that is suitable for the stability of this different structure.
Отличия от других молекул G-CSF объясняются следующим образом.The differences from other G-CSF molecules are explained as follows.
G-CSF первого поколения: филграстим (нейпоген®) состоит только из бактериального G-CSF без каких-либо модификаций, что обусловливает его более быстрое выведение из сыворотки крови.First generation G-CSF: Filgrastim (Neupogen®) consists of only bacterial G-CSF without any modifications, resulting in faster clearance from serum.
Единственная структура G-CSF нейпогена является значительно меньшей, и ее легче получать в составе по сравнению с hy-Fc-G-CSF.Neupogen's single G-CSF structure is significantly smaller and easier to formulate compared to hy-Fc-G-CSF.
G-CSF второго поколения: пэгфилграстим (НЕУЛАСТА®) содержит пегилированный G-CSF, а следовательно характеризуется сравнительно более продолжительным периодом полувыведения. Напротив, известно, что PEG может характеризоваться некоторыми побочными эффектами, а пегилирование вводит дополнительную стадию в ходе получения. В структурном отношении присоединение PEG или hy-Fc к G-CSF, в свою очередь, создает очень разные структуры.Second generation G-CSF: pegfilgrastim (NEULASTA®) contains pegylated G-CSF and therefore has a comparatively longer half-life. On the contrary, it is known that PEG may have some side effects, and PEGylation introduces an additional step during preparation. Structurally, the addition of PEG or hy-Fc to G-CSF in turn creates very different structures.
G-CSF третьего поколения: G-CSF, слитый с гибридным Fc (Hy-Fc-G-CSF), молекула, используемая в настоящем изобретении, представляет собой G-CSF третьего поколения, поскольку является гибридом 3 отдельных молекулярных соединений, а именно, IgD, IgG и G-CSF, составленных вместе с помощью генной инженерии. Как слияние IgD и IgG, так и связывание G-CSF осуществляются посредством транскрипции и трансляции одного единого генетического кода, состоящего из генетических кодов трех этих структур. Формула генетического кода ранее была защищена патентом US 8586048 В2. Эту структуру с более высокой молекулярной массой труднее стабилизировать по сравнению с филграстимом и пэгфилграстимом. Таким образом, для разработки состава на основе hy-Fc-G-CSF требуются различные условия и комбинации.Third Generation G-CSF: G-CSF fused to a hybrid Fc (Hy-Fc-G-CSF), the molecule used in the present invention is a third generation G-CSF as it is a hybrid of 3 separate molecular entities viz. IgD, IgG and G-CSF, genetically engineered together. Both the fusion of IgD and IgG and the binding of G-CSF are accomplished through the transcription and translation of one single genetic code, consisting of the genetic codes of these three structures. The genetic code formula was previously protected by patent US 8586048 B2. This higher molecular weight structure is more difficult to stabilize compared to filgrastim and pegfilgrastim. Thus, various conditions and combinations are required to develop a hy-Fc-G-CSF formulation.
Отличия от других Fc-гибридов включают один единый Fc-домен из одной единой молекулы Ig. В таких структурах гибрид означает связывание Fc из Ig с активным ингредиентом. Однако Fc-часть структуры Hy-Fc-G-CSF, называемая гибридным Fc, образована двумя разными молекулами Ig, а именно, IgD и IgG. G-CSF связан с этой структурой гибридного Fc. Таким образом, в случае hy-Fc-G-CSF термин гибрид означает два разных связывания, где первое представляет собой связывание IgD и IgG с образованием платформы hy-Fc, а второе представляет собой связывание G-CSF с этой платформой hyFc.Differences from other Fc hybrids include one single Fc domain from one single Ig molecule. In such structures, hybrid means the binding of Fc from Ig to the active ingredient. However, the Fc portion of the Hy-Fc-G-CSF structure, called hybrid Fc, is formed by two different Ig molecules, namely, IgD and IgG. G-CSF is associated with this hybrid Fc structure. Thus, in the case of hy-Fc-G-CSF, the term hybrid means two different bindings, where the first is the binding of IgD and IgG to form the hy-Fc platform, and the second is the binding of G-CSF to this hyFc platform.
Во-вторых, в отличие от других обычных Fc-гибридов, которые содержат перекрестносшивающие средства для слияния Fc с активными молекулами, hy-Fc-G-CSF не содержит какого-либо перекрестносSecond, unlike other conventional Fc hybrids, which contain cross-linking agents to fuse the Fc with active molecules, hy-Fc-G-CSF does not contain any cross-linking agents.
- 4 045982 шивающего средства. Слияние обычных F c-слитых лекарственных средств осуществляют путем получения Fc и активной молекулы в отдельности и выполнения химического слияния после получения в качестве второй стадии. Однако слияние hy-Fc-G-CSF осуществляют с помощью генной инженерии, путем транскрипции и трансляции единого генетического кода, и при этом в структуре не используется перекрестносшивающее средство. Этот генетический код предварительно теоретически получен и защищен упомянутым патентом US 8586048 В2.- 4 045982 sewing agent. Fusion of conventional Fc-fusion drugs is carried out by preparing the Fc and the active molecule separately and performing chemical fusion after preparation as a second step. However, the hy-Fc-G-CSF fusion is carried out using genetic engineering, by transcription and translation of a single genetic code, and does not use a cross-linker in the structure. This genetic code is previously theoretically obtained and protected by the mentioned patent US 8586048 B2.
Как впервые указано в патенте US 8586048 В2, G-CSF, слитый с гибридным Fc (hy-Fc-G-CSF), представлен следующей формулой (I), формула (I)As first disclosed in US Pat. No. 8,586,048 B2, G-CSF fused to a hybrid Fc (hy-Fc-G-CSF) is represented by the following formula (I), formula (I)
N'-G-Y-Z2-Z3-Z4-C, где G представляет собой G-CSF;N'-G-Y-Z2-Z3-Z4-C, where G represents G-CSF;
N' представляет собой N-конец полипептида, и С' представляет собой С-конец полипептида;N' represents the N-terminus of the polypeptide, and C' represents the C-terminus of the polypeptide;
Y представляет собой аминокислотную последовательность, содержащую 5 до 64 последовательных аминокислотных остатков от аминокислотного остатка в положении 162 в направлении N-конца, выбранных из аминокислотных остатков в положениях от 99 до 162 в SEQ ID NO: 2;Y is an amino acid sequence containing 5 to 64 consecutive amino acid residues from the amino acid residue at position 162 towards the N-terminus, selected from amino acid residues at positions 99 to 162 in SEQ ID NO: 2;
Z2 представляет собой аминокислотную последовательность, содержащую от 4 до 37 последовательных аминокислотных остатков от аминокислотного остатка в положении 163 в направлении С-конца, выбранных из аминокислотных остатков в положениях от 163 до 199 в SEQ ID NO: 2;Z2 is an amino acid sequence containing from 4 to 37 consecutive amino acid residues from the amino acid residue at position 163 towards the C-terminus, selected from the amino acid residues at positions 163 to 199 in SEQ ID NO: 2;
Z3 представляет собой аминокислотную последовательность, содержащую от 71 до 106 последовательных аминокислотных остатков от аминокислотного остатка в положении 220 в направлении Nконца, выбранных из аминокислотных остатков в положениях от 115 до 220 в SEQ ID NO: 3; иZ3 is an amino acid sequence containing from 71 to 106 consecutive amino acid residues from the amino acid residue at position 220 towards the N terminus, selected from the amino acid residues at positions 115 to 220 in SEQ ID NO: 3; And
Z4 представляет собой аминокислотную последовательность, содержащую от 80 до 107 последовательных аминокислотных остатков от аминокислотного остатка в положении 221 в направлении С-конца, выбранных из аминокислотных остатков в положениях от 221 до 327 в SEQ ID NO: 3.Z4 is an amino acid sequence containing from 80 to 107 consecutive amino acid residues from amino acid residue at position 221 towards the C-terminus, selected from amino acid residues at positions 221 to 327 in SEQ ID NO: 3.
В данном отношении hyFc-слитый G-CSF является уникальной и оригинальной молекулой, где Fcчасть сама по себе представляет собой слияние двух молекул иммуноглобулина, и при этом эта первая слитая молекула является дополнительно слитой с активной молекулой.In this regard, the hyFc-fusion G-CSF is a unique and original molecule, where the Fc moiety itself is a fusion of two immunoglobulin molecules, and wherein this first fusion molecule is further fused to an active molecule.
В настоящем изобретении использовали hy-Fc-платформу и G-CSF, имеющих аминокислотную последовательность из гуманизированных организмов. Дополнительная реакция слияния не использовалась, так как слияния между IgD и IgG и между G-CSF и иммуноглобулиновой частью обеспечивались посредством единого генетического кода и единой реакции транскрипции-трансляции. Пептидная связь между G-CSF и hy-Fc-платформой образована между пролином и аргинином. Аминокислотная последовательность мономера hy-Fc-слитого G-CSF представлена ниже. Сигнальная, G-CSF, N-концевая последовательность и последовательность hy-Fc указаны в соответствующем формате. Схематическое изображение белковой структуры hy-Fc-слитого G-CSF представлено на фиг. 1. Гибридный Fc, используемый для связывания с G-CSF, получают из комбинации частей IgD и IgG человека. В этой структуре (фиг. 1) (i) часть IgD человека (шарнир IgD и N-концевой СН2), которая не вызывает ответа ADCC, использовали для устранения цитотоксичности, и (ii) в случае IgG4 использовали часть, которая также устраняет цитотоксичность, поскольку не вызывает ответа CDC. Та же самая часть обладает сильной способностью связываться с FcRn, обеспечивая тем самым длительный период полувыведения за счет циркулирования молекулы посредством связывания с FcRn, и характеризуется 21-дневным периодом циркулирования в сыворотке крови человека.The present invention used a hy-Fc platform and G-CSF having an amino acid sequence from humanized organisms. An additional fusion reaction was not used because fusions between IgD and IgG and between G-CSF and the immunoglobulin moiety were achieved through a single genetic code and a single transcription-translation reaction. The peptide bond between G-CSF and the hy-Fc platform is formed between proline and arginine. The amino acid sequence of the hy-Fc-fusion G-CSF monomer is shown below. The signal, G-CSF, N-terminal and hy-Fc sequences are indicated in the appropriate format. A schematic representation of the protein structure of the hy-Fc fusion G-CSF is shown in FIG. 1. The hybrid Fc used to bind to G-CSF is derived from a combination of human IgD and IgG parts. In this structure (Fig. 1), (i) the portion of human IgD (IgD hinge and N-terminal CH2) that does not induce the ADCC response was used to eliminate cytotoxicity, and (ii) in the case of IgG4, the portion that also eliminates cytotoxicity was used. because it does not trigger a CDC response. The same moiety has a strong ability to bind to FcRn, thereby providing a long half-life due to the circulation of the molecule through binding to FcRn, and has a 21-day circulation period in human serum.
MAGPATQSPMKL^LQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGMAGPATQSPMKL^LQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQG
DGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGL FLYQGLLQALEGISPELGPILDTLQLDVADFATHWQQ^EELGMAPALQPTQGAMP AFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP^TGRGGEEKKKEKEKEEQ EERETKTPECPSHTQPLGVFLFPPKPKDTL^ISRTPEVTCWVDVSQEDPEVQFNWY WGYEVHNAKT^REE^NSTyRWSVLTVLHQDWLNGKEYKCKVSKKGL^SIEK nSKAKGQPREPQVYTLPPSQEEMTKHQVSLTCLVKGFYPS^AVEWESfiGQPE^^ YKTTPPVWSDGSFFL¥SRLTVDKSRWQEGNVFSCS¥/V?HEALHNHYTQKSLSLSLG КDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGL FLYQGLLQALEGISPELGPILDTLQLDVADFATHWQQ^EELGMAPALQPTQGAMP AFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP^TGRGGEEKKKEKEKEEQ EERETKTPECPSHTQPLGVFLFPPKPK DTL^ISRTPEVTCWVDVSQEDPEVQFNWY WGYEVHNAKT^REE^NSTyRWSVLTVLHQDWLNGKEYKCKVSKKGL^SIEK nSKAKGQPREPQVYTLPPSQEEMTKHQVSLTCLVKGFYPS^AVEWESfiGQPE^^ YKTTPPVWSDGSFFL¥SRLTVDKSRWQEGNVFSCS¥/ V?HEALHNHYTQKSLSLSLG K
В целом гибридный Fc, в случае если он присоединен к биологически активной молекуле, является эффективным в отношении увеличения периода полувыведения биологически активной молекулы из сыворотки крови, а также повышения уровня экспрессии полипептида, в случае если экспрессируется нуклеотид, кодирующий полипептид Fc-слитого белка. Таким образом, G-CSF, слитый с гибридным Fc (hyFc), также характеризуется более продолжительным периодом полувыведения в плазме крови, эффективным уровнем экспрессии, элиминированной цитотоксичностью и сниженной иммуногенностью (US 8586048 В2).In general, the Fc fusion, when attached to a biologically active molecule, is effective in increasing the serum half-life of the biologically active molecule, as well as increasing the expression level of the polypeptide when a nucleotide encoding the polypeptide of the Fc fusion protein is expressed. Thus, G-CSF fused to a hybrid Fc (hyFc) is also characterized by a longer plasma half-life, effective expression level, eliminated cytotoxicity and reduced immunogenicity (US 8586048 B2).
- 5 045982- 5 045982
В настоящем изобретении было обнаружено преимущественное влияние на стабильность молекулы гидролиза при более низких значениях рН (рН < 5,0) в участке соединения с G-CSF и перетасовки дисульфидных связей при высоких значениях рН (рН > 6,5), а также наличие у молекулы склонности к ним. G-CSF содержит две дисульфидные связи, образованные гомологичными цистеиновыми остатками, и дополнительный цистеиновый остаток в положении 17, который не может участвовать в формировании внутримолекулярных дисульфидных связей. Дисульфидные связи в этих молекулах стабилизируют структуры и делают их устойчивыми к относительно агрессивному воздействию (некоторые протеазы, высокие температуры, денатурирующие растворители, экстремальный рН), которые приводят к денатурации после уменьшения количества дисульфидных связей (Nicos A. Nicola, The waiter and Eliza Hall Institute of Medical Research, Granulocyte Colony Stimulating Factor, p. 77-100).In the present invention, the stability of the molecule was found to be preferentially influenced by hydrolysis at lower pH values (pH < 5.0) at the G-CSF binding site and disulfide bond shuffling at high pH values (pH > 6.5), as well as the presence of molecules of susceptibility to them. G-CSF contains two disulfide bonds formed by homologous cysteine residues and an additional cysteine residue at position 17, which cannot participate in the formation of intramolecular disulfide bonds. The disulfide bonds in these molecules stabilize the structures and make them resistant to relatively aggressive conditions (some proteases, high temperatures, denaturing solvents, extreme pH) that lead to denaturation after the number of disulfide bonds is reduced (Nicos A. Nicola, The waiter and Eliza Hall Institute of Medical Research, Granulocyte Colony Stimulating Factor, pp. 77-100).
Дополнительно, собственные исследования показали, что hy-Fc-слитый G-CSF является нерастворимым или труднорастворимым при рН от 5,3 до 6,0, и известно, что G-CSF сам по себе является стабильным и активным при рН около 4,0 (Т. Arakawa, S.J. Prestrelski, L.O. Narhi, T.C. Boone, W.C. Kenney, Cysteine 17 of recombinant human granulocyte-colony stimulating factor is partially solvent-exposed, J. Protein Chem. 12 (1993) 525-531).Additionally, proprietary studies have shown that hy-Fc-fused G-CSF is insoluble or sparingly soluble at pH 5.3 to 6.0, and G-CSF itself is known to be stable and active at pH around 4.0 (T. Arakawa, S.J. Prestrelski, L.O. Narhi, T.C. Boone, W.C. Kenney, Cysteine 17 of recombinant human granulocyte-colony stimulating factor is partially solvent-exposed, J. Protein Chem. 12 (1993) 525-531).
Способы выбора оптимальных составов на основе Fc-слитого G-CSF по настоящему изобретению.Methods for selecting optimal Fc-fusion G-CSF formulations of the present invention.
Значение рН водного препарата перед лиофилизацией и водной фармацевтической композиции, полученной путем восстановлением лиофилизированного сухого порошка, можно определить с помощью потенциометрического анализа, описанного в статье <791> USP (фармакопеи США).The pH of the aqueous preparation before lyophilization and the aqueous pharmaceutical composition obtained by reconstituting the lyophilized dry powder can be determined using the potentiometric assay described in USP Article <791>.
Анализ посредством электрофореза в полиакриламидном геле с додецилсульфатом натрия (SDSPAGE) может быть проведен для hy-Fc-слитого G-CSF для сравнения его молекулярной массы с молекулярной массой собственного стандартного образца. Лекарственный продукт и собственный стандартный образец разбавляют до 500 мкг/мл с использованием деионизированной воды и доводят до 3 мкг/20 мкл с использованием буфера для образца NuPAGE® LDS (4X) и деионизированной воды. Его загружают в 12% Bis-Tris-гель NuPAGE® Novex 4 (1,0 мм, 10 лунок) для проведения электрофореза. Гельэлектрофорез с использованием изоэлектрического фокусирования может использоваться для идентификации диапазона изоэлектрических точек hy-Fc-слитого G-CSF по отношению к собственному стандартному образцу. Лекарственный продукт и собственный стандартный образец разбавляют до 1 мг/мл с использованием деионизированной воды и доводят до 10 мкг/20 мкл с использованием буфера для образца Novex® IEF (2X). Изоэлектрическое фокусирование осуществляют с использованием геля для IEF Novex® с рН 3-10 (1,0 мм, 10 лунок).Sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDSPAGE) analysis can be performed on the hy-Fc fusion G-CSF to compare its molecular weight with that of its own reference standard. The drug product and in-house reference standard are diluted to 500 µg/mL using deionized water and adjusted to 3 µg/20 µL using NuPAGE® LDS Sample Buffer (4X) and deionized water. It is loaded into NuPAGE® Novex 4 12% Bis-Tris gel (1.0 mm, 10 wells) for electrophoresis. Gel electrophoresis using isoelectric focusing can be used to identify the range of isoelectric points of hy-Fc-fused G-CSF relative to its own standard sample. The drug product and in-house reference standard are diluted to 1 mg/mL using deionized water and adjusted to 10 μg/20 μL using Novex® IEF sample buffer (2X). Isoelectric focusing is performed using Novex® IEF gel pH 3-10 (1.0 mm, 10 wells).
Выделение hy-Fc-слитого G-CSF и мониторинг его чистоты с точки зрения свойств мономерности и гидрофобности можно осуществлять с помощью методик жидкостной хроматографии.Isolation of hy-Fc-fused G-CSF and monitoring of its purity in terms of monomeric and hydrophobic properties can be accomplished using liquid chromatography techniques.
Таким образом, эксклюзионная хроматография по размеру (SE-HPLC) может являться предпочтительным способом разделения молекул на основании их размера на высокомолекулярные соединения (HMW) и подвергнувшиеся разрушению соединения с использованием Acquity Arc (Waters). Разделение осуществляется посредством дифференциальной молекулярной эксклюзии или инклюзии в то время, как молекулы мигрируют вдоль длины колонки. Лекарственное вещество разбавляют до 1 мг/мл и подвергают разделению с использованием колонки TSK-GEL G3000SWxL (7,8x300 мм) и предохранительной колонки TSK-GEL G3000SWxL (6x40 мм) (TOSOH Bioscience). Подвижная фаза состоит из 50 мМ фосфатного буфера: 5,34 г двухосновного фосфата натрия, 3,12 г одноосновного фосфата натрия, 8,76 г хлорида натрия в 1 л деионизированной воды, которые смешивают с ацетонитрилом в соотношении 9:1 (об./об.), в то время как конечный рН составляет 7,0. Скорость потока поддерживают при 0,5 мл/мин. и длину волны детектора 214 нм в течение 30 мин. Рассчитывают % долю площади основного пика по отношению к общей площади в соответствии с результатом анализа, где выход указывает на мономерную чистоту.Thus, size exclusion chromatography (SE-HPLC) may be a preferred method for separating molecules based on their size into high molecular weight (HMW) and degraded compounds using Acquity Arc (Waters). Separation is accomplished through differential molecular exclusion or inclusion as molecules migrate along the length of the column. The drug substance is diluted to 1 mg/mL and subjected to separation using a TSK-GEL G3000SWxL (7.8 x 300 mm) column and a TSK-GEL G3000SWxL (6 x 40 mm) guard column (TOSOH Bioscience). The mobile phase consists of 50 mM phosphate buffer: 5.34 g dibasic sodium phosphate, 3.12 g monobasic sodium phosphate, 8.76 g sodium chloride in 1 L of deionized water, which are mixed with acetonitrile in a ratio of 9:1 (v/v). vol.), while the final pH is 7.0. The flow rate is maintained at 0.5 ml/min. and detector wavelength 214 nm for 30 min. Calculate the % fraction of the main peak area relative to the total area according to the result of the analysis, where the yield indicates the monomeric purity.
Обращенно-фазовая высокоэффективная хроматография (RP-HPLC) может являться еще одним способом проверки чистоты посредством разделения их по гидрофобности. Для контроля примесей и времени удерживания вариантов Fc-слитого G-CSF и усеченных форм с использованием Acquity Arc (Waters) используют RP-HPLC. Лекарственное средство в концентрации, составляющей 1 мг/мл, в соответствующем буфере для состава подвергают разделению с использованием колонки Vydac 214TP С4 (4,6x250 мм) (Grace, Vydac) и предохранительной колонки 214MS С4, 5 мкм, 7,5x4,6 мм (Grace, Vydac). Подвижная фаза состоит из 0,15% трифторуксусной кислоты (TFA) в деионизированной воде и 0,15% TFA в ацетонитриле при скорости потока, составляющей 0,5 мл/мин. Длину волны выявления, составляющую 220 нм, поддерживают в течение 35 мин и осуществляют мониторинг % доли площади основного пика по отношению к общей площади в соответствии с результатом анализа.Reversed phase high performance chromatography (RP-HPLC) can be another way to test purity by separating them based on hydrophobicity. RP-HPLC was used to monitor impurities and retention times of G-CSF Fc-fusion variants and truncated forms using Acquity Arc (Waters). The drug at a concentration of 1 mg/ml in the appropriate formulation buffer is subjected to separation using a Vydac 214TP C4 column (4.6x250 mm) (Grace, Vydac) and a 214MS C4 guard column, 5 μm, 7.5x4.6 mm (Grace, Vydac). The mobile phase consists of 0.15% trifluoroacetic acid (TFA) in deionized water and 0.15% TFA in acetonitrile at a flow rate of 0.5 ml/min. The detection wavelength of 220 nm is maintained for 35 min and the % area fraction of the main peak relative to the total area is monitored according to the analysis result.
Остаточную влажность лиофилизированных продуктов определяют способом Карла-Фишера, описанным в статье <921> USP.The residual moisture content of lyophilized products is determined by the Karl-Fischer method described in USP article <921>.
Видимые частицы лиофилизированных продуктов определяются невооруженным глазом. Как указано в USP, водные лекарственные формы для инъекций должны являться по существу свободными от частиц, различимых невооруженным глазом.Visible particles of lyophilized products are visible to the naked eye. As specified in the USP, aqueous injectable dosage forms must be substantially free of particles visible to the naked eye.
- 6 045982- 6 045982
В следующих примерах описано настоящее изобретение, включающее лиофилизированный состав на основе полноразмерного hyFc-Fused G-CSF, описанного в US 8586048 B2.The following examples describe the present invention, including a lyophilized formulation based on full-length hyFc-Fused G-CSF, described in US 8586048 B2.
Предварительные исследованияPreliminary studies
Определение соответствующего стабилизирующего средства и буферной системыDetermination of the appropriate stabilizing agent and buffer system
В составах на основе Fc-слитых белков, составах с низким рН может встречаться протеолиз и дезамидирование, тогда как составы с высоким рН часто подвергаются агрегации, окислению и перегруппировке дисульфидных связей. (Cao, W., Piedmonte, D. М., Ricci, M. S., & Yeh, P. Y. (2013). Formulation, Drug Product, and Delivery: Considerations for Fc-Fusion Proteins. Therapeutic Fc-Fusion Proteins, 115-154.) В соответствии с данной информацией предварительные исследования начинали при низком рН, составляющем около 4,0.In Fc fusion protein formulations, low pH formulations may experience proteolysis and deamidation, while high pH formulations are often subject to aggregation, oxidation and disulfide bond rearrangement. Cao, W., Piedmonte, D. M., Ricci, M. S., & Yeh, P. Y. (2013). Formulation, Drug Product, and Delivery: Considerations for Fc-Fusion Proteins. Therapeutic Fc-Fusion Proteins, 115-154. ) According to this information, preliminary studies were started at a low pH of about 4.0.
В предварительных исследованиях вначале получали семь различных водных препаратов, содержащих hy-Fc-слитый G-CSF в качестве активного ингредиента, полоксамер 188 в качестве поверхностноактивного вещества в ацетатном буфере, имеющем рН приблизительно 4,0, с использованием различных стабилизирующих средств. Эти полученные водные препараты подвергали лиофилизации. После осуществления лиофилизации композиции анализировали в отношении внешнего вида лиофилизата, времени восстановления и рН (рН измеряли в восстановленных водных композициях). Внешний вид лиофилизата является важной характеристикой продуктов сублимационной сушки, которая может изменять качество продукта (прежде всего остаточную влажность, время восстановления, стабильность и активность), что впоследствии может повлиять на безопасность пациента и эффективность продукта. Время восстановления представляет собой промежуток времени, требуемый для регидратации лиофилизированного состава с помощью раствора до осветленного раствора, не содержащего частиц. В настоящем изобретении лиофилизированные составы восстанавливали с использованием 1 мл воды для инъекций.In preliminary studies, seven different aqueous formulations containing a hy-Fc fusion G-CSF as the active ingredient, poloxamer 188 as a surfactant were first prepared in an acetate buffer having a pH of approximately 4.0, using various stabilizing agents. These resulting aqueous preparations were lyophilized. After lyophilization, the compositions were analyzed with respect to the appearance of the lyophilisate, reconstitution time and pH (pH was measured in reconstituted aqueous compositions). The appearance of the lyophilisate is an important characteristic of freeze-dried products, which can change the quality of the product (primarily residual moisture, recovery time, stability and potency), which can subsequently affect patient safety and product effectiveness. The reconstitution time is the length of time required for the lyophilized formulation to be rehydrated by the solution to a clarified, particulate-free solution. In the present invention, lyophilized formulations were reconstituted using 1 ml of water for injection.
Таблица 1Table 1
Предварительные исследования для определения соответствующего стабилизирующего средстваPreliminary studies to determine the appropriate stabilizing agent
* Заметно невооруженным глазом.* Visible to the naked eye.
В соответствии с результатами оценки внешнего вида лиофилизата и времени восстановления составы 1-4 являются неприемлемыми для продукта лиофилизации. Также состав-5 продемонстрировал значительное увеличение агрегации, заметное невооруженным глазом после восстановления с использованием 1 мл воды для инъекций. Эти результаты можно объяснить сдвигом рН выше 5,2 в составе во время лиофилизации (обнаружено, что pl, при которой hyFc-слитый G-CSF является нерастворимым или труднорастворимым, соответствует рН 5,3-6,0) вследствие испарения уксусной кислоты. Также повышенный рН наблюдали в составах 6 и 7. Сдвиги рН были ограниченными в составе, содержащем сахарозу, в отличие от состава, содержащего только маннит. В соответствии с этими предварительными результатами было продемонстрировано следующее: приемлемые лиофилизаты не были получены при использовании продуктов, содержащих 4% сорбита, уксусная кислота может вызывать сдвиг рН во время лиофилизации, что может иметь исключительно важное значение для стабильности состава, присутствие сахарозы в составе может улучшать стабильность.In accordance with the results of evaluating the appearance of the lyophilisate and the recovery time, compositions 1-4 are unacceptable for the lyophilization product. Formulation-5 also showed a significant increase in aggregation visible to the naked eye after reconstitution with 1 mL of water for injection. These results can be explained by a pH shift above 5.2 in the formulation during lyophilization (the pl at which the hyFc-fused G-CSF is insoluble or sparingly soluble is found to correspond to pH 5.3-6.0) due to evaporation of acetic acid. Also, increased pH was observed in formulations 6 and 7. pH shifts were limited in the formulation containing sucrose, in contrast to the formulation containing only mannitol. According to these preliminary results, the following were demonstrated: acceptable lyophilisates were not obtained using products containing 4% sorbitol, acetic acid may cause a pH shift during lyophilization that may be critical to formulation stability, the presence of sucrose in the formulation may improve stability.
После этих исследований различные буферные системы использовали в тех же составах, которыеFollowing these studies, various buffer systems were used in the same formulations that
- 7 045982 приведены ниже. Цитратную буферную систему использовали для предупреждения сдвига рН лиофилизированного продукта. Состав-8 получали с использованием цитратной буферной системы при рН 4,2, содержащей 2,0% hy-Fc-слитого G-CSF в качестве активного ингредиента, полоксамера 188 в качестве поверхностно-активного вещества, 4% маннита и 1% сахарозы в качестве стабилизирующего средства. Состав-9 получали с использованием ацетатной буферной системы при рН 4,2, содержащей 2,0% hy-Fcслитого G-CSF в качестве активного ингредиента, полоксамера 188 в качестве поверхностно-активного вещества, 4% маннита и 1% сахарозы в качестве стабилизирующего средства. Эти водные препараты выдерживали в течение 1 недели при 25°C перед лиофилизацией с целью демонстрации стабильности hyFc-слитого G-CSF при использовании различных буферных систем.- 7 045982 are given below. A citrate buffer system was used to prevent a shift in the pH of the lyophilized product. Formulation-8 was prepared using a citrate buffer system at pH 4.2 containing 2.0% hy-Fc-fusion G-CSF as the active ingredient, poloxamer 188 as a surfactant, 4% mannitol and 1% sucrose in as a stabilizing agent. Formulation-9 was prepared using an acetate buffer system at pH 4.2 containing 2.0% hy-Fc fusion G-CSF as the active ingredient, poloxamer 188 as a surfactant, 4% mannitol and 1% sucrose as a stabilizing agent. facilities. These aqueous preparations were incubated for 1 week at 25°C before lyophilization to demonstrate the stability of the hyFc-fused G-CSF using different buffer systems.
Таблица 2table 2
Предварительные исследования для определения соответствующей буферной системыPreliminary studies to determine an appropriate buffer system
В составе-8 видимая агрегация происходила в водных препаратах через 1 неделю. В табл. 2 агрегация также показана снижением концентрации почти на 50% в составе-8 и снижением концентрации почти на 20% в составе-9. Эти водные препараты не подвергали лиофилизации в связи с нестабильностью водных форм. Следовательно, пришли к заключению, что hy-Fc-слитый G-CSF является более стабильным в ацетатном буфере, и исследования в отношении разработки состава продолжали с ацетатным буфером.In composition-8, visible aggregation occurred in aqueous preparations after 1 week. In table 2 aggregation is also shown by a concentration reduction of almost 50% in composition-8 and a concentration reduction of almost 20% in composition-9. These aqueous preparations were not lyophilized due to the instability of the aqueous forms. Therefore, it was concluded that the hy-Fc-fusion G-CSF is more stable in acetate buffer, and formulation development studies continued with acetate buffer.
Трегалозу и сахарозу считали приоритетными при тестирования различных стабилизирующих средств. Хотя была продемонстрирована эффективность сахарозы в повышении стабильности, гидролиз сахарозы в кислой среде мог представлять проблему. Поскольку сахароза в кислой среде подвергается гидролизу, приняли решение в следующих исследованиях использовать трегалозу.Trehalose and sucrose were considered priorities when testing various stabilizing agents. Although sucrose has been demonstrated to be effective in increasing stability, hydrolysis of sucrose in acidic conditions could be a problem. Since sucrose undergoes hydrolysis in an acidic environment, we decided to use trehalose in the following studies.
Перед началом исследования составов подготовили предварительное исследование водных препаратов, содержащих полоксамер 188 в качестве поверхностно-активного вещества в ацетатном буфере при рН 4,25, без hy-Fc-слитого G-CSF с различными комбинациями трегалозы и сорбита для оценки структуры лиофилизатов и сдвигов рН.Before starting the formulation study, a preliminary study of aqueous formulations containing poloxamer 188 as a surfactant in acetate buffer at pH 4.25, without hy-Fc-fusion G-CSF, with various combinations of trehalose and sorbitol was prepared to evaluate the structure of lyophilisates and pH shifts .
Таблица 3Table 3
Определение соответствующего процентного содержания стабилизирующего средства без hy-Fc-слитого белка G-CSFDetermination of the appropriate percentage of stabilizing agent without hy-Fc fusion protein G-CSF
* В качестве трегалозы использовали дегидрат трегалозы.* Trehalose dehydrate was used as trehalose.
** Составы получали с использованием 1 мл воды для инъекций, а лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций.**Formulations were prepared using 1 ml water for injection, and the lyophilized formulation was reconstituted using 1 ml water for injection.
Согласно результатам, приведенным в табл. 3, приемлемые лиофилизаты получали при пониженном содержании сорбита и повышенном содержании трегалозы. Дополнительно, снижение процентного содержания трегалозы в составах вызывало сдвиг рН в сторону повышения. В заключение, содержание сорбита, составляющее 2%, выбирали в качестве предела содержания сорбита в составе с получениемAccording to the results given in table. 3, acceptable lyophilisates were obtained with a reduced sorbitol content and an increased trehalose content. Additionally, decreasing the percentage of trehalose in the formulations caused an upward shift in pH. Finally, a sorbitol content of 2% was chosen as the limit of sorbitol content in the formulation to obtain
- 8 045982 приемлемой структуры лиофилизата.- 8 045982 acceptable structure of the lyophilisate.
В предварительных исследованиях испытывали различные стабилизирующие средства и буферные системы, чтобы найти подходящие вспомогательные вещества. Стабильный состав для лиофилизации, содержащий уникальную оригинальную молекулу hy-Fc-G-CSF, является полностью специфическим и достаточно сложным. Данное исследование является первым исследованием лиофилизации, включающим hy-Fc-G-CSF и обеспечивающим стабильность данного уникального лекарственного продукта, совместно содержащего Fc-слитую часть и G-CSF-часть. Таким образом, в следующих примерах водные препараты получают с содержанием hy-Fc-слитого G-CSF в качестве активного ингредиента, полоксамера 188 в качестве поверхностно-активного вещества, комбинации трегалозы и сорбита в качестве стабилизирующего средства в ацетатном буфере.In preliminary studies, various stabilizing agents and buffer systems were tested to find suitable excipients. The stable composition for lyophilization, containing the unique original hy-Fc-G-CSF molecule, is completely specific and quite complex. This study is the first lyophilization study incorporating hy-Fc-G-CSF to ensure the stability of this unique drug product co-containing an Fc fusion moiety and a G-CSF moiety. Thus, in the following examples, aqueous formulations are prepared containing a hy-Fc fusion G-CSF as the active ingredient, poloxamer 188 as a surfactant, a combination of trehalose and sorbitol as a stabilizing agent in acetate buffer.
Пример 1. Определение композиции для составов на основе hy-Fc-слитого G-CSF.Example 1: Determination of composition for hy-Fc-fusion G-CSF formulations.
Собственные исследования показали, что изоэлектрическая точка (pl) hyFc-слитого G-CSF находится между 5,3 и 6,9. В данном диапазоне hyFc-слитый G-CSF обладает ограниченной растворимостью. Более того, согласно наблюдениям устойчивость коллоидной системы hyFc-слитого G-CSF увеличивалась при снижении рН (от 5,2 до 3,8) (заявка на патент согласно РСТ PCT/TR2018/050208). Следовательно, в соответствии с собственными исследованиями определяли оптимальный диапазон рН для этой композиции, составляющий от 3,8 до 5,2, предпочтительно от 4 до 5.Own research has shown that the isoelectric point (pl) of hyFc-fused G-CSF is between 5.3 and 6.9. In this range, the hyFc-fused G-CSF has limited solubility. Moreover, the stability of the hyFc-fused G-CSF colloidal system was observed to increase with decreasing pH (from 5.2 to 3.8) (PCT patent application PCT/TR2018/050208). Therefore, in accordance with our own research, the optimal pH range for this composition was determined to be from 3.8 to 5.2, preferably from 4 to 5.
После определения диапазона рН комбинацию сорбита и трегалозы выбирали в качестве стабилизирующего средства; полоксамер 188 выбирали в качестве поверхностно-активного вещества. На основании данного выбора определяли состав для лиофилизации, показанный ниже (табл. 4).After determining the pH range, the combination of sorbitol and trehalose was selected as a stabilizing agent; Poloxamer 188 was chosen as the surfactant. Based on this choice, the composition for lyophilization shown below was determined (Table 4).
Таблица 4Table 4
Определенная композиция состава на основе hy-Fc-слитого G-CSFSpecific formulation of hy-Fc-fusion G-CSF formulation
* Составы получали с использованием 1 мл воды для инъекций, а лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций.*Formulations were prepared using 1 ml water for injection, and the lyophilized formulation was reconstituted using 1 ml water for injection.
q.s.: требуемое количество.q.s.: required quantity.
Пример 2. Кратковременная стабильность и оценка эффектов в отношении замораживанияоттаивания определенного состава в жидкой форме.Example 2: Short-term stability and evaluation of freeze-thaw effects of a specific formulation in liquid form.
Чтобы определить пригодность определенного состава для сублимационного высушивания оценивали кратковременную стабильность состава в жидкой форме, приведенного в табл. 5, и эффект в отношении замораживания-оттаивания.To determine the suitability of a particular composition for freeze-drying, the short-term stability of the composition in liquid form, given in Table 1, was assessed. 5, and the effect on freeze-thaw.
Таблица 5 _________Композиция состава на основе hy Fc-слитого G-CSF_________Table 5 _________Composition of the composition based on hy Fc-fused G-CSF_________
Компонент Функция КоличествоComponent Function Quantity
q.s.: требуемое количество.q.s.: required quantity.
Состав на основе G-CSF получали в виде композиции состава, приведенной выше (табл. 5), с по- 9 045982 мощью растворения вспомогательных веществ в воде для инъекций. Концентрация белка составляла 20 мг/мл, и рН состава составлял рН 4,6.The G-CSF based formulation was prepared as the formulation given above (Table 5) by dissolving the excipients in water for injection. The protein concentration was 20 mg/ml, and the pH of the formulation was pH 4.6.
Для определения кратковременной стабильности в жидкой форме состав инкубировали при 25°C в течение 1 недели. Через 1 неделю стабильность hyFc-слитого G-CSF оценивали с помощью анализов SE-HPLC, RP-HPLC, SDS-PAGE и IEF. С другой стороны, эффекты замораживания-оттаивания оценивали с помощью анализов SE-HPLC после 3 циклов замораживанияоттаивания (-80 и 25°C).To determine short-term stability in liquid form, the formulation was incubated at 25°C for 1 week. After 1 week, the stability of the hyFc-fusion G-CSF was assessed by SE-HPLC, RP-HPLC, SDS-PAGE, and IEF assays. On the other hand, freeze-thaw effects were assessed using SE-HPLC analyzes after 3 freeze-thaw cycles (-80 and 25°C).
Таблица 6Table 6
Кратковременная стабильность жидкой формы состава на основе hyFc-слитого G-CSF и оценка эффекта замораживания-оттаивания в отношении этого составаShort-term stability of the liquid form of a hyFc-fused G-CSF formulation and evaluation of the freeze-thaw effect on this formulation
В соответствии с результатами, приведенными в таблице 6, через неделю при 25°C результаты SEHPLC, RP-HPLC, SDS-PAGE и IEF, как было обнаружено, являлись аналогичными. Также определили, что чистота согласно SE-HPLC являлась аналогичной после 3 циклов замораживания-оттаивания. Эти результаты продемонстрировали, что этот состав может оставаться стабильным во время осуществления лиофилизации при предполагаемом диапазоне рН.According to the results shown in Table 6, after a week at 25°C, the results of SEHPLC, RP-HPLC, SDS-PAGE and IEF were found to be similar. It was also determined that SE-HPLC purity was similar after 3 freeze-thaw cycles. These results demonstrated that this formulation could remain stable during lyophilization at the expected pH range.
Пример 3. Лиофилизация состава на основе G-CSF, слитого с гибридным Fc, при рН 4,8 (LF4,8).Example 3 Lyophilization of a G-CSF fused Fc fusion formulation at pH 4.8 (LF4.8).
Для лиофилизации состава на основе hyFc-слитого G-CSF (табл. 5) состав получали при рН 4,8 и кодировали как LF4,8. Затем продуктом наполняли стеклянные флаконы 2R типа 1 и частично закрывали пробками для лиофилизации. Циклы лиофилизации осуществляли в сублимационной сушильной установке Lyobeta (Telstar, Испания). Цикл лиофилизации осуществляли посредством начальной стадии выдерживания при 5°C, стадии замораживания при -50°C, стадии первичного высушивания при -40°C, 0,07 мбар в течение 48 ч и стадии вторичного высушивания при 35°C в течение 7 ч.To lyophilize the hyFc-fusion G-CSF formulation (Table 5), the formulation was prepared at pH 4.8 and coded LF4.8. The product was then filled into 2R type 1 glass vials and partially capped for lyophilization. Lyophilization cycles were carried out in a Lyobeta freeze dryer (Telstar, Spain). The lyophilization cycle was carried out through an initial holding step at 5°C, a freezing step at -50°C, a primary drying step at -40°C, 0.07 mbar for 48 hours and a secondary drying step at 35°C for 7 hours.
Перед лиофилизацией и после нее стабильность hyFc-слитого G-CSF оценивали с помощью SDSPAGE, IEF, SE-HPLC, RP-HPLC и анализов видимых частиц. После лиофилизации остаточную влажность определяли с помощью анализа Карла-Фишера. Значение рН состава измеряли до осуществления лиофилизации и после восстановления лиофилизированного состава. Результаты показаны в табл. 7 ниже.Before and after lyophilization, the stability of hyFc-fusion G-CSF was assessed by SDSPAGE, IEF, SE-HPLC, RP-HPLC and visible particle assays. After lyophilization, residual moisture was determined using Karl-Fischer analysis. The pH value of the composition was measured before lyophilization and after reconstitution of the lyophilized composition. The results are shown in table. 7 below.
- 10 045982- 10 045982
Таблица 7 Результаты анализа состава на основе hy-Fc-слитого G-CSF при рН 4,8 (LF4,8) перед лиофилизацией и после лиофилизацииTable 7 Results of analysis of the hy-Fc-fusion G-CSF formulation at pH 4.8 (LF4.8) before lyophilization and after lyophilization
*Лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций.*Lyophilized formulation was reconstituted using 1 ml of water for injection.
После осуществления лиофилизации получали фармацевтически приемлемые лиофилизаты (белые и неповрежденные) (Patel, S.M., et al. Lyophilized Drug Product Cake Appearance: What Is Acceptable?, Journal of Pharmaceutical Sciences, Volume 106, Issue 7, Pages 1706-1721, 2017). Чистота согласно SEHPLC и чистота согласно RP-HPLC, как обнаружилось, были аналогичными перед лиофилизацией и после лиофилизации. После лиофилизации наблюдался небольшой сдвиг рН - от рН 4,8 до рН 4,9.After lyophilization, pharmaceutically acceptable lyophilisates (white and intact) were obtained (Patel, S.M., et al. Lyophilized Drug Product Cake Appearance: What Is Acceptable?, Journal of Pharmaceutical Sciences, Volume 106, Issue 7, Pages 1706-1721, 2017). SEHPLC purity and RP-HPLC purity were found to be similar before lyophilization and after lyophilization. After lyophilization, a slight pH shift was observed, from pH 4.8 to pH 4.9.
Также обнаружили, что результаты SDS-PAGE и IEF являлись аналогичными. Следовательно, структура hy-Fc-слитого G-CSF сохранялась в определенном составе с рН 4,8 во время осуществления лиофилизации.It was also found that the results of SDS-PAGE and IEF were similar. Therefore, the structure of the hy-Fc-fusion G-CSF was maintained in a specific composition at pH 4.8 during lyophilization.
Пример 4. Исследования стабильности с ускоренной деградацией лиофилизированного состава на основе hy-Fc-слитого G-CSF (LF4,8).Example 4 Stability studies with accelerated degradation of a lyophilized formulation based on hy-Fc-fusion G-CSF (LF4.8).
Лиофилизированный состав на основе hy-Fc-слитого G-CSF (LF4,8), приведенный в примере 3, подвергали исследованиям стабильности с ускоренной деградацией при 25°C с 60% относительной влажностью (RH) и при 40°C с 75% RH в течение 1 недели и 2 недель для предвидения потенциальной стабильности белка в течение срока его хранения. Результаты показаны в табл. 8 и 9 ниже.The lyophilized hy-Fc-fusion G-CSF formulation (LF4,8) shown in Example 3 was subjected to stability studies with accelerated degradation at 25°C with 60% relative humidity (RH) and at 40°C with 75% RH for 1 week and 2 weeks to anticipate the potential stability of the protein during its shelf life. The results are shown in table. 8 and 9 below.
Таблица 8Table 8
Результаты анализа лиофилизированного состава на основе hy-Fc-слитого G-CSF через 1 неделю воздействия условий исследования стабильности с ускоренной деградациейAnalysis results of a hy-Fc-fused G-CSF lyophilized formulation after 1 week of exposure to accelerated degradation stability study conditions
- 11 045982- 11 045982
* Лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций. Таблица 9 Результаты анализа лиофилизированного состава на основе hy-Fc-слитого G-CSF через 2 недели воздействия условий исследования стабильности с ускоренной деградацией*The lyophilized formulation was reconstituted using 1 ml of water for injection. Table 9 Results of analysis of hy-Fc-fusion G-CSF lyophilized formulation after 2 weeks of exposure to accelerated degradation stability study conditions
* Лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций.*The lyophilized formulation was reconstituted using 1 ml of water for injection.
Было продемонстрировано, что лиофилизированный состав на основе hy-Fc-слитого G-CSF (LF4,8), как обнаружено, являлся стабильным при исследованиях стабильности с ускоренной деградацией при 25°C с 60% относительной влажностью (RH) и при 40°C с 75% RH в течение 1 недели и 2 недель.It was demonstrated that a lyophilized formulation based on hy-Fc-fusion G-CSF (LF4,8) was found to be stable in stability studies with accelerated degradation at 25°C with 60% relative humidity (RH) and at 40°C with 75% RH for 1 week and 2 weeks.
Пример 5. Лиофилизация составов на основе G-CSF, слитого с гибридным Fc, при рН 4,2 (LF4,2) и рН 4,5 (LF4,5).Example 5. Lyophilization of formulations based on G-CSF fused to a hybrid Fc at pH 4.2 (LF4.2) and pH 4.5 (LF4.5).
Для лиофилизации получали составы на основе hyFc-слитого G-CSF с рН 4,2 (LF4,2) и рН 4,5 (LF4,5), приведенные в табл. 10. Затем продуктами наполняли стеклянные флаконы 2R типа 1 и частично закрывали пробками для лиофилизации. Циклы лиофилизации осуществляли в сублимационной сушильной установке Lyobeta (Telstar, Испания). Цикл лиофилизации осуществляли посредством начальной стадии выдерживания при 5°C, стадии замораживания при -50°C, стадии первичного высушивания при 40°C, 0,07 мбар в течение 48 ч и стадии вторичного высушивания при 35°C в течение 7 ч.For lyophilization, compositions based on hyFc-fused G-CSF with pH 4.2 (LF4.2) and pH 4.5 (LF4.5) were obtained, shown in table. 10. The products were then filled into 2R type 1 glass vials and partially capped for lyophilization. Lyophilization cycles were carried out in a Lyobeta freeze dryer (Telstar, Spain). The lyophilization cycle was carried out through an initial holding step at 5°C, a freezing step at -50°C, a primary drying step at 40°C, 0.07 mbar for 48 hours, and a secondary drying step at 35°C for 7 hours.
- 12 045982- 12 045982
Таблица 10Table 10
Композиции составов на основе hy-Fc-слитого G-CSF при рН 4,2 (LF4,2) и pH4,5(LF4,5)Compositions of formulations based on hy-Fc-fused G-CSF at pH 4.2 (LF4.2) and pH4.5 (LF4.5)
Перед лиофилизацией и после нее стабильность hyFc-слитого G-CSF оценивали с помощью SDSPAGE, IEF, SE-HPLC, RP-HPLC и анализов видимых частиц. После лиофилизации остаточную влажность определяли с помощью анализа Карла-Фишера. Также рН составов измеряли до осуществления лиофилизации и после восстановления лиофилизированных составов. Результаты показаны в табл. 11 ниже.Before and after lyophilization, the stability of hyFc-fusion G-CSF was assessed by SDSPAGE, IEF, SE-HPLC, RP-HPLC and visible particle assays. After lyophilization, residual moisture was determined using Karl-Fischer analysis. Also, the pH of the formulations was measured before lyophilization and after reconstitution of the lyophilized formulations. The results are shown in table. 11 below.
Таблица 11Table 11
Результаты анализа состава на основе hy-Fc-слитого G-CSF при рН 4,2 (LF4,2) и рН 4,5 (LF4,5) перед лиофилизацией и после лиофилизацииAnalysis results of hy-Fc-fusion G-CSF formulation at pH 4.2 (LF4.2) and pH 4.5 (LF4.5) before lyophilization and after lyophilization
* Лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций.*The lyophilized formulation was reconstituted using 1 ml of water for injection.
После осуществления лиофилизации получали фармацевтически приемлемые лиофилизаты для всех составов (белые и неповрежденные) (Patel, S.M., et al. Lyophilized Drug Product Cake Appearance: What Is Acceptable?, Journal of Pharmaceutical Sciences, Volume 106, Issue 7, Pages 1706-1721, 2017). Чистота согласно SE-HPLC и чистота согласно RP-HPLC, как обнаружилось, были аналогичными перед лиофилизацией и после лиофилизации. После лиофилизации в обоих составах наблюдался небольшой сдвиг рН. Также обнаружили, что результаты SDS-PAGE и IEF являлись аналогичными. Следовательно, структура hy-Fc-слитого G-CSF сохранялась в определенном составе при рН 4,2 и рН 4,5 во время осуществления лиофилизации.After lyophilization, pharmaceutically acceptable lyophilisates for all formulations (white and intact) were obtained (Patel, S.M., et al. Lyophilized Drug Product Cake Appearance: What Is Acceptable?, Journal of Pharmaceutical Sciences, Volume 106, Issue 7, Pages 1706-1721, 2017). SE-HPLC purity and RP-HPLC purity were found to be similar before lyophilization and after lyophilization. After lyophilization, a slight pH shift was observed in both formulations. It was also found that the results of SDS-PAGE and IEF were similar. Therefore, the structure of the hy-Fc-fusion G-CSF was maintained in a certain composition at pH 4.2 and pH 4.5 during lyophilization.
- 13 045982- 13 045982
Пример 6. Исследования стабильности с ускоренной деградацией лиофилизированных составов на основе hy-Fc-слитого G-CSF и сравнение с жидким составом.Example 6 Stability studies with accelerated degradation of hy-Fc-fused G-CSF lyophilized formulations and comparison with liquid formulation.
Лиофилизированные составы на основе (LF4,2, LF4,5, LF4,8) hy-Fc-слитого G-CSF, приведенные в примерах 3 и 5, подвергали исследованиям стабильности с ускоренной деградацией при 40°C с 75% RH в течение 2 недель для предвидения потенциальной стабильности белка в течение срока его хранения. Результаты показаны в табл. 12 ниже.Lyophilized formulations based on (LF4.2, LF4.5, LF4.8) hy-Fc-fused G-CSF, shown in Examples 3 and 5, were subjected to stability studies with accelerated degradation at 40°C with 75% RH for 2 weeks to anticipate the potential stability of the protein during its shelf life. The results are shown in table. 12 below.
Таблица 12Table 12
Результаты анализа лиофилизированных составов на основе hy-Fc-слитогоResults of the analysis of lyophilized formulations based on hy-Fc fusion
G-CSF через 2 недели воздействия условий исследования стабильности с ускоренной деградацией (40°C - 75% RH)G-CSF after 2 weeks of exposure to accelerated degradation stability study conditions (40°C - 75% RH)
*Жидкий состав состоял из 20 мг/мл hy-Fc-слитого G-CSF, 10 мМ Na/ацетатного буфера, 5% сорбита, 0,1% полоксамера 188. Обнаружили, что этот жидкий состав являлся стабильным в течение б месяцев при 2-8°C (заявка на патент согласно РСТ PCT/TR2018/050208).*The liquid formulation consisted of 20 mg/ml hy-Fc-fusion G-CSF, 10 mM Na/acetate buffer, 5% sorbitol, 0.1% poloxamer 188. This liquid formulation was found to be stable for 6 months at 2 -8°C (patent application according to PCT PCT/TR2018/050208).
**Лиофилизированный состав восстанавливали с использованием 1 мл воды для инъекций.**Lyophilized formulation was reconstituted using 1 ml water for injection.
Было продемонстрировано, что лиофилизированные составы (LF4,2, LF4,5, LF4,8) на основе G-CSF, слитого с гибридным Fc, как обнаружено, являлись стабильными по сравнению с жидким составом, который, как обнаружено, являлся стабильным в течение 6 месяцев при 2-8°C (заявка на патент согласно РСТ PCT/TR2018/050208). Следовательно, эти результаты показали, что для G-CSF, слитого с гибридным Fc, успешно разработаны стабильные лиофилизированные составы. В настоящем изобретении согласно данному документу лиофилизированная композиция на основе Fc-слитого G-CSF состоит из буферной системы, по меньшей мере одного стабилизирующего средства и по меньшей мере одного поверхностно-активного вещества; где препарат имеет значение рН, составляющее от 3,8 до 5,2, предпочтительно от 4 до 5, и стабилизирующее средство представляет собой комбинацию трегалозы и сорбита.It was demonstrated that lyophilized formulations (LF4.2, LF4.5, LF4.8) based on G-CSF fused to a hybrid Fc were found to be stable compared to the liquid formulation, which was found to be stable over 6 months at 2-8°C (patent application according to PCT PCT/TR2018/050208). Therefore, these results indicated that stable lyophilized formulations have been successfully developed for G-CSF fused to hybrid Fc. In the present invention herein, the lyophilized Fc-fusion G-CSF composition consists of a buffer system, at least one stabilizing agent and at least one surfactant; wherein the preparation has a pH value of 3.8 to 5.2, preferably 4 to 5, and the stabilizing agent is a combination of trehalose and sorbitol.
Дополнительно, лиофилизированный состав LF4,2 на основе hy-Fc-слитого G-CSF подвергали воздействию различных условий исследования стабильности (2-8°C, 25°C -60% RH, 30°C - 65% RH и 40°C 75% RH) в течение 3 месяцев, чтобы предвидеть потенциальную стабильность белка в течение срока его хранения. Результаты показаны в табл. 13 ниже.Additionally, a lyophilized formulation of LF4,2 based on hy-Fc-fusion G-CSF was subjected to various stability study conditions (2-8°C, 25°C -60% RH, 30°C - 65% RH and 40°C 75 % RH) for 3 months to anticipate the potential stability of the protein during its shelf life. The results are shown in table. 13 below.
Таблица 13 Результаты анализа лиофилизированных составов на основе hy-Fc-слитого G-CSF через 3 месяца при различных условиях исследования стабильности (2-8°C, 25°C - 60% RH, 30°C - 65% RH и 40°C - 75% RH)Table 13 Results of analysis of lyophilized formulations based on hy-Fc-fusion G-CSF after 3 months under various stability study conditions (2-8°C, 25°C - 60% RH, 30°C - 65% RH and 40°C - 75% RH)
--
Claims (9)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19177024.7 | 2019-05-28 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EA045982B1 true EA045982B1 (en) | 2024-01-24 |
Family
ID=
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9636400B2 (en) | VEGF specific fusion protein antagonist formulations | |
| RU2683823C2 (en) | Sustained type human growth hormone preparation | |
| KR20230121822A (en) | Pharmaceutical composition of GLP-1/GLP-2 dual agonist | |
| US10918698B2 (en) | Lyophilized pharmaceutical composition of Fc-peptide fusion protein | |
| KR102589578B1 (en) | Stable hybrid FC-fused G-CSF formulation | |
| EA045982B1 (en) | STABLE LYOPHILIZED COMPOSITION BASED ON G-CSF FUSED WITH HYBRID Fc | |
| US20220288167A1 (en) | A stable lyophilized formulation for hybrid fc fused g-csf | |
| EP3434283A1 (en) | Medicinal composition comprising peg anti-human ngf antibody fab' fragment | |
| KR20230121824A (en) | Pharmaceutical composition of GLP-1/GLP-2 dual agonists | |
| US20190022183A1 (en) | A novel liquid formulation of long-acting human growth hormone conjugate | |
| KR20230121823A (en) | Pharmaceutical composition of GLP-1/GLP-2 dual agonists | |
| JP2023539476A (en) | Annexin A1 N-terminal peptide formulation and method | |
| JPH10265404A (en) | Pharmaceutical preparation containing human growth hormone | |
| RU2779387C1 (en) | Pharmaceutical composition of fusion protein taci-fc | |
| EA026073B1 (en) | Formulation for bovine granulocyte colony stimulating factor and method of treatment using same | |
| US20230025806A1 (en) | Stable compositions of fc multimers | |
| KR20210117200A (en) | Formulatiom of fusion protein comprising il-2 protein and cd80 protein | |
| KR20120139299A (en) | Stable lyophilized composition for injection comprising epidermal growth factor |