DE19749073C1 - New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals - Google Patents

New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals

Info

Publication number
DE19749073C1
DE19749073C1 DE1997149073 DE19749073A DE19749073C1 DE 19749073 C1 DE19749073 C1 DE 19749073C1 DE 1997149073 DE1997149073 DE 1997149073 DE 19749073 A DE19749073 A DE 19749073A DE 19749073 C1 DE19749073 C1 DE 19749073C1
Authority
DE
Germany
Prior art keywords
peptide
peptides
nucleic acid
acid
anup
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related
Application number
DE1997149073
Other languages
German (de)
Inventor
Wolf-Georg Prof Dr Forssmann
Gabriele Heine
Knut Dr Adermann
Peter Dr Schulz-Knappe
Michael Dr Nehls
Markus Dr Meyer
Klaus Dr Bensch
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
FORSSMANN WOLF GEORG PROF DR
Original Assignee
FORSSMANN WOLF GEORG PROF DR
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by FORSSMANN WOLF GEORG PROF DR filed Critical FORSSMANN WOLF GEORG PROF DR
Priority to DE1997149073 priority Critical patent/DE19749073C1/en
Priority to PCT/EP1998/003460 priority patent/WO1998056810A2/en
Priority to AU85366/98A priority patent/AU8536698A/en
Application granted granted Critical
Publication of DE19749073C1 publication Critical patent/DE19749073C1/en
Anticipated expiration legal-status Critical
Expired - Fee Related legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4703—Inhibitors; Suppressors
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; CARE OF BIRDS, FISHES, INSECTS; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Abstract

Protein of formula: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEA EYPFNQSPVVTRSCSSSCVAT DPDSIGAAHLIFCCFRDLCNSEL (I), designated LUS-I, its cyclic, glycosylated, phosphorylated, acetylated, amidated or side chain-coupled derivatives and biologically active fragments are new. Also new are: (1) nucleic acid (II) encoding (I); (2) antisense sequences (III) that bind to (II); (3) antibody (Ab) that binds to (I); (4) inhibitor (IV) of the activity or expression of (I); (5) transgenic animal defective for the LUS-I gene.

Description

Die vorliegende Erfindung betrifft Peptide und Peptidderivate mit biologischer Aktivität.The present invention relates to peptides and peptide derivatives with biological activity.

US 5,298,604 betrifft das humane antineoplastische Urin­ protein (ANUP), bei dem der N-Terminus durch Pyroglutamat­ säure blockiert ist, das ein Molekulargewicht von 16 KD und die N-terminale Sequenz LKCYTCKEPMT (T or S?) AAX? aufweist.US 5,298,604 relates to human antineoplastic urine protein (ANUP) in which the N-terminus is caused by pyroglutamate is blocked, the molecular weight of 16 KD and the N-terminal sequence LKCYTCKEPMT (T or S?) AAX? having.

Sloane und Davis beschreiben in Tumor Targeting 2 (1996), S. 322-326, ein als ANUP bezeichnetes Protein, das N- terminal durch Pyroglutamat blockiert ist und die Sequenz LKCYTCKEPMT (T or S?) AA und eine Molekulargewicht von 15 KDa aufweist.Sloane and Davis describe in Tumor Targeting 2 (1996), Pp. 322-326, a protein called ANUP, the N- is blocked by pyroglutamate and the sequence LKCYTCKEPMT (T or S?) AA and a molecular weight of 15 KDa having.

Es wurden Peptide mit der Aminosäuresequenz der Formel gemäß Anspruch 1 gefunden,
worin
R1 NH2, eine Aminosäure, ein Peptid mit bis zu 100 Amino­ säuren oder ein Derivat davon darstellt,
Y1, Y2 Aminosäuren sind, die unabhängig voneinander aus der Gruppe Cystein, Asparaginsäure, Glutaminsäure, Lysin und Or­ nithin gewählt werden
und seine cyclischen, glykosylierten, phosphorylierten, acetylierten, amidierten und/oder Verknüpfungen von Seiten­ ketten enthaltende Derivate sowie Fragmente mit der bio­ logischen Aktivität von ANUP. Peptides with the amino acid sequence of the formula according to claim 1 were found
wherein
R 1 represents NH 2 , an amino acid, a peptide with up to 100 amino acids or a derivative thereof,
Y 1 , Y 2 are amino acids which are selected independently of one another from the group of cysteine, aspartic acid, glutamic acid, lysine and ornithine
and its cyclic, glycosylated, phosphorylated, acetylated, amidated and / or linkage-containing derivatives and fragments with the biological activity of ANUP.

R1 besteht bevorzugterweise aus ein oder zwei Aminosäuren oder Aminosäure-Derivaten.R 1 preferably consists of one or two amino acids or amino acid derivatives.

Die erfindungsgemäßen Peptide können als Y1 und Y2 Cystein enthalten, jedoch können als Y1 auch Aminosäuren mit einer Carboxylgruppe in der Seitenkette eingesetzt werden, insbe­ sondere Asparaginsäure oder Glutaminsäure, wenn Y2 eine Aminosäure ist, die eine Aminogruppe in der Seitenkette trägt, insbesondere Lysin oder Ornithin. Es kann jedoch auch bevorzugt sein, daß Y2 eine Aminosäure mit einer Carboxyl­ gruppe in der Seitenkette, insbesondere Asparaginsäure oder Glutaminsäure ist, und Y1 eine Aminosäure ist, die eine Aminogruppe in der Seitenkette trägt, insbesondere Lysin oder Ornithin.The peptides according to the invention can contain cysteine as Y 1 and Y 2 , but amino acids with a carboxyl group in the side chain can also be used as Y 1 , in particular aspartic acid or glutamic acid when Y 2 is an amino acid which carries an amino group in the side chain, especially lysine or ornithine. However, it may also be preferred that Y 2 is an amino acid with a carboxyl group in the side chain, especially aspartic acid or glutamic acid, and Y 1 is an amino acid that carries an amino group in the side chain, especially lysine or ornithine.

Dabei wird insbesondere bevorzugt, daß die Seitenketten von Y1 und Y2 kovalent verbunden sind durch Disulfidbrücken, die aus den Cysteinen gebildet werden oder durch Amidbindung zwischen den Carboxyl- und Aminogruppen der Seitenketten von Y1 und Y2.It is particularly preferred that the side chains of Y 1 and Y 2 are covalently linked by disulfide bridges which are formed from the cysteines or by amide bond between the carboxyl and amino groups of the side chains of Y 1 and Y 2 .

Die erfindungsgemäßen Peptide lassen sich aus humanem Blut­ filtrat oder Urin aufreinigen oder durch Festphasenpeptid­ synthese oder rekombinante Expression in Mikroorganismen her­ stellen.The peptides according to the invention can be obtained from human blood purify filtrate or urine or by solid phase peptide synthesis or recombinant expression in microorganisms put.

Insbesondere anti-Neoplastisches Urin-Peptid ANUP-I wurde aus menschlichem Blutfiltrat durch chromatographische Techniken isoliert. Die Primärstruktur des so gewonnenen Peptids konnte durch Methoden der Proteinsequenzierung nach Edman aufgeklärt werden und ergab folgende Sequenz:
In particular, anti-neoplastic urine peptide ANUP-I was isolated from human blood filtrate by chromatographic techniques. The primary structure of the peptide obtained in this way could be elucidated by methods of protein sequencing according to Edman and resulted in the following sequence:

Die Bestimmung des relativen Molekulargewichts durch Elektro­ spray-Massenspektrometrie von isoliertem ANUP-I aus mensch­ lichem Blutfiltrat ergab 8845 Da und stimmt mit dem be­ rechneten Molekulargewicht der bestimmten Aminosäuresequenz von 8843 Da überein. Ein Strukturmerkmal des Peptides ANUP-I besteht darin, daß alle in seiner Aminosäuresequenz ent­ haltenen Cysteinreste Bestandteile von Disulfidbrücken sind. Aus menschlichem Urin konnte ein identisches Peptid isoliert werden.Determination of the relative molecular weight by electro Spray mass spectrometry of isolated human ANUP-I blood filtrate resulted in 8845 Da and agrees with the be calculated molecular weight of the determined amino acid sequence out of 8843. A structural feature of the ANUP-I peptide is that all ent in its amino acid sequence cysteine residues are components of disulfide bridges. An identical peptide was isolated from human urine become.

Das erfindungsgemäße Peptid ANUP-I hat eine partielle Homo­ logie mit einem von Ridge und Sloane publizierten anti­ neoplastischen Urinpeptid (R. J. Ridge & N. H. Sloane, Cytokine 8 (1996), 1-5).The peptide ANUP-I according to the invention has a partial homo logic with an anti published by Ridge and Sloane neoplastic urine peptide (R.J. Ridge & N.H. Sloane, Cytokine 8 (1996), 1-5).

Die erfindungsgemäßen Peptide eignen sich insbesondere zur Herstellung eines Arzneimittels zur Behandlung der Über- oder Unterexpression von ANUP, von Krebserkrankungen, wie Krebs­ erkrankungen des Gebärmutterhalses, das kleinzellige Bronchialkarzinom, Pankreaskarzinom, Mammakarzinom und Melanome sowie bakterielle Infekten, Autoimmunerkrankungen, angioneurotisches Ödem, Asthma bronchiale und paroxysmale nächtliche Hämoglobinurie.The peptides according to the invention are particularly suitable for Manufacture of a medicament to treat excess or Under-expression of ANUP, cancers such as cancer diseases of the cervix, the small cell Bronchial carcinoma, pancreatic carcinoma, breast carcinoma and Melanoma and bacterial infections, autoimmune diseases, angioneurotic edema, bronchial asthma and paroxysmal nocturnal hemoglobinuria.

Eine weitere Ausführungsform der Erfindung stellen Arzneimit­ tel dar, die die erfindungsgemäßen Peptide in einer pharma­ zeutisch üblichen Darreichungsform enthalten.Another embodiment of the invention are pharmaceuticals tel represents the peptides according to the invention in a pharma  contain the usual dosage form.

Weitere bevorzugte Ausführungsformen der Erfindung sind Nukleinsäuren, die für die erfindungsgemäßen Peptide kodieren, Antisensenukleotide, die unter stringenten Be­ dingungen an Nukleinsäuresequenzen binden, die für die erfindungsgemäßen Peptide kodieren, Antikörper, die an die erfindungsgemäßen Peptide binden, Inhibitoren, die die biologische Aktivität der erfindungsgemäßen Peptide hemmen und Inhibitoren, die die Expression von ANUP hemmen sowie transgene Säugetiere mit Gendefizienz für ANUP, die sich insbesondere zur Tumorforschung eignen, zur Untersuchung des Einflusses von ANUP auf die Bildung und Entwicklung von Tumoren. Further preferred embodiments of the invention are Nucleic acids for the peptides according to the invention encode antisense nucleotides, which under stringent Be bind conditions to nucleic acid sequences necessary for the encode peptides according to the invention, antibodies to the Peptides of the invention bind inhibitors that the inhibit biological activity of the peptides according to the invention and inhibitors that inhibit the expression of ANUP as well transgenic mammals with gene deficiency for ANUP who are are particularly suitable for tumor research, for examining the Influence of ANUP on the formation and development of Tumors.  

SEQUENZPROTOKOLL SEQUENCE LOG

Claims (14)

1. Peptid mit einer Aminosäuresequenz der Formel
worin
R1 NH2, eine Aminosäure, ein Peptid mit bis zu 100 Aminosäuren oder ein Derivat davon darstellt,
Y1, Y2 Aminosäuren sind, die unabhängig voneinander aus der Gruppe Cystein, Asparaginsäure, Glutaminsäure, Lysin und Ornithin gewählt werden
und seine cyclischen, glykosylierten, phosphory­ lierten, acetylierten, amidierten und/oder Verknüpfung von Seitenketten enthaltende Derivate mit der biologischen Aktivität von ANUP.1. Peptide with an amino acid sequence of the formula
wherein
R 1 represents NH 2 , an amino acid, a peptide with up to 100 amino acids or a derivative thereof,
Y 1 , Y 2 are amino acids which are selected independently of one another from the group of cysteine, aspartic acid, glutamic acid, lysine and ornithine
and its cyclic, glycosylated, phosphorylated, acetylated, amidated and / or linkage-containing derivatives containing the biological activity of ANUP. 2. Peptid gemäß Anspruch 1, dadurch gekennzeichnet, daß Y1 und Y2 Cystein sind.2. Peptide according to claim 1, characterized in that Y 1 and Y 2 are cysteine. 3. Peptid gemäß einem der Ansprüche 1 und/oder 2, dadurch gekennzeichnet, daß
Y1 Asparagin- oder Glutaminsäure ist und Y2 Lysin oder Ornithin ist oder
Y2 Asparaginsäure oder Glutaminsäure ist und Y1 Lysin oder Ornithin ist. 3. Peptide according to one of claims 1 and / or 2, characterized in that
Y 1 is aspartic or glutamic acid and Y 2 is lysine or ornithine or
Y 2 is aspartic acid or glutamic acid and Y 1 is lysine or ornithine. 4. Peptid gemäß mindestens einem der Ansprüche 1 bis 3, dadurch gekennzeichnet, daß die Seitenkette von Y1 und Y2 kovalent verbunden sind.4. Peptide according to at least one of claims 1 to 3, characterized in that the side chains of Y 1 and Y 2 are covalently linked. 5. Peptid nach Anspruch 1 mit der Sequenz ID No. 1, wobei SEQ ID No. 1 Bestandteil des Anspruchs ist.5. Peptide according to claim 1 with the sequence ID No. 1, where SEQ ID No. 1 is part of the claim. 6. Verfahren zur Herstellung von Peptiden gemäß mindestens einem der Ansprüche 1 bis 5 durch Aufreinigung aus humanem Blutfiltrat oder Urin, durch Festphasenpeptidsynthese oder rekombinante Expression in Mikroorganismen.6. Process for the preparation of peptides according to at least one of claims 1 to 5 Purification from human blood filtrate or urine Solid phase peptide synthesis or recombinant expression in microorganisms. 7. Nukleinsäure dadurch gekennzeichnet, daß sie für mindestens eins der Peptide gemäß Anspruch 1 bis 5 kodiert.7. Nucleic acid characterized in that it is for at least one of the peptides according to claims 1 to 5 encoded. 8. Antisensenukleotid, dadurch gekennzeichnet, daß es unter stringenten Bedingungen an eine Nukleinsäure­ sequenz bindet, die für Peptide gemäß mindestens einem der Ansprüche 1 bis 5 kodiert.8. antisense nucleotide, characterized in that it to a nucleic acid under stringent conditions sequence binds for peptides according to at least encoded one of claims 1 to 5. 9. Antikörper, dadurch gekennzeichnet, daß er an Peptide gemäß mindestens einem der Ansprüche 1 bis 5 bindet.9. Antibody, characterized in that it is peptides binds according to at least one of claims 1 to 5. 10. Verwendung von Peptiden gemäß mindestens einem der Ansprüche 1 bis 5, Nukleinsäuren gemäß Anspruch 7, Antisensenukleotiden gemäß Anspruch 8 und/oder Antikörpern gemäß Anspruch 9 zur Behandlung von Über- und Unterexpression von ANUP-I, Krebserkrankungen, insbesondere Krebserkrankungen des Gebärmutterhalses, das kleinzellige Bronchialkarzinom, Pankreaskarzinom, Mammakarzinom und Melanome sowie bakterielle Infekten, Autoimmunerkrankungen, angioneurotisches Ödem, Asthma bronchiale und paroxysmale nächtliche Hämoglobinurie. 10. Use of peptides according to at least one of the Claims 1 to 5, nucleic acids according to claim 7, Antisense nucleotides according to claim 8 and / or Antibodies according to claim 9 for the treatment of hyper and under-expression of ANUP-I, cancer, especially cancer of the cervix, the small cell bronchial carcinoma, pancreatic carcinoma, Breast cancer and melanoma as well as bacterial Infections, autoimmune diseases, angioneurotic Edema, bronchial asthma and paroxysmal nocturnal Hemoglobinuria.   11. Arzneimittel enthaltend Peptide gemäß mindestens einem der Ansprüche 1 bis 5, Nukleinsäuren gemäß Anspruch 7, Antisensenukleotide gemäß Anspruch 8 und/oder Antikörper gemäß Anspruch 9 in einer pharmazeutisch üblichen Darreichungsform.11. Medicament containing peptides according to at least one of claims 1 to 5, nucleic acids according to Claim 7, antisense nucleotides according to claim 8 and / or antibodies according to claim 9 in one pharmaceutical dosage form. 12. Verwendung der Nukleinsäure gemäß Anspruch 7 zur Behandlung somatischer oder nicht-somatischer Generkrankung.12. Use of the nucleic acid according to claim 7 for Treatment somatic or non-somatic Genetic disease. 13. Transgenes Säugetier mit Gendefizienz für ANUP gemäß Anspruch 1.13. Transgenic mammal with gene deficiency for ANUP according to Claim 1. 14. Diagnostikmittel enthaltend mindestens ein Peptid gemäß Anspruch 1 bis 5, eine Nukleinsäure gemäß Anspruch 7, ein Antisensenukleotid gemäß Anspruch 8 und/oder einen Antikörper gemäß Anspruch 9.14. Diagnostic agent containing at least one peptide according to claims 1 to 5, a nucleic acid according to Claim 7, an antisense nucleotide according to claim 8 and / or an antibody according to claim 9.
DE1997149073 1997-06-09 1997-11-06 New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals Expired - Fee Related DE19749073C1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
DE1997149073 DE19749073C1 (en) 1997-11-06 1997-11-06 New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals
PCT/EP1998/003460 WO1998056810A2 (en) 1997-06-09 1998-06-09 Lus-1 human protein, its production and use
AU85366/98A AU8536698A (en) 1997-06-09 1998-06-09 Lus-1 human protein, its production and use

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
DE1997149073 DE19749073C1 (en) 1997-11-06 1997-11-06 New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals

Publications (1)

Publication Number Publication Date
DE19749073C1 true DE19749073C1 (en) 1999-07-08

Family

ID=7847823

Family Applications (1)

Application Number Title Priority Date Filing Date
DE1997149073 Expired - Fee Related DE19749073C1 (en) 1997-06-09 1997-11-06 New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals

Country Status (1)

Country Link
DE (1) DE19749073C1 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5298604A (en) * 1992-07-27 1994-03-29 Sloane Nathan H Parital primary amino acid sequence of the antineoplastic protein (ANUP); a cytokine present in granulocytes

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5298604A (en) * 1992-07-27 1994-03-29 Sloane Nathan H Parital primary amino acid sequence of the antineoplastic protein (ANUP); a cytokine present in granulocytes

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
Cytokine 1996, Vol.8 No.1, S.1-5 *
Tumor targeting 1996, 2, S.322-226 *

Similar Documents

Publication Publication Date Title
KR910002692B1 (en) Fsh
DE69233191T2 (en) Cyclin Prad1 (Cyclin D1) and its cDNA
DE69734766T2 (en) Inhibitor and Stimulator of the Proliferation of Haematopoietic Stem Cells and Their Applications
US5180820A (en) Brain-derived neurotrophic factor
JP3445269B2 (en) Treatment of retinal neuronal disorders by application of insulin-like growth factors and analogs
DE69534310T2 (en) PTC GENES AND ITS USE
JPH10509415A (en) Conotoxin peptide
DE69934995T2 (en) FOR THE HUMAN GROWTH DIFFERENTIATION FACTOR ENCODING SEQUENCE AND POLYPEPTIDE WHICH IS CODED BY SUCH A DNA SEQUENCE AND METHOD FOR THE PRODUCTION THEREOF;
DE69932510T2 (en) VASKULARISIERUNGSINHIBITOREN
JPH07507446A (en) DNA encoding taurine and GABA transporter and its use
Darmer et al. Primary structure of the precursor for the sea anemone neuropeptide Antho-RFamide (less than Glu-Gly-Arg-Phe-NH2).
DE69736109T2 (en) DIFFERENTIATION INHIBITOR
US5633347A (en) Conotoxin peptides
US5595972A (en) Conotoxin peptides
DE69332798T2 (en) IKAROS: A REGULATORY GENE IN T-CELL DIFFERENTIATION
WO1993010232A1 (en) Lymphoid cd30-antigen
CA2351558A1 (en) Peptide fragments having cell death inhibitory activity
EP1287142B1 (en) Nucleic acid molecule comprising a nucleic acid sequence coding for an sdf-1 gamma chemokine, a neuropeptide precursor or at least one neuropeptide
AU675927B2 (en) Autotaxin: motility stimulating protein useful in cancer diagnosis and therapy
DE19749073C1 (en) New protein, LUS-I, and related nucleic acid, antibodies, inhibitors and transgenic animals
RU2186783C2 (en) Rabbit antiserum inhibiting transport of cationic amino acids and pharmaceutical composition comprising thereof
JPH04500603A (en) Cloned nephritis antigen
JPH11503909A (en) Conotoxin peptide
DE2804567C2 (en) Pentapeptides, process for their preparation and their use
DE2853002A1 (en) POLYPEPTIDES AND THE METHOD FOR MANUFACTURING THEM

Legal Events

Date Code Title Description
8100 Publication of the examined application without publication of unexamined application
D1 Grant (no unexamined application published) patent law 81
8364 No opposition during term of opposition
8339 Ceased/non-payment of the annual fee