DE4427531A1

DE4427531A1 - Human beta-defensin 1 isolated from haemofiltrate

Info

Publication number: DE4427531A1
Application number: DE19944427531
Authority: DE
Inventors: Klaus W Dr Rer Nat Bensch; Wolf-Georg Prof Dr M Forssmann; Peter Dr Med Schulz-Knappe
Original assignee: Forssmann Wolf-Georg Prof Drmed 30175 Hannover De
Current assignee: Forssmann Wolf-Georg Prof Drmed 30175 Hannover De
Priority date: 1994-08-04
Filing date: 1994-08-04
Publication date: 1996-02-08

Abstract

beta -defensin, hBD-1, of formula (I) and its biologically active fragments and/or derivs. (esp. amidated, acetylated, sulphated, phosphorylated and/or glycosylated) are new: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (I). Also new is nucleic acid (II), pref. the 108 base sequence given in the specification, encoding (I) or its fragments.

Description

Das β-Defensin hBD-1 konnte überraschenderweise aus humanem Hämofiltrat isoliert werden. Es besteht aus der nachstehend angegebenen Aminosäuresequenz:The β-defensin hBD-1 was surprisingly isolated from human hemofiltrate. It consists of the amino acid sequence given below:

DHYNCVSSGG QCLYSACPIF TKIQGTCYRG KAKCCKDHYNCVSSGG QCLYSACPIF TKIQGTCYRG KAKCCK

Das erfindungsgemäße Peptid ist erhältlich durch ein Reinigungsverfahren ausgehend von humanem Hämofiltrat.The peptide according to the invention can be obtained by a purification process starting from human hemofiltrate.

Das humane Hämofiltrat wird gegebenenfalls mit Wasser verdünnt und angesäuert. Der pH- Wert beträgt vorzugsweise 1,5 bis 3,5, insbesondere 2,5 bis 3,0. Danach wird das Hämofiltrat über einen Kationenaustauscher geleitet, beispielsweise einem mit Sulfonsäuregruppen modifizierenden Trägermaterial (Fraktogel SP-650 (M), Merck, Darmstadt). Die an den Kationenaustauscher gebundenen Peptide werden mit einer relativ hoch konzentrierten Salzlösung eluiert. Die Ionenstärke der Elutionslösung entspricht dabei ungefähr einer 0,7 bis 1,3 molaren Natriumchloridlösung.The human hemofiltrate is optionally diluted with water and acidified. The pH The value is preferably 1.5 to 3.5, in particular 2.5 to 3.0. After that, the hemofiltrate passed over a cation exchanger, for example one with sulfonic acid groups modifying carrier material (Fraktogel SP-650 (M), Merck, Darmstadt). The Andes Cation exchangers are bound with a relatively highly concentrated peptide Saline solution eluted. The ionic strength of the elution solution corresponds approximately to a 0.7 to 1.3 molar sodium chloride solution.

Das aufgefangene Eluat wird mit einem peptidfällenden Reagenz, beispielsweise Ammoniumsulfat, versetzt. Die Ausfällung der Peptid erfolgt vorzugsweise bei niedrigeren Temperaturen, insbesondere im Bereich von 4°C bis 10°C. Das so gewonnene Präzipitat wird von der überstehenden Lösung abgetrennt.The eluate collected is treated with a peptide-precipitating reagent, for example Ammonium sulfate. The peptide is preferably precipitated at lower ones Temperatures, especially in the range of 4 ° C to 10 ° C. The precipitate thus obtained is separated from the supernatant solution.

Das Präzipitat wird in Wasser gelöst und die Lösung neutralisiert, vorzugsweise mit Natriumhydroxid auf einen pH zwischen 6,5 und 7,0. Die hochmolekularen Proteine werden von den Peptiden abgetrennt, beispielsweise mit Hilfe einer Ultrafiltration durch eine Ultra filtrationsmembran mit einer Ausschlußgrenze von 20 000 Da (Cellulosetriacetat-Membran der Fa. Sartorius).The precipitate is dissolved in water and the solution is neutralized, preferably with Sodium hydroxide to a pH between 6.5 and 7.0. The high molecular weight proteins are separated from the peptides, for example with the aid of ultrafiltration by an ultra filtration membrane with an exclusion limit of 20,000 Da (cellulose triacetate membrane of Sartorius).

Das die Peptide enthaltene Ultrafiltrat wird einer weiteren Kationenaustausch-Chromato graphie unterzogen. Diese Chromatographie ist vorzugsweise eine Gradientenelutions- Chromatographie mit einem Puffer geringerer Ionenstärke bis zu einem Puffer mit höherer Ionenstärke entsprechend einer Ionenstärke von 0,7 M bis 1,3 M Ammoniumacetat.The ultrafiltrate containing the peptides is a further cation exchange chromato subjected to graphics. This chromatography is preferably a gradient elution Chromatography with a buffer of lower ionic strength up to a buffer with higher Ionic strength corresponding to an ionic strength of 0.7 M to 1.3 M ammonium acetate.

Die das erfindungsgemäße Peptid enthalten Fraktionen werden mittels semipräparativer Umkehrphasen-Chromatographie beispielsweise an mit C4 modifizierten Trägermaterialien weitergereinigt. Der Aufreinigungsgrad wird vorzugsweise mittels analytischer Umkehrphasen- Chromatographie beispielsweise an mit C18 modifizierten Trägermaterialien und der Kapillarzonenelektrophorese überprüft.The fractions containing the peptide according to the invention are made by means of semi-preparative Reverse phase chromatography, for example on support materials modified with C4 further cleaned. The degree of purification is preferably determined by means of analytical reverse phase Chromatography, for example, on carrier materials modified with C18 and Capillary zone electrophoresis checked.

Die durch die chromatographische Reinigung erhaltene Substanz wurde der Strukturaufklärung zugeführt. Die Bestimmung der Molekülmassen des nativen Peptids sowie seiner proteo lytischen Fragmente und chemisch modifizierten Derivate erfolgte mittels eines Sciex API III Massenspektrometer. Die Aminosäureanalyse wurde nach einer sauren Totalhydrolyse durchgeführt. Die Sequenzanalyse erfolgte über einen Edman-Abbau der Peptids, seiner proteo lytischen Spaltprodukte sowie von chemisch modifizierten Derivaten mit einem ABI 473 A Sequenzer.The substance obtained by the chromatographic purification became the structure elucidation fed. Determination of the molecular mass of the native peptide and its proteo lytic fragments and chemically modified derivatives were carried out using a Sciex API III Mass spectrometry. The amino acid analysis was carried out after a total acid hydrolysis carried out. The sequence analysis was carried out via an Edman degradation of the peptide, his proteo lytic fission products as well as chemically modified derivatives with an ABI 473 A. Sequencer.

Aus der erfindungsgemäßen Peptidsequenz läßt sich ein Polynukleotid ableiten, kodierend für das β-Defensin hBD-1.A polynucleotide encoding for can be derived from the peptide sequence according to the invention the β-defensin hBD-1.

Das Polynukleotid ist insbesondere eine cDNA, die sowohl als Ausgangspunkt einer gentechnischen Herstellung des β-Defensins hBD-1 dienen kann, wie auch als analytisches Werkzeug zu Nachweis des Auftretens von für das Peptid kodierender DNA oder mRNA.The polynucleotide is in particular a cDNA, which is both the starting point for a genetic engineering of the β-defensin hBD-1 can serve as well as analytical Tool for detecting the appearance of DNA or mRNA coding for the peptide.

Dabei können entsprechende Derivate als Hybridisierungssonden eingesetzt werden. Beispielsweise weist die cDNA des erfindungsgemäßen Peptids die nachstehende Sequenz auf:Corresponding derivatives can be used as hybridization probes. For example, the cDNA of the peptide according to the invention has the following sequence:

Neben der gentechnischen Herstellung ist auch die aufbauende Totalsynthese an üblichen Festphasen im Sinne der Merrifield-Synthese möglich. Die Synthesestrategie und der Aufbau des Peptids und von ihm abgeleiteten Derivaten mit den entsprechend geschützten Aminosäuren sind dem Fachmann bekannt.In addition to genetic engineering, total synthesis is also conventional Solid phases possible in the sense of Merrifield synthesis. The synthesis strategy and the structure of the peptide and derivatives derived from it with the correspondingly protected amino acids are known to the person skilled in the art.

Das erfindungsgemäße Peptid kann als Arzneimittel Verwendung finden. Seine biologische Aktivität entspricht der einer antibiotischen Substanz. Es ist daher geeignet, als Arzneimittel bei den in Anspruch 10 bis 12 genannten Indikationen eingesetzt zu werden. Das erfindungs gemäße Peptid kann dabei in für Peptide üblicher Weise parenteral, intravenös, intramuskulär, intranasal, lokal-topisch oder bukal verabreicht werden. Die Menge an zu verabreichenden Peptid beträgt 1 mg bis 1 g pro Darreichungseinheit pro Tag.The peptide according to the invention can be used as a medicament. Its biological Activity corresponds to that of an antibiotic substance. It is therefore suitable as a medicine the indications mentioned in claims 10 to 12 are used. The invention appropriate peptide can be parenterally, intravenously, intramuscularly, in a manner customary for peptides, can be administered intranasally, topically or buccally. The amount of to be administered Peptide is 1 mg to 1 g per dosage unit per day.

Das erfindungsgemäße Diagnostikmittel enthält poly- oder monoklonale Antikörper gegen das erfindungsgemäße Peptid gegebenenfalls in fluoreszenz- oder radioaktivmarkierter Form, um in an sich bekannten ELISA oder RIA eingesetzt zu werden. The diagnostic agent according to the invention contains poly- or monoclonal antibodies against the Peptide according to the invention optionally in fluorescence or radioactively labeled form to in to be used in known ELISA or RIA.

Die Erfindung wird anhand der folgenden Beispiele näher beschrieben.The invention is described in more detail by the following examples.

example 1 Batch extraction

In sechs Ansätzen wurden je 800 l humanes Hämofiltrat mit Wasser auf 2500 l verdünnt und der pH mit konzentrierter HCl auf 2,7 eingestellt. Nach Auftrag auf eine Amicon-Vantage Säule wurden die gebundenen Peptide in 6 bis 7 l eluiert (Chromatogramm siehe Abb. 1).In six batches, 800 l of human hemofiltrate were diluted to 2500 l with water and the pH was adjusted to 2.7 with concentrated HCl. After application to an Amicon-Vantage column, the bound peptides were eluted in 6 to 7 l (chromatogram see Fig. 1).

Chromatographiebedingungen:
Säule: Amicon-Vantage (25 cm Durchmesser × 7 cm Füllhöhe)
Füllmaterial: Merck Fractogel SP-650 (M)
Batchpuffer: 1 M NaCl, pH 5,5
Fluß beim Auftrag: 2 l/min
Fluß beim Eluieren: 1 l/min
Detektion: 214 nm
Anlage: Pilot-Scale EigenbauChromatography conditions:
Column: Amicon-Vantage (25 cm diameter × 7 cm filling height)
Filling material: Merck Fractogel SP-650 (M)
Batch buffer: 1 M NaCl, pH 5.5
Flow when applied: 2 l / min
Flow when eluting: 1 l / min
Detection: 214 nm
System: self-built pilot-scale

Ammonium sulfate precipitation

Das Eluat wurde direkt nach der Elution mit 660 g/l Ammoniumsulfat versetzt und die Peptide über Nacht bei 4°C ausgefällt. Das Peptidpräzipitat wurde über einen Büchner-Filter filtriert.Immediately after the elution, the eluate was mixed with 660 g / l ammonium sulfate and the peptides precipitated overnight at 4 ° C. The peptide precipitate was filtered through a Büchner filter.

Ultrafiltration

Das in 2 l Wasser gelöste Peptidpräzipitat aus 4800 l Hämofiltrat wird mit Natronlauge auf pH 6,8 eingestellt. Eine Abtrennung hochmolekularer Proteine erfolgt über eine Ultrafiltration an einer Zellulosetriacetat-Membran mit einer Ausschlußgröße von 20 kDa (Sartorius Sartocon Mini).The peptide precipitate from 4800 l hemofiltrate dissolved in 2 l water is dissolved in sodium hydroxide solution pH 6.8 adjusted. High molecular weight proteins are separated by ultrafiltration on a cellulose triacetate membrane with an exclusion size of 20 kDa (Sartorius Sartocon Mini).

Cation exchange chromatography

Das Filtrat nach Ultrafiltration wird auf eine Leitfähigkeit von 5,7 mS/cm mit Wasser verdünnt und ein pH von 3,0 mit HCl eingestellt. Die Peptidlösung wird auf eine Amicon-Vantage Säule aufgetragen, welche mit Puffer A gespült und mit Puffer B im Gradienten eluiert wird. Es werden alle zwei Minuten Fraktionen gesammelt. Die Fraktion 40 wurde zur weiteren Bearbeitung unterworfen (Chromatogramm siehe Abb. 2).The filtrate after ultrafiltration is diluted to a conductivity of 5.7 mS / cm with water and a pH of 3.0 is adjusted with HCl. The peptide solution is applied to an Amicon-Vantage column, which is rinsed with buffer A and eluted with buffer B in a gradient. Fractions are collected every two minutes. Fraction 40 was subjected to further processing (chromatogram see Fig. 2).

Chromatographiebedingungen:
Säule: Amicon-Vantage (6 cm Durchmesser × 13 cm Füllhöhe)
Füllmaterial: Merck Fractogel SP-650 (M)
Puffer A: 0,1 M Essigsäure, 20% Methanol
Puffer B: 0,5 M Essigsäure, 20% Methanol, 1 M Ammoniumacetat
Gradient: 0-40% B in 60 min, 40% B auf 100% B in 10 min
Fluß: 50 ml/min
Detektion: 280 nm
Chromatographieanlage: BioPilot (Pharmacia)
Fraktionen: á 2 min ab Start des GradientenChromatography conditions:
Column: Amicon-Vantage (6 cm diameter × 13 cm filling height)
Filling material: Merck Fractogel SP-650 (M)
Buffer A: 0.1 M acetic acid, 20% methanol
Buffer B: 0.5 M acetic acid, 20% methanol, 1 M ammonium acetate
Gradient: 0-40% B in 60 min, 40% B to 100% B in 10 min
Flow: 50 ml / min
Detection: 280 nm
Chromatography system: BioPilot (Pharmacia)
Fractions: á 2 min from the start of the gradient

Semi-preparative reverse phase C4 chromatography

Die Fraktion 40 wurde sukzessive in mehreren identischen Chromatographien über eine semipräparative Reverse-Phase Säule aufgetrennt. Die Fraktion 37 enthielt die erfindungs gemäße Substanz (Chromatogramm siehe Abb. 3).Fraction 40 was separated successively in several identical chromatographies on a semi-preparative reverse phase column. Fraction 37 contained the substance according to the invention (chromatogram see Fig. 3).

Chromatographiebedingungen:
Säule: 2 cm × 12,5 cm Stahlsäule
Füllmaterial: Parcosil RP-C4 5 µm, 300 Å
Puffer A: 0,1% TFA
Puffer B: 0,1% TFA, 80% Acetonitril
Gradient: 5-50% B in 45 min, 50-100% B in 10 min
Fluß: 2 ml/min
Detektion: 220 nm
Chromatographieanlage: Kontron
Fraktionen: á 1 min ab Start des GradientenChromatography conditions:
Column: 2 cm × 12.5 cm steel column
Filling material: Parcosil RP-C4 5 µm, 300 Å
Buffer A: 0.1% TFA
Buffer B: 0.1% TFA, 80% acetonitrile
Gradient: 5-50% B in 45 min, 50-100% B in 10 min
Flow: 2 ml / min
Detection: 220 nm
Chromatography system: Kontron
Fractions: á 1 min from the start of the gradient

Analytical reverse phase C18 chromatography

Die Fraktion 37 aus dem semipräparativen Trennschritt wurde auf einer analytischen Säule weiter aufgereinigt (Chromatogramm siehe Abb. 4).Fraction 37 from the semi-preparative separation step was further purified on an analytical column (chromatogram see Fig. 4).

Chromatographiebedingungen:
Säule: 0,46 cm × 25 cm Stahlsäule
Füllmaterial: Vydac RP-C18, 5 µm, 300 Å
Puffer A: 0,1% TFA
Puffer B: 0,1% TFA, 80% Acetonitril
Gradient: 5-50% B in 45 min, 50-100% B in 10 min
Fluß: 0,7 ml/min
Detektion: 214 nm
Chromatographieanlage: Kontron.Chromatography conditions:
Column: 0.46 cm × 25 cm steel column
Filling material: Vydac RP-C18, 5 µm, 300 Å
Buffer A: 0.1% TFA
Buffer B: 0.1% TFA, 80% acetonitrile
Gradient: 5-50% B in 45 min, 50-100% B in 10 min
Flow: 0.7 ml / min
Detection: 214 nm
Chromatography system: Kontron.

In dieser Rechromatographie wird die Reinheit des isolierten Peptides, wie es zur weiteren Analytik verwandt wird, deutlich (Chromatogramm siehe Abb. 4). In this rechromatography the purity of the isolated peptide, as it is used for further analysis, becomes clear (chromatogram see Fig. 4).

Capillary zone electrophoresis

Zur Überprüfung der Reinheit wurde eine Kapillarzonen-Elektrophorese angefertigt. Die Fraktion 34 enthält die zu über 98% aufgereinigte Substanz (Elektropherogramm siehe Abb. 5).A capillary zone electrophoresis was made to check the purity. Fraction 34 contains over 98% of the substance purified (see Fig. 5 for electropherogram).

Bedingungen:
Kapillare: fused silica
Effektive Länge: 50 cm
Gesamtlänge: 57 cm
Puffer: 100 mM NaH₂PO₄ pH 2,5, 0,2% Hydroypropylmethylcellulose
Strom: 120 µA const.
Detektion: 200 nm
Temperatur: 25°CConditions:
Capillary: fused silica
Effective length: 50 cm
Overall length: 57 cm
Buffer: 100 mM NaH₂PO₄ pH 2.5, 0.2% hydroypropylmethyl cellulose
Current: 120 µA const.
Detection: 200 nm
Temperature: 25 ° C

Example 2 Mass determination

Alle Massenbestimmungen des unmodifizierten Peptids, von proteolytischen Fragmenten und chemisch modifizierten Derivaten wurden auf einem Elektrospray-Massenspektrometer (Sciex API III, Fa. Perkin Elmer) durchgeführt. Die Molekülmasse der unbehandelten Peptids wurde zu 3928,0 ± 0,5 Da (Massenspektrum siehe Abb. 6a) bestimmt.All mass determinations of the unmodified peptide, of proteolytic fragments and chemically modified derivatives were carried out on an electrospray mass spectrometer (Sciex API III, Perkin Elmer). The molecular mass of the untreated peptide was determined to be 3928.0 ± 0.5 Da (mass spectrum see Fig. 6a).

Determination of cysteines

Cysteine lassen sich nach vorheriger chemischer Derivatisierung, zum Beispiel nach Reduktion mit β-Mercaptoethanol und Carboxamidomethylierung mit Iodacetamid, in der Peptid- Sequenzierung nachweisen. Nach der Derivatisierung schließt sich eine Entsalzung vorzugsweise über eine analytische Reverse-Phase Chromatographie mit einer Vydac RP-C18 Säule (4,6 mm × 25 cm) an. Ein Teil des so modifizierten Peptids wird der Sequenzanalyse zugeführt, mit dem anderen Teil ergibt eine Massenbestimmung ein Molekülmasse von 4276,5 ± 0,6 Da (Massenspektrum siehe Abb. 6b). Aus der Massendifferenz von 348,5 ± 0,6 Da zwischen dem alkylierten und dem nativen Peptid wird geschlossen, daß das Peptid sechs Cysteine enthält, welche zudem mit drei Disulfidbrücken untereinander verbunden sind.After prior chemical derivatization, for example after reduction with β-mercaptoethanol and carboxamidomethylation with iodoacetamide, cysteines can be detected in peptide sequencing. After the derivatization, desalting is preferably followed by an analytical reverse phase chromatography with a Vydac RP-C18 column (4.6 mm × 25 cm). Part of the peptide modified in this way is fed to the sequence analysis, with the other part a mass determination gives a molecular mass of 4276.5 ± 0.6 Da (mass spectrum see Fig. 6b). From the mass difference of 348.5 ± 0.6 Da between the alkylated and the native peptide it is concluded that the peptide contains six cysteines, which are also connected to one another with three disulfide bridges.

Amino acid analysis

Nach Gasphasen-Hydrolyse mit 6 N HCl für 1 Stunde bei 160°C werden die Aminosäuren mit einem automatischen Aminosäureanalysator (AminoQuant, Hewlett-Packard) nach Doppelmarkierung mit OPA/Fmoc mit dem Standardprogramm analysiert. Die Ergebnisse einer Aminosäureanalyse des erfindungsgemäßen Peptids sind in Tabelle 1 zusammengefaßt. After gas phase hydrolysis with 6 N HCl for 1 hour at 160 ° C, the amino acids with an automatic amino acid analyzer (AminoQuant, Hewlett-Packard) Double marking with OPA / Fmoc analyzed with the standard program. The results of one Amino acid analysis of the peptide according to the invention are summarized in Table 1.

Tabelle 1 Table 1

Aminosäurezusammensetzung von hBD-1 Amino acid composition of hBD-1

Sequence determination

Sowohl das native als auch das carboxyamidomethylierte Peptid werden mittels Edman-Abbau auf einem ABI 473 A Sequenzer unter Verwendung des Standard-Programms analysiert. Die Proben werden auf mit Polybrene vorbehandelte Membranen in Mengen zwischen 100 und 400 pmol aufgetragen. In Übereinstimmung mit den Ergebnissen aus der Aminosäureanalyse und den Massenbestimmungen ergibt sich die folgende Sequenz:Both the native and the carboxyamidomethylated peptide are degraded using Edman analyzed on an ABI 473 A sequencer using the standard program. The Samples are applied to membranes pretreated with Polybrene in amounts between 100 and 400 pmol applied. In accordance with the results from amino acid analysis and The following sequence results from the mass determinations:

DHYNCVSSGG QCLYSACPIF TKIQGTCYRG KAKCCKDHYNCVSSGG QCLYSACPIF TKIQGTCYRG KAKCCK

Database comparison

Ein Datenbankvergleich wurde mit Hilfe des HUSAR-Programmpakets an den SwissProt und EMBL-Nukleinsäure Datenbanken durchgeführt. Es wurde eine Sequenzhomologie zu verschiedenen Mitgliedern der Superfamilie der β-Defensine festgestellt, inbesondere zu dem "Tracheal Antimicrobial Peptide" (kurz TAP) von Rind.A database comparison was made with the help of the HUSAR program package to SwissProt and EMBL nucleic acid databases performed. Sequence homology has been added various members of the superfamily of β-defensins were found, particularly to that "Tracheal Antimicrobial Peptide" (TAP for short) from cattle.

Example 3 Synthesis of oligonucleotides

Drei Primer wurden auf einem Nukleinsäure-Sythesizer (Fa. Applied Biosystems) nach der Phosphoamidit-Methode nach den Angaben des Herstellers synthetisiert, auf OPC-Säulen gereinigt und in bidest. H₂O gelöst. BD-N und BD-C bilden ein Paar sogenannter "degenerierter" PCR-Primer, welche sämtliche Codierungsmöglichkeiten für die in Beispiel 2 bestimmten amino- und carboxyterminalen Aminosäuresequenzen des β-Defensins und eine zusätzliche Linkersequenz mit Restriktionsschnittstellen für die spätere Klonierung enthalten. Mit Unip-2 wird die Erststrangsynthese der cDNA durchgeführt.Three primers were on a nucleic acid synthesizer (Applied Biosystems) after the Phosphoamidite method synthesized according to the manufacturer's instructions, on OPC columns cleaned and in double dist. H₂O solved. BD-N and BD-C form a pair of so-called "Degenerate" PCR primer, which all coding possibilities for the in Example 2 certain amino and carboxy terminal amino acid sequences of the β-defensin and a contain additional linker sequence with restriction sites for later cloning. The first strand synthesis of the cDNA is carried out with Unip-2.

Preparation of cDNA

Aus humanem Gewebe wurde mit Hilfe eines automatischen Nukleinsäurenextraktors (ABI, 340) Gesamt-RNA nach den Angaben des Herstellers präpariert. Aus 5 µg dieser RNA wurde die mRNA unter Verwendung des Primers Unip-2 und von MMLV-RTase (Gibco-BRL) in cDNA-Erststrang umgeschrieben.An automated nucleic acid extractor (ABI, 340) Total RNA prepared according to the manufacturer's instructions. 5 µg of this RNA became the mRNA using the primer Unip-2 and MMLV-RTase (Gibco-BRL) in Rewrite cDNA first strand.

Amplification of the cDNA coding for hBD-1

Die spezifische Amplifikation der codierenden cDNA wurde durch eine PCR an einem Thermocycler (Perkin-Elmer-Cetus, 7000) durchgeführt. Mit etwa 1 µg cDNA aus verschiedenen humanen Geweben, insbesondere des Urogenital- und Respirationstraktes, werden mit den oben aufgeführten Primern nach Standardmethoden die codierenden cDNAs erhalten.The specific amplification of the coding cDNA was determined by PCR on a Thermal cycler (Perkin-Elmer-Cetus, 7000) performed. With about 1 µg cDNA from different human tissues, especially the urogenital and respiratory tract, are covered with the receive the coding cDNAs listed above according to standard methods.

Nucleic acid sequencing

Die Nukleinsäurensequenz nach routinegemäß ausgeführter Fluoreszenzsequenzierung ergab die unten aufgeführte Struktur. Wo die DNA-Sequenz mit der Proteinsequenz von hBD-1 übereinstimmt, sind die Aminosäuren im Ein-Buchstaben-Code angegeben. Die Konsensussequenz für eine hypothetische Polyadenylierungs-Stelle ist einfach und für das Stop-Codon doppelt unterstrichen.The nucleic acid sequence after routine fluorescence sequencing revealed the structure below. Where the DNA sequence with the protein sequence from hBD-1 matches, the amino acids are specified in the one-letter code. The Consensus sequence for a hypothetical polyadenylation site is simple and for that Double underline stop codon.

Claims

1. β-defensin hBD-1 with the following amino acid sequence DHYNCVSSGG QCLYSACPIF TKIQGTCYRG KAKCCK as well as its biologically active fragments and / or derivatives, especially amidated, acetylated, sulfated, phosphorylated and / or glycosylated derivatives.

2. Polynucleotide coding for β-defensin hBD-1 according to claim 1 and / or its Fragments.

3. Polynucleotide according to claim 2, characterized in that it is a cDNA fragment of the formula below

4. A method for producing a β-defensin hBD-1 according to claim 1 by extraction of hemofiltrate by cation exchange extraction with subsequent elution of the adsorbed substances, ammonium sulfate precipitation of the peptides present in the eluate and Proteins, absorption of the precipitate in aqueous solution and separation of the proteins by ultrafiltration, a renewed cation exchange chromatography of the Ultrafiltrate containing peptides and a reverse phase chromatography.

5. A method for producing a β-defensin hBD-1 according to claim 1 by Solid phase synthesis in the sense of Merrifield synthesis with protected amino acids.

6. The method for producing a β-defensin hBD-1 according to claim 1 Routinely known expression using common biotechnological vectors.

7. diagnostic agent of the substance according to claim 1 according to claim 1 containing poly or monoclonal antibodies against β-defensin hBD-1 or with that for β-defensin coding nucleic acid or mRNA.

8. Diagnostic agent containing the substance of claim 1 for test systems to control Plasma, urine and cerebrospinal fluid levels of this substance.

9. diagnostic agent containing the substance of claim 1 as a marker for functional disorders of the immune system and inflammatory processes.

10. Medicament containing the substance of claim 1, β-defensin hBD-1, as effective ingredient.

11. Use of β-defensin hBD-1 according to claim 10 for the production of a Drug for the treatment of disorders in inflammatory processes, disturbed Inflammatory reaction, especially if the macrophage migration is damaged.

12. Use of β-defensin hBD-1 according to claim 10 for the production of a Medicinal product used to treat infectious diseases by using it as an antibiotic is used.