DE10351471A1 - Polyvalent allergy vaccine - Google Patents
Polyvalent allergy vaccine Download PDFInfo
- Publication number
- DE10351471A1 DE10351471A1 DE10351471A DE10351471A DE10351471A1 DE 10351471 A1 DE10351471 A1 DE 10351471A1 DE 10351471 A DE10351471 A DE 10351471A DE 10351471 A DE10351471 A DE 10351471A DE 10351471 A1 DE10351471 A1 DE 10351471A1
- Authority
- DE
- Germany
- Prior art keywords
- allergen
- chimera
- allergens
- phl
- hybrid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 229960005486 vaccine Drugs 0.000 title claims description 33
- 206010020751 Hypersensitivity Diseases 0.000 title claims description 28
- 230000007815 allergy Effects 0.000 title claims description 25
- 208000026935 allergic disease Diseases 0.000 title claims description 13
- 239000013566 allergen Substances 0.000 claims abstract description 144
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 107
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 81
- 229920001184 polypeptide Polymers 0.000 claims abstract description 56
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 46
- 229960004784 allergens Drugs 0.000 claims description 59
- 108090000623 proteins and genes Proteins 0.000 claims description 30
- 102000004169 proteins and genes Human genes 0.000 claims description 29
- 241001465754 Metazoa Species 0.000 claims description 27
- 238000011282 treatment Methods 0.000 claims description 24
- 239000000203 mixture Substances 0.000 claims description 22
- 239000012634 fragment Substances 0.000 claims description 21
- 238000004519 manufacturing process Methods 0.000 claims description 19
- 239000000427 antigen Substances 0.000 claims description 16
- 102000036639 antigens Human genes 0.000 claims description 16
- 108091007433 antigens Proteins 0.000 claims description 16
- 210000004027 cell Anatomy 0.000 claims description 15
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 claims description 12
- 238000000034 method Methods 0.000 claims description 12
- 239000004816 latex Substances 0.000 claims description 11
- 229920000126 latex Polymers 0.000 claims description 11
- 108091033319 polynucleotide Proteins 0.000 claims description 11
- 239000002157 polynucleotide Substances 0.000 claims description 11
- 102000040430 polynucleotide Human genes 0.000 claims description 11
- 235000018185 Betula X alpestris Nutrition 0.000 claims description 10
- 235000018212 Betula X uliginosa Nutrition 0.000 claims description 10
- 238000002360 preparation method Methods 0.000 claims description 10
- 239000013574 grass pollen allergen Substances 0.000 claims description 9
- 241000894006 Bacteria Species 0.000 claims description 7
- 102000004127 Cytokines Human genes 0.000 claims description 7
- 108090000695 Cytokines Proteins 0.000 claims description 7
- 230000015572 biosynthetic process Effects 0.000 claims description 7
- 239000013575 birch pollen allergen Substances 0.000 claims description 6
- 235000014655 lactic acid Nutrition 0.000 claims description 6
- 239000004310 lactic acid Substances 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 5
- 238000003786 synthesis reaction Methods 0.000 claims description 5
- 238000002560 therapeutic procedure Methods 0.000 claims description 5
- 238000011321 prophylaxis Methods 0.000 claims description 4
- 230000001960 triggered effect Effects 0.000 claims description 4
- 244000025254 Cannabis sativa Species 0.000 claims description 3
- 239000002671 adjuvant Substances 0.000 claims description 3
- 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 claims description 2
- 239000003814 drug Substances 0.000 claims description 2
- 229940046528 grass pollen Drugs 0.000 claims description 2
- 230000002519 immonomodulatory effect Effects 0.000 claims description 2
- 230000008569 process Effects 0.000 claims description 2
- 206010001742 Allergy to animal Diseases 0.000 claims 1
- 208000007811 Latex Hypersensitivity Diseases 0.000 claims 1
- 206010039251 Rubber sensitivity Diseases 0.000 claims 1
- 206010048908 Seasonal allergy Diseases 0.000 claims 1
- 229940079593 drug Drugs 0.000 claims 1
- 201000005391 latex allergy Diseases 0.000 claims 1
- 102000006392 myotrophin Human genes 0.000 claims 1
- 108010058605 myotrophin Proteins 0.000 claims 1
- 201000004338 pollen allergy Diseases 0.000 claims 1
- 230000001105 regulatory effect Effects 0.000 claims 1
- 241000699670 Mus sp. Species 0.000 description 22
- 208000010668 atopic eczema Diseases 0.000 description 10
- 210000004989 spleen cell Anatomy 0.000 description 10
- 230000024664 tolerance induction Effects 0.000 description 10
- 102000001708 Protein Isoforms Human genes 0.000 description 9
- 108010029485 Protein Isoforms Proteins 0.000 description 9
- 230000000172 allergic effect Effects 0.000 description 9
- 229940046536 tree pollen allergenic extract Drugs 0.000 description 9
- 108010034983 Hev b 10 Proteins 0.000 description 8
- 210000003719 b-lymphocyte Anatomy 0.000 description 8
- 239000000428 dust Substances 0.000 description 8
- 210000004209 hair Anatomy 0.000 description 8
- 239000013573 pollen allergen Substances 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 101100243820 Caenorhabditis elegans phlp-2 gene Proteins 0.000 description 7
- 102100037850 Interferon gamma Human genes 0.000 description 7
- 108010074328 Interferon-gamma Proteins 0.000 description 7
- 102000004388 Interleukin-4 Human genes 0.000 description 7
- 108090000978 Interleukin-4 Proteins 0.000 description 7
- 230000016396 cytokine production Effects 0.000 description 7
- 239000000284 extract Substances 0.000 description 7
- 206010070834 Sensitisation Diseases 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 230000035755 proliferation Effects 0.000 description 6
- 230000008313 sensitization Effects 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 230000000903 blocking effect Effects 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 101100243399 Caenorhabditis elegans pept-2 gene Proteins 0.000 description 4
- 101100316805 Caenorhabditis elegans spe-5 gene Proteins 0.000 description 4
- 241000746981 Phleum Species 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 239000006285 cell suspension Substances 0.000 description 4
- 210000003630 histaminocyte Anatomy 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 210000003491 skin Anatomy 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- 108010061629 Dermatophagoides pteronyssinus antigen p 1 Proteins 0.000 description 3
- 108010002616 Interleukin-5 Proteins 0.000 description 3
- 102000000743 Interleukin-5 Human genes 0.000 description 3
- 206010028164 Multiple allergies Diseases 0.000 description 3
- 108091008874 T cell receptors Proteins 0.000 description 3
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 230000031261 interleukin-10 production Effects 0.000 description 3
- 230000017307 interleukin-4 production Effects 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 241000208199 Buxus sempervirens Species 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 108010062580 Concanavalin A Proteins 0.000 description 2
- 206010010741 Conjunctivitis Diseases 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 206010062717 Increased upper airway secretion Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 101710171134 Protein Bet Proteins 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 230000006052 T cell proliferation Effects 0.000 description 2
- 230000003187 abdominal effect Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 229940074608 allergen extract Drugs 0.000 description 2
- 230000002052 anaphylactic effect Effects 0.000 description 2
- 208000003455 anaphylaxis Diseases 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 208000006673 asthma Diseases 0.000 description 2
- 210000003651 basophil Anatomy 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000004140 cleaning Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 229940028885 interleukin-4 Drugs 0.000 description 2
- 230000022023 interleukin-5 production Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 102000013415 peroxidase activity proteins Human genes 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- 208000026435 phlegm Diseases 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 210000003462 vein Anatomy 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- -1 1,1,3,3-tetramethyluronium hexafluorophosphate Chemical compound 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 206010002199 Anaphylactic shock Diseases 0.000 description 1
- 206010003645 Atopy Diseases 0.000 description 1
- 206010063659 Aversion Diseases 0.000 description 1
- COXVTLYNGOIATD-HVMBLDELSA-N CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O Chemical compound CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O COXVTLYNGOIATD-HVMBLDELSA-N 0.000 description 1
- 101100004297 Caenorhabditis elegans bet-1 gene Proteins 0.000 description 1
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 1
- 108010055622 Dermatophagoides farinae antigen f 1 Proteins 0.000 description 1
- 108010061608 Dermatophagoides pteronyssinus antigen p 2 Proteins 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- 102000009438 IgE Receptors Human genes 0.000 description 1
- 108010073816 IgE Receptors Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- BZLVMXJERCGZMT-UHFFFAOYSA-N Methyl tert-butyl ether Chemical compound COC(C)(C)C BZLVMXJERCGZMT-UHFFFAOYSA-N 0.000 description 1
- 241000208125 Nicotiana Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 241000746983 Phleum pratense Species 0.000 description 1
- 241000209049 Poa pratensis Species 0.000 description 1
- 241000209504 Poaceae Species 0.000 description 1
- 229920000361 Poly(styrene)-block-poly(ethylene glycol) Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 241000238711 Pyroglyphidae Species 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 206010040914 Skin reaction Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 206010045240 Type I hypersensitivity Diseases 0.000 description 1
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000013567 aeroallergen Substances 0.000 description 1
- 230000002009 allergenic effect Effects 0.000 description 1
- 230000037446 allergic sensitization Effects 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 230000007503 antigenic stimulation Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 208000010216 atopic IgE responsiveness Diseases 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 230000009849 deactivation Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000003112 degranulating effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 229960003699 evans blue Drugs 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 230000009123 feedback regulation Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000013568 food allergen Substances 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 229940046533 house dust mites Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 150000002617 leukotrienes Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000001589 lymphoproliferative effect Effects 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 238000010397 one-hybrid screening Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 238000002203 pretreatment Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 206010039083 rhinitis Diseases 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 231100000430 skin reaction Toxicity 0.000 description 1
- 230000035483 skin reaction Effects 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 229940043517 specific immunoglobulins Drugs 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 230000003614 tolerogenic effect Effects 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- 230000002227 vasoactive effect Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Botany (AREA)
- Pulmonology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Polypeptide, bestehend aus einer Vielzahl von immundominanten T-Zell-Epitopen von Allergenen, die geeignet sind, verschiedene Allergene gleichzeitig zu behandeln.Polypeptides consisting of a variety of immunodominant T-cell epitopes of allergens capable of treating different allergens simultaneously.
Description
Die Erfindung betrifft neue Polypeptide, die insbesonders geeignet sind, verschiedene Allergien gleichzeitig behandeln zu können. Des weiteren betrifft die vorliegende Erfindung eine Verwendung der Polypeptide zur Herstellung einer Vakzine zur Behandlung allergischer Erkrankungen.The Invention relates to novel polypeptides which are particularly suitable to treat different allergies at the same time. Of Furthermore, the present invention relates to a use of Polypeptides for the preparation of a vaccine for the treatment of allergic Diseases.
Typ 1 Allergie ist die Bezeichnung für den Zustand einer immunologisch bedingten Überempfindlichkeitsreaktion vom Soforttyp gegen Substanzen (Allergene), gegen die normalerweise keine Sensibilisierung vorliegt.Type 1 allergy is the name for the condition of an immunological hypersensitivity reaction of immediate type against substances (allergens), against which normally there is no sensitization.
Es werden vier Typen von Überempfindlichkeitsreaktionen unterschieden, von denen Typ I-III durch Antikörper mediiert werden und nur die Typ IV Reaktion von sensibilisierten T-Zellen ausgelöst wird.It Become four types of hypersensitivity reactions of which type I-III are mediated by antibodies and only the type IV reaction is triggered by sensitized T cells.
Die Typ I Reaktion, oder auch Hypersensibilitätsreaktion vom Soforttyp, wird durch IgE Antikörper vermittelt. Im Rahmen der Sensibilisierungsphase mit Allergenen werden spezifische IgE Antikörper von B-Zellen gebildet, die vor allem unter dem Einfluss von Botenstoffen von T-Helfer 2 Zellen (Interleukin 4, 5, 13) entstehen. Beim Allergiker besteht ein genetische Neigung diese Botenstoffe – Zytokine – in einem Übermaß zu produzieren, wodurch dann auch eine übermäßig hohe Konzentration an IgE Antikörpern entstehen kann. Diese IgE Antikörper werden dann an Mastzellen und Basophilen an die Fc-ε Rezeptoren gebunden.The Type I reaction, or immediate hypersensitivity reaction, becomes by IgE antibodies taught. As part of the sensitization phase with allergens become specific IgE antibodies formed by B cells, especially under the influence of messenger substances T helper 2 cells (interleukin 4, 5, 13) arise. When allergic there is a genetic tendency to produce these messengers - cytokines - in an excess which then also an excessively high Concentration of IgE antibodies can arise. These IgE antibodies are then attached to mast cells and basophils to the Fc-ε receptors bound.
Bei einem erneuten Kontakt mit dem/den Allergenen werden die Allergene an die mastzellständigen IgE gebunden und führen zu einer Kreuzvernetzung der IgE-Antikörper, wodurch es zur Degranulierung der Mastzellen und Basophilen mit Ausschüttung von vasoaktiven Substanzen (Histamin, Leukotriene etc.) kommt. Dadurch kommt es zu den typischen allergischen Symptomen, die von Heuschnupfen über Konjunktivitis, Asthma bronchiale bis hin zum anaphylaktischen Schock reichen können.at Renewed contact with the allergen (s) will cause the allergens to the mast cell-bound IgE tied and lead cross-linking the IgE antibodies, thus allowing it to degranulate mast cells and basophils with release of vasoactive substances (Histamine, leukotrienes etc.) comes. This leads to the typical allergic symptoms ranging from hay fever to conjunctivitis, asthma can range from bronchial to anaphylactic shock.
Zu den wichtigsten Aeroallergenen (es gibt natürlich auch Nahrungsmittelallergene, die aber viel seltener zu allergischen Erkrankungen führen wie Inhalationsallergene) gehören Baum- und Gräserpollen, Tierhaare- und Proteine, Hausstaubmilben, Latexallergene etc.To the most important aeroallergens (of course there are also food allergens, but they are much less likely to cause allergic diseases Inhalation allergens) Tree and grass pollen, Animal hair and proteins, house dust mites, latex allergens etc.
Etwa 20 % der Bevölkerung leidet an Typ I Allergien, wobei ein Grossteil der Betroffenen nicht nur gegen ein Allergen, sondern gegen verschieden Allergene gleichzeitig sensibilisiert ist ("Poly-Allergiker").Approximately 20% of the population suffers from type I allergies, with a majority of those affected not only against one allergen, but against different allergens at the same time sensitized ("poly-allergic").
Die Therapie der Wahl (und einzige kausale Behandlung) ist die spezifische Immuntherapie, kurz SIT. Dabei werden in steigender Dosierung Allergenextrakte dem Patienten gespritzt, damit dieser hyposensibilisiert wird, sprich geringer bis gar nicht auf das jeweilige Allergen reagiert. Diese Form der Behandlung kann zwar sehr erfolgreich sein, allerdings vor allem dann, wenn es sich um junge und monosensibilisierte Personen handelt, d.h. Patienten, die bevorzugt nur auf ein Allergen allergisch sind. Weitere Nachteile dieser Behandlung sind, dass die Behandlung mehrere Jahre dauert, dass es manchmal zu anaphylaktischen Nebenwirkungen kommen kann, und dass die Behandlung durch Spritzen erfolgt, wovor sehr viele Patienten – besonders Kinder – eine große Abneigung zeigen.The Therapy of choice (and only causal treatment) is the specific one Immunotherapy, in short SIT. In this case, in increasing dosage allergen extracts injected to the patient so that it is hyposensitized, speak less or not at all responds to the respective allergen. These Although the form of treatment can be very successful, it does especially when it comes to young and monosensitized persons, i.e. Patients who are allergic to only one allergen. Other disadvantages of this treatment are that the treatment is multiple It may take years for anaphylactic side effects to occur can, and that the treatment is done by spraying, what a lot many patients - especially Children - one size Show aversion.
Des weiteren ist zu beachten, dass derzeit nach den internationalen Richtlinien zur Immuntherapie von der Behandlung Polysensibilisierter ausdrücklich abgeraten wird, vor allem wegen zu geringem Behandlungserfolg und gesteigertem Risiko für anaphylaktische Nebenreaktionen während der Behandlung.Of Further, it should be noted that currently according to the international Guidelines for immunotherapy of polysensitized treatment expressly is discouraged, especially because of low treatment success and increased risk for anaphylactic side reactions during treatment.
Durch zahlreiche Publikationen (Wiedermann U et al, 1999; J. Allergy Clin Immunol; 103: p 93; Garside P, 1999 Gut; 44: p 137; Lowrey J et al 1998; Int. Arch. Allergy Immunol; 116: 93.) ist bekannt, dass durch die mukosale Applikation von einem rekombinanten Allergen die allergische Sensibilisierung mit dem selben Allergen verhindert werden kann – es kann also erfolgreich eine Prophylaxe wie auch eine Therapie gegen eine Allergie erzielt werden.By numerous publications (Wiedermann U et al, 1999, J. Allergy Clin Immunol; 103: p 93; Garside P, 1999 Good; 44: p 137; Lowrey J et al 1998; Int. Arch. Allergy Immunol; 116: 93.) it is known that by the mucosal application of a recombinant allergen prevents allergic sensitization with the same allergen can be - it So it can successfully be a prophylaxis as well as a therapy against an allergy can be achieved.
Des weiteren wird versucht, eine Behandlung von Allergien durch die Induktion von sogenannten blockierenden Antikörpern (meist IgG) zu erreichen. Diese blockierenden Antikörper sollen das jeweilige Antigen/Allergen abfangen damit es nicht mehr an mastzellständige IgE-Antikörper binden kann. Zur Induktion dieser IgG-Antikörper werden zumeist B-Zellepitope, oder Konstrukte, die diese enthalten, herangezogen.Of Another is trying to get a treatment for allergies through the Induction of so-called blocking antibodies (mostly IgG) to achieve. These blocking antibodies should intercept the respective antigen / allergen so that it no longer at mastzellständige Bind IgE antibodies can. For the induction of these IgG antibodies are mostly B-cell epitopes, or constructs containing them.
Aus
Aufgabe der vorliegenden Erfindung ist es daher, neue Polypeptide bereitzustellen, die es erlauben, mehrere Allergien behandeln zu können.task It is therefore an object of the present invention to provide novel polypeptides. which allow to treat multiple allergies.
Des weiteren ist es Aufgabe der Erfindung, Polypeptide bereitzustellen, die es erlauben, mehrere Allergien gleichzeitig, insbesondere Allergien, die durch nicht kreuzreagierenden Allergene ausgelöst werden, behandeln zu können.Of Another object of the invention is to provide polypeptides, which allow multiple allergies at the same time, especially allergies, which are triggered by non-cross-reacting allergens to be able to.
Darüber hinaus ist es Aufgabe der vorliegenden Erfindung bevorzugt über die Schleimhaut eine Prophylaxe und/oder Therapie gegen mehrere Allergien gleichzeitig durchführen zu können.Furthermore it is an object of the present invention preferably via the Mucosa a prophylaxis and / or therapy against multiple allergies perform at the same time to be able to.
Der Erfindung liegt die Erkenntnis zugrunde, daß dies durch neuartige Hybridpolypeptide und/oder Chimärantigene erreicht werden kann.Of the The invention is based on the finding that this is due to novel hybrid polypeptides and / or chimeric antigens can be achieved.
Die Aufgabe wird erfindungsgemäß durch ein Hybridpolypeptid gelöst, welches eine Vielzahl von immundominanten T-Zell-Epitopen von Allergenen umfasst, wobei zumindest zwei von den Allergenen nicht miteinander kreuzreagieren.The Task is achieved by solved a hybrid polypeptide, which is a multitude of immunodominant T-cell epitopes of allergens wherein at least two of the allergens do not interact with each other cross-react.
Eine bekannte Vorgehensweise bei der Behandlung von Allergikern ist es, wie oben erwähnt, die Induktion von blockierenden Antikörpern zu erreichen.A known approach in the treatment of allergy sufferers is as mentioned above, to achieve the induction of blocking antibodies.
Das Grundkonzept der vorliegenden Erfindung liegt dagegen darin, dass die Hybridpolypeptide, die immundominante T-Zell-Epitope von verschiedenen Allergenen umfassen, bei mukosaler Applikation zu einer antigenspezifischen Nichtreaktivität führen, d.h. eine mukosale Toleranz bewirken, die durch Deletion, Anergie von Antigen/Allergen-spezifischen T-Zellen durch die Produktion von suppressiv-wirksamen Zytokinen von sogenannten regulatorischen T-Zellen oder durch Immunmodulation (Th1 > Th2-Zellen) erreicht wird. Durch das Fehlen der notwendingen Zytokine wird in der Folge auch die Bildung von antigen-spezifischen Antikörpern unterbunden. Es wird somit eine Unterdrückung der unerwünschten Immunantworten gegen die jeweiligen Allergene erreicht.The basic concept of the present invention, on the other hand, is that the hybrid polypeptides comprising immunodominant T cell epitopes of different allergens, when administered mucosally, lead to antigen-specific non-reactivity, ie cause mucosal tolerance caused by deletion, anergy of antigen / allergen. specific T cells by the production of suppressive cytokines of so-called regulatory T cells or by immunomodulation (Th 1 > Th 2 cells) is achieved. Due to the absence of the necessary cytokines, the formation of antigen-specific antibodies is subsequently prevented as well. It is thus achieved a suppression of unwanted immune responses to the respective allergens.
Dabei wird unter einem Hybridpolypeptid ein Polypeptid verstanden, das eine Vielzahl von immundominanten T-Zell-Epitope aufweist. Es ist bevorzugt, daß das Hybridpolypeptid aus zumindest fünf immundominanten T-Zell-Epitopen, mehr bevorzugt aus zumindest vier immundominanten T-Zell-Epitopen und am meisten bevorzugt aus zumindest drei immundominanten T-Zell-Epitopen besteht. Bevorzugt ist des weiteren, daß das Hybridpolypeptid nur aus T-Zell-Epitopen besteht.there By a hybrid polypeptide is meant a polypeptide which has a variety of immunodominant T-cell epitopes. It is preferred that the Hybrid polypeptide of at least five immunodominant T-cell epitopes, more preferably at least four immunodominant T-cell epitopes and most preferably from at least three immunodominant T-cell epitopes consists. It is further preferred that the hybrid polypeptide only consists of T-cell epitopes.
Unter einem Allergen versteht man eine normalerweise harmlose Substanz, die befähigt ist in einem Allergiker bzw. Atopiker die Bildung von IgE Antikörpern zu induzieren und bei erneutem Kontakt allergische Symptome vom Soforttyp (Rhinitis, Konjunktivitis, Asthma etc.) auszulösen. Es handelt sich dabei um ganze Proteine oder Proteinfragmente bzw. Peptide von unterschiedlich langer Aminosäuresequenz.Under An allergen is a normally harmless substance which empowers is in an allergic person or atopic the formation of IgE antibodies too induce allergic symptoms of immediate type on renewed contact (Rhinitis, conjunctivitis, asthma etc.). These are to whole proteins or protein fragments or peptides of different long amino acid sequence.
Unter Epitop versteht man eine bestimmte Region am oder im Protein – meist von 10-20 Aminosäuren Länge, die entweder von spezifischen Immunglobulinen (Antikörpern) von B-Zellen erkannt werden kann und/oder von T-Zellen (bzw. deren spezifischen T-Zellrezeptoren) erkannt werden. In der Regel erkennen Antikörper Epitope auf der Tertiärstruktur von Proteinen, sie werden daher B-Zellepitope genannt. Diese B-Zellepitope entsprechen entweder sogenannten Konformationsepitopen oder linearen Epitopen, die an der Oberfläche gelegen sind und für Antikörper leicht zugängig sind. Im Unterschied dazu sind die T-Zellepitope, die von den T-Zellrezeptoren von spezifischen T-Zellen erkannt werden, immer linear Epitope und nicht nur an der Oberfläche des Moleküls gelegen, sondern können beliebig innerhalb der gesamten Sequenz des Moleküls verteilt liegen. Die T-Zelleptitope werden erst dann für T-Zellen zugängig, wenn das Allergen von Antigen-präsentierenden Zellen aufgenommen wurde, prozessiert und mittels MHC-Klasse II Molekülen an die T-Zellen bzw. deren T-Zellrezeptor dargereicht wurde.Under Epitope is a specific region on or in the protein - usually of 10-20 amino acids in length, the either recognized by specific immunoglobulins (antibodies) from B cells and / or of T cells (or their specific T cell receptors) be recognized. In general, antibodies recognize epitopes on the tertiary structure of proteins, they are called B-cell epitopes. This B-cell epitope correspond to either so-called conformation epitopes or linear Epitopes on the surface are located and for antibody easily accessible are. In contrast, the T cell epitopes are different from the T cell receptors be recognized by specific T cells, always linear epitopes and not just on the surface of the molecule located but you can distributed as desired throughout the entire sequence of the molecule lie. The T cell epitopes become accessible to T cells only when the allergen of antigen-presenting Cells was recorded, processed and using MHC class II molecules to the T cells or their T cell receptor was presented.
Zu meist haben B-Zellepitope und T-Zellepitope unterschiedliche Lokalisationen innerhalb des Moleküls, und daher werden T-Zellepitope (in der Regel) nicht von Antikörpern erkannt oder gebunden. Das bedeutet, wenn man einen Allergiker, der bereits spezifische Antiköper gebildet hat, mit einer Substanz behandelt, die ein T-Zellepitop darstellt, dann besteht nicht die Gefahr, dass diese T-Zellepitope von den Antikörpern gebunden werden. Daher besteht auch nicht die Gefahr für anaphylaktische Reaktionen während der Behandlung. (Dies ist nicht der Fall, wenn die behandelnde Substanz ein B-Zellepitop darstellt oder enthält).To most B-cell epitopes and T-cell epitopes have different locations within the molecule, and therefore, T-cell epitopes are (usually) not recognized by antibodies or tied. That means if you have an allergic person already specific antibodies has been treated with a substance that is a T cell epitope represents then there is no danger that these T-cell epitopes from the antibodies be bound. Therefore, there is also no danger for anaphylactic Reactions during the treatment. (This is not the case if the treating substance represents or contains a B-cell epitope).
Eine weitere Bedingung ist, daß T-Zell-Epitope von mindestens zwei Allergenen verwendet werden, die nicht miteinander kreuzreagieren. Eine Kreuzreaktion tritt z.B. auf als Reaktion auf Antigene verwandter Bakterien, wenn bestimmte Untereinheiten innerhalb ihres "Antigenmosaiks" identisch sind. Gleiches kann sich bei Eiweißkörpern verwandter Tierarten und bei künstlich konjugierten Antigenen (mit Strukturähnlichkeiten der angekoppelten Haptene) ereignen.A Another condition is that T-cell epitopes be used by at least two allergens that are not together cross-react. A cross reaction occurs e.g. on in response to Antigens of related bacteria, if certain subunits within their "Antigen mosaic" are identical. The same can be related to protein bodies Animal species and artificial conjugated antigens (with structural similarities of the coupled Haptens).
Ein Vorteil von Hybridpolypeptiden aus T-Zell-Epitopen, die nicht miteinander kreuzreagieren, besteht darin, daß diese geeignet sind, mehrere Allergien, die nicht in ihrem Antigenmosaik identisch sind, gleichzeitig behandeln zu können.One Advantage of hybrid polypeptides from T cell epitopes that do not interact Cross react, is that they are suitable, several Treat allergies that are not identical in their antigenic mosaic at the same time to be able to.
Es ist bevorzugt, daß alle T-Zell-Epitope des Hybridpolypeptids von Allergenen stammen, die nicht miteinander kreuzreagieren. Dadurch besteht die Möglichkeit, eine Behandlung von Multi- oder Polyallergikern durchzuführen.It it is preferred that all T cell epitopes of the hybrid polypeptide are derived from allergens that do not cross-react with each other. This makes it possible to perform a treatment of multi- or polyallergics.
Es ist insbesondere bevorzugt, daß die verwendeten T-Zell-Epitope aus der Reihe der Baumpollenallergene, insbesondere Birkenallergene, bevorzugt Bet v 1, Bet v 1 Isoformen, wie beschrieben in Feneira, F et al 1997, Int. Arch Allergy Immunol: 113;125 und Bet v 1 Mutante, wie beschrieben in Ferreira F. et al 1998 FASEB:12:231, Gräserpollenallergene (bevorzugt Phlp 1, Phlp 2, Phlp 5, Phlp 6), Latexallergene (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und Tierallergene ausgewählt werden.It is particularly preferred that the used T cell epitopes from the tree pollen allergen family, especially birch allergens, preferably Bet v 1, Bet v 1 isoforms, as described in Feneira, F et al 1997, Int. Arch Allergy Immunol: 113, 125 and Bet v 1 mutant as described in Ferreira F. et al 1998 FASEB: 12: 231, grass pollen allergens (preferably Phlp 1, Phlp 2, Phlp 5, Phlp 6), latex allergens (preferred Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and animal allergens.
Es ist besonders bevorzugt, daß die Tierallergene Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2) sind.It is particularly preferred that the Animal allergenic animal hairs (preferably Fel d 1) and / or house dust mite allergens (preferably, the p 1, the p 2, the f 1, the f 2) are.
Es ist insbesondere bevorzugt, daß es sich bei dem Hybridpolypeptid um ein Hybridpolypeptid handelt, daß die T-Zell-Epitope von Gräserpollenallergenen (Phlp 1, Phlp 2, Phlp 5, Phlp 6) und/oder Tierallergenen, insbesondere Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2), und/oder Baumpollenallergene, insbesondere Birkenpollenallergenen (bevorzugt Bet v 1, Bet v 1 von Isoform oder Bet v 1 von Mutanten) umfaßt.It is particularly preferred that it the hybrid polypeptide is a hybrid polypeptide such that the T cell epitopes of grass pollen allergens (Phlp 1, Phlp 2, Phlp 5, Phlp 6) and / or animal allergens, in particular Animal hairs (preferably Fel d 1) and / or house dust mite allergens (preferably the p 1, the p 2, the f 1, the f 2), and / or tree pollen allergens, in particular birch pollen allergens (preferably Bet v 1, Bet v 1 of isoform or Bet v 1 of mutants).
Es ist noch mehr bevorzugt, daß das Hybridpolypeptid ein Hybrid ist, daß die T-Zell-Epitope von einem Graspollenallergen (bevorzugt Phlp 1, Phlp 2, Phlp 5, Phlp 6), von einem Baumpollenallergen, insbesondere Birkenpollenallergen (bevorzugt Bet v 1 Bet v 1 von Isoformen oder Bet v 1 von Mutanten), und von einem Latexallergen (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und/oder Tierallergen umfaßt. Es ist noch mehr bevorzugt, daß das Hybridpolypeptid nur aus T-Zell-Epitopen von Gräserallergenen (bevorzugt Phlp 1, Phlp 2, Phlp 5, Phlp 6), und/oder Baumpollenallergenen, insbesondere Birkenpollenallergenen (bevorzugt Ber v 1), und/oder Latexallergenen (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und/oder Tierallergenen besteht.It is even more preferred that the Hybrid polypeptide a hybrid is that the T-cell epitopes of a grass pollen allergen (preferably Phlp 1, Phlp 2, Phlp 5, Phlp 6) from a tree pollen allergen, especially birch pollen allergens (preferably Bet v 1 Bet v 1 of Isoforms or Bet v 1 of mutants), and of a latex allergen (preferably Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and / or animal allergens. It is even more preferred that the Hybrid polypeptide only from T-cell epitopes of grass allergens (preferably Phlp 1, Phlp 2, Phlp 5, Phlp 6), and / or tree pollen allergens, in particular Birch pollen allergens (preferably Ber v 1), and / or latex allergens (preferably Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and / or animal allergens.
Besonders
bevorzugt ist das Hybridpolypeptid mit folgender Aminosäuresequenz:
MGETLLRAVESYAGELELQFRRVKCKYTVATAPEVKYTVFETALKParticularly preferred is the hybrid polypeptide having the following amino acid sequence:
MGETLLRAVESYAGELELQFRRVKCKYTVATAPEVKYTVFETALK
Die Aufgabe wird erfindungsgemäß auch dadurch gelöst, daß ein Allergenchimär bereitgestellt wird, welches zumindest ein ganzes Protein und zumindest ein weiteres Allergenfragment umfaßt.The Task is inventively also characterized solved, the existence Allergenchimär which is at least one whole protein and at least another allergen fragment.
Unter einem Allergenchimär wird nach vorliegender Erfindung ein Polypeptid verstanden, welches zumindest aus einem vollständigen Protein besteht und welches durch gentechnische Herstellung zumindest ein weiteres Allergenfragment, bevorzugt zwei oder drei, in sich trägt.Under an allergen chimera is understood according to the present invention, a polypeptide which at least from a complete one Protein exists and which by genetic engineering at least another allergen fragment, preferably two or three, in itself wearing.
Solche Allergenchimäre sind besonders gut geeignet zu Behandlung von Allergien, da sie individuell auf den Allergiker abgestimmt werden können.Such Allergenchimäre are particularly suitable for treating allergies as they are can be individually tailored to the allergic person.
Es ist besonders bevorzugt, dass das Protein und/oder die Allergenfragmente, bevorzugt Proteinfragmente, nicht miteinander kreuzreagieren. Es ist insbesondere bevorzugt, daß das Protein und die integrierten Allergenfragmente, bevorzugt Proteinfragmente, alle miteinander nicht kreuzreagieren. Der Vorteil eines solchen Allergenchimärs liegt darin, daß ein Polyallergiker gleichzeitig gegen verschiedene Allergien behandelt werden kann und zwar auch gegen solche, die nicht miteinander kreuzreagieren.It is particularly preferred that the protein and / or the allergen fragments, preferably protein fragment elements, do not cross-react with each other. It is particularly preferred that the protein and the integrated allergen fragments, preferably protein fragments, do not all cross-react with each other. The advantage of such an allergen chimera is that a polyallergic can be treated simultaneously against various allergies, even those that do not cross-react with each other.
Des weiteren ist bevorzugt, daß es sich bei den Allergenfragmenten, bevorzugt Proteinfragmenten, um T-Zell-Epitope handelt. Der Vorteil eines solchen Allergenchimärs liegt darin, daß, wie oben beschrieben, nicht die Produktion von IgG-Antikörpern angeregt wird, sondern es zu einer Unterdrückung der Herstellung von IgE-Antikörpern durch Deaktivierung der Zytokinsynthese kommt. Ein weiterer Vorteil eines Allergenchimärs ist, daß es sich um ein Molekül mit Tertiärstruktur handelt, welches mit erhöhter Effiziens von Antigenpräsentierenden Zellen (z.B. Dedritenzellen, B-Zellen etc.) aufgenommen werden, prozessiert werden kann, und so die immundominanten Peptide an die spezifischen T-Zellen präsentiert werden können. Die Verwendung von Molekülen mit Tertiärstruktur bewirkt darüber hinaus, dass die tolerogene Wirkung erhöht werden kann.Of further it is preferred that it the allergen fragments, preferably protein fragments, are T-cell epitopes is. The advantage of such an allergen chimera is that, as above described, not the production of IgG antibodies is stimulated, but it is a repression the production of IgE antibodies by deactivation of cytokine synthesis. Another advantage is an allergen chimera, that it a molecule with tertiary structure act, which with increased Efficiencies of antigen presenting Cells (e.g., dendritic cells, B cells, etc.) are taken up, can be processed, and so the immunodominant peptides to the specific T cells are presented can be. The use of molecules with tertiary structure does over it In addition, the tolerogenic effect can be increased.
Es ist insbesondere bevorzugt, daß es sich bei dem ganzen Protein im Allergenchimär um ein Protein ausgewählt aus der Gruppe der Baumpollenallergene, insbesondere Birkenallergene (bevorzugt Bet v 1, Bet v 1 von Isoformen oder Bet v 1 von Mutanten), Gräserpollenallergene (bevorzugt Phlp 1, Phlp 2, Phlp 5, Phlp 6), Latexallergene (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und Tierallergene, insbesondere Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2), handelt. Es ist insbesondere bevorzugt, daß es sich bei dem Protein um ein Baumpollenallergen, insbesondere um ein Birkenallergen, und besonders bevorzugt um das Protein Bet v 1, Bet v 1 von Isoformen oder Bet v 1 von Mutanten handelt.It is particularly preferred that it the whole protein in the allergen chimera is selected from a protein the group of tree pollen allergens, especially birch allergens (preferably Bet v 1, Bet v 1 of isoforms or Bet v 1 of mutants), grass pollen allergens (preferably Phlp 1, Phlp 2, Phlp 5, Phlp 6), latex allergens (preferred Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and animal allergens, in particular animal hairs (preferred Fel d 1) and / or house dust mite allergens (preferably Der p 1, The p 2, the f 1, the f 2), acts. It is particularly preferred that it the protein is a tree pollen allergen, especially um a birch allergen, and more preferably the protein Bet v 1, Bet v 1 is isoforms or Bet v 1 is mutants.
Des weiteren ist bevorzugt, daß es sich bei den Allergenfragmenten um T-Zell-Epitope, ausgewählt aus der Gruppe bestehend aus Gräserpollenallergene (bevorzugt Phlp 1, Phlp 2, Phlp 5, Phlp 6), Latexallergene (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 4, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und Tierallergene, insbesondere Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2), handelt.Of further it is preferred that it the allergen fragments are T-cell epitopes selected from the group from grass pollen allergens (preferably Phlp 1, Phlp 2, Phlp 5, Phlp 6), latex allergens (preferred Hev b 1, Hev b 2, Hev b 3, Hev b 4, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and animal allergens, in particular animal hair (preferably Fel d 1) and / or house dust mite allergens (preferred The p 1, the p 2, the f 1, the f 2), act.
Es ist insbesondere bevorzugt, daß es sich bei den Allergenfragmenten, bevorzugt Proteinfragmenten, um T-Zell-Epitope von Gräserpollenallergene (bevorzugt Phlp 1, Phlp 2, Phlp 5, Phlp 6), und/oder Latexallergenen (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und/oder Tierallergene, insbesondere Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2), handelt und das vollständige Protein Bet v 1, Bet v 1 von Isoformen oder Bet v 1 von Mutanten ist.It is particularly preferred that it in the allergen fragments, preferably protein fragments to T cell epitopes of grass pollen allergens (preferably Phlp 1, Phlp 2, Phlp 5, Phlp 6), and / or latex allergens (preferably Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and / or animal allergens, in particular Animal hairs (preferably Fel d 1) and / or house dust mite allergens (preferably the p 1, the p 2, the f 1, the f 2), and the full Protein Bet v 1, Bet v 1 of isoforms or Bet v 1 of mutants is.
Es ist insbesondere bevorzugt, dass die Allergenchimärkonstrukte aus Bet v 1, Bet v 1 von Isoformen oder Bet v 1 von Mutanten und den immundominanten Peptiden von Phl p 1 und Phl p 5 bestehen. Folgende Konstrukte sind am meisten bevorzugt:It It is especially preferred that the allergen chimera constructs from Bet v 1, Bet v 1 from isoforms or Bet v 1 from mutants and consist of the immunodominant peptides of Phl p 1 and Phl p 5. Following constructs are most preferred:
Konstrukt
1 (Phl p 1 - Bet v 1a - Phl p 5) - Aminosäuresequenz 
Konstrukt
2 (Phl p 5 - Bet v 1a - Phl p 1) - Aminosäuresequenz 
Konstrukt
3 (Bet v 1a - Phl p 1 - Phl p 5) - Aminosäuresequenz 
Konstrukt
4 (Phl p 1 - Phl p 5 - Bet v 1a) - Aminosäuresequenz 
Die Erfindung umfaßt des weiteren Polynukleotide, die das Allergenchimär nach der vorliegenden Erfindung codieren. Durch die Degenerierung des genetischen Codes können verschiedene Polynukleotidmoleküle für ein einziges Allergenchimär codieren. Die Polynukleotide der vorliegenden Erfindung sind vorzugsweise ein Expressionskonstrukt um die Polypeptide nach der Expression in der Wirtszelle zu erhalten. Das Expressionskonstrukt kann weitere Komponenten enthalten, die zur Exprimierung notwendig sind und allgemeiner Stand der Technik darstellen, wie z.B. Promotorsequenzen, Gencodierungsresistenzfaktoren gegen bestimmte Antibiotika sowie ein Replikationsorigin.The Invention furthermore, polynucleotides carrying the allergen chimera after encode the present invention. By the degeneration of the genetic Codes can different polynucleotide molecules for a only allergen chimera encode. The polynucleotides of the present invention are preferably an expression construct around the polypeptides after expression to get in the host cell. The expression construct can have more Contain components that are necessary for expression and more general State of the art, e.g. Promoter sequences, gene coding resistance factors against certain antibiotics as well as a replication origin.
Konstrukt
1 (Phl p 1 - Bet v 1a - Phl p 5) - Nukleotidsequenz 
Konstrukt
2 (Phl p 5 - Bet v 1a - Phl p 1) - Nukleotidsequenz 
Konstrukt
3 (Bet v 1a - Phl p 1 - Phl p 5) - Nukleotidsequenz 
Konstrukt
4 (Phl p 1 - Phl p 5 - Bet v 1a) - Nukleotidsequenz 
Des weiteren umfaßt die Erfindung eine pharmazeutische Zusammensetzung, die ein Hybridpolypeptid und/oder ein Allergenchimär wie oben beschrieben, umfaßt.Of further comprises the invention a pharmaceutical composition comprising a hybrid polypeptide and / or an allergen chimera as described above.
Insbesondere handelt es sich um eine Vakzinzusammensetzung die zumindest ein Hybridpolypeptid und/oder ein Allergenchimär wie oben beschrieben, beinhaltet, welches löslich sein muß. Bei Applikation wird das Allergenchimär in physiologischer Kochsalzlösung gelöst und appliziert.Especially it is a vaccine composition which at least one Hybrid polypeptide and / or an allergen chimera as described above, which is soluble have to be. When applied, the allergen chimera is dissolved in physiological saline and applied.
Des weiteren ist bevorzugt, daß die Zusammensetzung, die das Hybridpolypeptid und/oder das Allergenchimär wie oben beschrieben umfasst, zur Behandlung einer allergischen Erkrankung geeignet ist.Of Further, it is preferred that the A composition comprising the hybrid polypeptide and / or the allergen chimera as above for the treatment of an allergic disease suitable is.
Des weiteren ist bevorzugt, daß die pharmazeutische Zusammensetzung, insbesondere Vakzine, ein mukosales Adjuvans und/oder Antigentransportsystem, wie zum Beispiel Milchsäurebakterien, umfaßt.Of Further, it is preferred that the pharmaceutical composition, in particular vaccine, a mucosal Adjuvant and / or antigen transport system, such as lactic acid bacteria, includes.
Bestimmte Milchsäurebakterien haben die Eigenschaft eine Thl Immunantwort zu induzieren. Dazu ist es zweckdienlich, Milchsäurebakterien als Expressionssystem zur Herstellung von Proteinen und Peptiden zu verwenden. Als mukosale (orale) Vakzine können derartige Milchsäurebakterien die Immunantwort so beeinflussen, dass die allergischen Reaktionen verhindert oder moduliert werden können. Daher umfaßt vorzugsweise die Vakzine zusätzlich Milchsäurebakterien um die Wirkung bei Applikation von Hybridpeptiden oder Allergenchimären zu verbessernCertain Lactic acid bacteria have the property to induce a Thl immune response. To it is convenient to lactobacilli as an expression system for the production of proteins and peptides to use. As a mucosal (oral) vaccine such lactic acid bacteria can to influence the immune response so that the allergic reactions can be prevented or modulated. Therefore, preferably the vaccine additionally Lactic acid bacteria to improve the effect when applying hybrid peptides or allergen chimeras
Weiterhin umfaßt die Erfindung die Verwendung eines Hybridpolypeptids und/oder eines Allergenchimärs wie oben beschrieben zur Herstellung eines Arzneimittels, insbesondere einer Vakzine. Es ist des weiteren bevorzugt, daß die Verwendung eines Hybridpolypeptids und/oder Allergenchimärs zur Herstellung einer Vakzine zur Behandlung von Allergien dient.Farther comprises the invention the use of a hybrid polypeptide and / or a Allergenchimärs as described above for the preparation of a medicament, in particular a vaccine. It is further preferred that the use of a hybrid polypeptide and / or allergen chimera for the preparation of a vaccine for the treatment of allergies.
Weiterhin wird bevorzugt, daß das Hybridpolypeptid und/oder das Allergenchimär wie oben beschrieben zur Herstellung einer Vakzine zur gleichzeitigen Behandlung von zumindest zwei verschiedenen Allergien verwendet wird.Farther it is preferred that the Hybrid polypeptide and / or allergen chimera as described above to Preparation of a vaccine for the simultaneous treatment of at least two different allergies is used.
Des weiteren ist bevorzugt, daß das Hybridpolypeptid und/oder das Allergenchimär zur Herstellung einer Vakzine zur gleichzeitigen Behandlung von zumindest zwei verschiedenen Allergien verwendet wird, wobei diese durch nicht miteinander kreuzreagierend Allergenen ausgelöst werden.Of Further, it is preferable that the Hybrid polypeptide and / or the allergen chimera for the production of a vaccine for the simultaneous treatment of at least two different allergies which are not cross-reactive with each other Allergens triggered become.
Insbesondere wird bevorzugt, daß bei der Verwendung der Hybridpolypeptide und/oder Allergenchimäre zur Herstellung einer Vakzine diese Hybridpolypeptide, Fragmente aufweisen, von zumindest zwei nicht miteinander kreuzreagierenden Allergenen, und/oder die Allergenchimäre Proteine und Fragmente aufweisen, von zumindest zwei nicht miteinander kreuzreagierenden Allergenen.Especially is preferred that at the use of the hybrid polypeptides and / or allergen chimeras for the production a vaccine containing these hybrid polypeptides, fragments of at least two non-cross-reactive allergens, and / or the allergen chimeras proteins and fragments of at least two non-cross-reacting Allergens.
Des weiteren wird bevorzugt, daß bei der Verwendung der Hybridpolypeptide und/oder Allergenchimäre zur Herstellung einer Vakzine Hybridpolypeptide nur aus Fragmenten und/oder die Allergenchimäre nur aus Proteinen und Fragmenten bestehen, die nicht miteinander kreuzreagieren.Of Another is preferred that at the use of the hybrid polypeptides and / or allergen chimeras for the production a vaccine hybrid polypeptides only from fragments and / or the Allergenchimäre only consist of proteins and fragments that are not together cross-react.
Es ist des weiteren bevorzugt, daß bei der Verwendung der Hybridpolypeptide und/oder Allergenchimäre zur Herstellung einer Vakzine die Hybridpolypeptide bzw. die Allergenchimäre T-Zell-Epitope der Allergene aufweisen.It is further preferred that at the use of the hybrid polypeptides and / or allergen chimeras for the production a vaccine, the hybrid polypeptides or the allergen chimeric T cell epitopes have the allergens.
Des weiteren wird bevorzugt, daß bei der Verwendung von Hybridpolypeptiden und/oder Allergenchimären zur Herstellung einer Vakzine es sich bei den Allergenfragmenten um T-Zell-Epitope, ausgewählt aus der Reihe bestehend aus Gräserpollenallergenen (bevorzugt Phl p 1, Phl p 2, Phl p 5, Phl p 6), Baumpollenallergenen, insbesondere Birkenpollenallergenen (bevorzugt Bet v 1, Bet v 1 von Isoformen oder Bet v 1 von Mutanten), Latexallergenen (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und Tierallergenen, insbesondere Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2), handelt.Of Another is preferred that at the use of hybrid polypeptides and / or allergen chimeras Manufacture of a vaccine to the allergen fragments around T-cell epitopes selected from the series consisting of grass pollen allergens (preferably Phl p 1, Phl p 2, Phl p 5, Phl p 6), tree pollen allergens, in particular birch pollen allergens (preferably Bet v 1, Bet v 1 of isoforms or Bet v 1 of mutants), latex allergens (preferred Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and animal allergens, in particular animal hairs (preferred Fel d 1) and / or house dust mite allergens (preferably Der p 1, The p 2, the f 1, the f 2), acts.
Des weiteren ist bevorzugt, daß bei der Verwendung von Allergenchimären zur Herstellung einer Vakzine es sich bei dem Protein um ein Protein ausgewählt aus der Gruppe bestehend aus Gräserpollenallergen (bevorzugt Phl p 1, Phl p 2, Phl p 5, Phl p 6), Baumpollenallergen, insbesondere Birkenpollenallergen (Bet v 1, Bet v 1 von Isoformen oder Bet v 1 von Mutanten), Latexallergen (bevorzugt Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) und Tierallergen, insbesondere Tierhaare (bevorzugt Fel d 1) und/oder Hausstaubmilbenallergenen (bevorzugt Der p 1, Der p 2, Der f 1, Der f 2), handelt.Of Another is preferred that at the use of allergen chimeras For the production of a vaccine the protein is a protein selected from the group consisting of grass pollen allergens (preferred Phl p 1, Phl p 2, Phl p 5, Phl p 6), tree pollen allergen, in particular Birch pollen allergen (Bet v 1, Bet v 1 of isoforms or Bet v 1 of mutants), latex allergen (preferably Hev b 1, Hev b 2, Hev b 3, Hev b 5, Hev b 6, Hev b 7, Hev b 8, Hev b 9, Hev b 10) and Animal allergens, in particular animal hairs (preferably Fel d 1) and / or Dust mite allergens (preferably Der p 1, Der p 2, Der f 1, The f 2), acts.
Des weiteren können Hybridpolypeptide und/oder Allergenchimäre, wie oben definiert, zur Herstellung einer Vakzine zur Behandlung von Allergien, insbesondere zur Behandlung von Allergien beruhend auf zwei nicht kreuzreagierenden Allergenen verwendet werden.Of others can Hybrid polypeptides and / or allergen chimeras, as defined above, for Production of a vaccine for the treatment of allergies, in particular for the treatment of allergies based on two non-cross-reactive Allergens are used.
Des weiteren ist bevorzugt, dass die Hybridpolypeptide und/oder Allergenchimäre zur Herstellung einer Vakzine so verwendet werden, dass sie zur Prophylaxe und/oder Therapie von Allergien, beruhend auf mindestens zwei nicht kreuzreagierenden Allergenen, verwendet werden kann.Of Further, it is preferred that the hybrid polypeptides and / or allergen chimeras for the preparation a vaccine can be used so that they are for prophylaxis and / or Therapy of allergies based on at least two non-cross-reactive Allergens, can be used.
Des weiteren ist bevorzugt, daß die Hybridpolypeptide und/oder die Allergenchimäre zur Herstellung einer Vakzine so verwendet werden, daß die Vakzine nasal, rektal oder oral verabreicht werden kann. Es ist aber auch denkbar, dass die Hybridpolypeptide und/oder die Allergenchimäre zur Herstellung einer Vakzine so verwendet werden, dass die Vakzine zur systemischen Behandlung verwendet werden kann. Es ist allerdings bevorzugt, dass die Verabreichung nasal, rektal oder oral, insbesondere bevorzugt nasal, erfolgen kann.Of Further, it is preferred that the Hybrid polypeptides and / or the allergen chimeras for the production of a vaccine be used so that the Vaccine can be administered nasally, rectally or orally. But it is also conceivable that the hybrid polypeptides and / or allergen chimeras for the production a vaccine can be used so that the vaccine is systemic Treatment can be used. However, it is preferred that administration nasally, rectally or orally, more preferably nasal, can be done.
Des weiteren ist bevorzugt, daß die Verwendung der pharmazeutischen Zusammensetzung, insbesondere Vakzine, ein mukosales Adjuvans und/oder Antigentransportsystem, wie zum Beispiel Milchsäurebakterien, umfaßt.Of Further, it is preferred that the Use of the pharmaceutical composition, in particular vaccines, a mucosal adjuvant and / or antigen transport system, such as Example lactic acid bacteria, includes.
Besonders bevorzugt sind die Vakzine, die im Methodenteil beschrieben sind.Especially preferred are the vaccines described in the Methods section.
Es ist bevorzugt, daß die Vakzine eine Dosis von Hybridpolypeptid und/oder Allergenchimär zumindest von 20 μg aufweist.It it is preferred that the Vaccine a dose of hybrid polypeptide and / or allergen chimera at least from 20 μg.
Es ist des weiteren bevorzugt, dass die Vakzine so aufgebaut ist, dass sie zumindest drei mal im Abstand von einer Woche appliziert werden kann. Dabei ist allerdings bevorzugt, dass die Verabreichung nasal, rektal oder oral, insbesondere bevorzugt nasal, erfolgen kann.It is further preferred that the vaccine is constructed so that they are applied at least three times at intervals of one week can. However, it is preferred that the administration is nasal, rectal or orally, especially preferably nasally.
Des weiteren umfaßt die Erfindung auch das Verfahren zur Herstellung von Hybridpolypeptiden und die Verfahren zur Herstellung von Allergenchimären.Of further comprises the invention also the process for the preparation of hybrid polypeptides and the methods of producing allergen chimeras.
Die Hybridpolypeptide werden vorzugsweise durch chemische Synthese hergestellt, insbesondere bevorzugt durch die im Methodikteil genannte Peptidsynthese.The Hybrid polypeptides are preferably prepared by chemical synthesis, in particular preferred by the peptide synthesis mentioned in the method section.
Die Allergenchimäre werden vorzugsweise durch die Rekombinationstechnik hergestellt. Dabei werden Polynukleotide verwendet, welche für das Allergenchimär codieren, wobei diese Polynukleotide in eine Wirtszelle eingeführt werden und diese Wirtszelle unter bestimmten Bedingungen kultiviert wird, so daß das Allergenchimär exprimiert wird. Anschließend wird das Expressionsprodukt von der Zelle getrennt. Die Polynukleotide können nach bekannten Methoden hergestellt werden bzw. es ist bevorzugt, daß die PCR-Technik verwendet wird, um Polynukleotide herzustellen, die die Allergenchimäre codieren.The Allergenchimäre are preferably prepared by the recombination technique. In this case, polynucleotides are used which code for the allergen chimera, wherein these polynucleotides are introduced into a host cell and this host cell is cultured under certain conditions, so that the allergen chimera expresses becomes. Subsequently the expression product is separated from the cell. The polynucleotides can be prepared by known methods or it is preferred that the PCR technique is used to prepare polynucleotides that the allergen chimeras encode.
Die Erfindung wird des weiteren durch folgende Beispiele genauer illustriert, ist aber auf diese nicht begrenzt.The Invention is further illustrated by the following examples, but is not limited to these.
Material und Methodenmaterial and methods
Tiereanimals
7-Wochen alte, weibliche BALB/c-Mäuse wurden von Charles River (Sulzfeld, Deutschland) erhalten. Alle Experimente wurden von der Tierversuchskomission der Universität Wien und des Ministeriums für Entwicklung, Forschung und Kultur genehmigt.7 weeks old, female BALB / c mice were obtained from Charles River (Sulzfeld, Germany). All Experiments were carried out by the Animal Experiments Commission of the University of Vienna and Ministry of Development, research and culture approved.
Rekombinante Allergene, natürliche AllergenextrakteRecombinant allergens, natural allergen extracts
Bet v 1, Phl p 1 und Phl 5 wurden von Biomay GmbH (Linz, Österreich) erhalten. Birkenpollen und Pollen der Phleum pratense (Wiesengras) wurden von Allergon (Välinge, Sweden) bezogen und die Extrakte davon nach Wiedermann et. al., 1999 (J. Allergy Clin. Immunol. 103:1202) hergestellt.Bet v 1, Phl p 1 and Phl 5 were from Biomay GmbH (Linz, Austria) receive. Birch pollen and pollen of the phleum pratense (meadow grass) were by Allergon (Välinge, Sweden) and the extracts thereof according to Wiedermann et. al. 1999 (J. Allergy Clin Immunol 103: 1202).
Synthese, Reinigung und Charakterisierung der PeptideSynthesis, purification and Characterization of the peptides
Die Peptide wurden synthetisiert indem eine Fmoc (9 Fluorenyl Methoxy Carbonyl) – Methode mit HBTU-[(2-(H-Benzotriazol-1-yl)1,1,3,3 Tetramethyluronium Hexafluorophosphat- Aktivierung (0.1 mmol kleine Zyklen) auf Applied Biosystems (Foster City, CA) Peptidsynthetisierer Model 433A verwendet wurde. Vorgeladene PEG-PS (Polyethylenglycol Polysterene-Harze (0.15-0.2 mmol/g Füllstoff; vVon Septive Biosystems, Warrington, UK) wurden als feste Phase benutzt um die Peptide zu bilden. Die chemischen Materialien wurden von PE Applied Biosystems erworben. Die Ankoppelung von Aminosäuren wurde durch die Messung der Leitfähigkeit mit Feedback-Regulation überwacht. Die Peptide wurden mit folgender Lösung vom Harz getrennt: 2 Stunden 250 μl destilliertes Wasser, 250 μl Triisopropylsilan (Fluka, Buchs, Schweiz), und 9.5 ml Trifluoracticacid und in Tert-butyl-methyl-ether (Fluka, Buchs, Schweiz) gefällt. Die Identität der Peptide wurde mittels Massenspektrometrie überprüft und die Peptide wurden auf >90% Reinheit durch preparative HPLC (pichem, Graz,Österreich) gereinigt.The Peptides were synthesized by using a Fmoc (9 fluorenyl methoxy Carbonyl) method with HBTU - [(2- (H-benzotriazol-1-yl) 1,1,3,3-tetramethyluronium hexafluorophosphate Activation (0.1 mmol small cycles) on Applied Biosystems (Foster City, CA). Peptide Synthesizer Model 433A was used. Preloaded PEG-PS (polyethylene glycol polysterene resins (0.15-0.2 mmol / g filler; v. Septive Biosystems, Warrington, UK) were used as a solid phase used to make the peptides. The chemical materials were from Acquired PE Applied Biosystems. The coupling of amino acids was by measuring the conductivity monitored with feedback regulation. The peptides were separated from the resin with the following solution: 2 hours 250 μl distilled Water, 250 μl Triisopropylsilane (Fluka, Buchs, Switzerland), and 9.5 ml of trifluoractic acid and in tert-butyl methyl ether (Fluka, Buchs, Switzerland) like. The identity The peptides were checked by mass spectrometry and the peptides were checked for> 90% purity preparative HPLC (pichem, Graz, Austria) cleaned.
Herstellung/Klonierung der Allergenchimäre:Preparation / cloning the allergen chimera:
Zuerst werden Expressionsplasmide, die für Bet v 1a codierende cDNA enthalten, im Vektor pHis-Parallel 2 hergestellt (Tabelle. 1). Der pHis-Parallel 2 enthält einen T7 Promotor zur Expressionsinduktion mittels IPTG (Isopropyl-β-D-thiogalactopyranosid), gefolgt von einem N-terminalen 6× Histidin-Tag und eine Schnittstelle für TEV (tobacco etch viral protease), mit deren Hilfe das His-Tag abgespalten werden kann. Mit Hilfe des 6× His-Tag kann das exprimierte Allergen über Ni-NTA (nickelnitrilotriacetic acid ) Agarose (Quiagen) gereinigt werden.First become expression plasmids, the cDNA coding for Bet v 1a contained in the vector pHis-Parallel 2 prepared (Table 1). Of the pHis-Parallel 2 contains a T7 promoter for expression induction by means of IPTG (isopropyl-β-D-thiogalactopyranoside), followed by an N-terminal one 6 × histidine tag and an interface for TEV (tobacco etch viral protease), with the help of which the His tag split off can be. With the help of the 6 × His-tag can the expressed allergen over Ni-NTA (nickelnitrilotriacetic acid) agarose (Quiagen) purified become.
Als Primer werden 5a und 5b für die Konstrukte 1–3 und 5a und 5c für das Konstrukt 4 (mitendständigem Bet v 1a) verwendet. Die Primer enthalten jeweils eine Schnittstelle für den Vektro (Nco I bzw. Xho I), eine Schnittstelle, um weitere cDNA einzufügen (Eco R I bzw. Hind III), bzw. ein Stopcodon (5c) und Bet v 1a Teilsequenzen. Mittels PCR wird die cDNA con Bet v 1, die auch Start und Stop Codon enthält, amplifiziert. Nach Reinigung und dem Verdau mit den entsprechenden Restriktionsenzymen (Nco I bzw. Xho I) wird das Konstrukt in den pHis-Parallel Vektor eingefügt (siehe Tabelle 1).When Primers become 5a and 5b for Constructs 1-3 and 5a and 5c for the construct 4 (incomplete Bet v 1a) used. The primers each contain an interface for the Vectors (Nco I or Xho I), an interface for inserting additional cDNA (Eco R I or Hind III), or a stop codon (5c) and Bet v 1a partial sequences. Using PCR, the cDNA con Bet v 1, which also start and stop codon contains amplified. After cleaning and digestion with the appropriate Restriction enzymes (Nco I or Xho I) is the construct in the pHis-parallel vector added (see Table 1).
In weiteren Schritten werden die Phl p 1 und Phl p 5 Teilstücke mit den entsprechenden Primeren (1a-d, 2a-d, 3a-d, 4a-d), die ebenfalls Schnittstelle und Sequenzteile enthalten, amplifiziert. nach Reinigung und Enzymverdau werden die Teilstücke in den Vektor, der bereits die Bet v 1a Sequenz enthält, eingefügt. Mit Hilfe der beiden Schnittstellen, jeweils am 3'Ende und 5'Ende, können in Zukunft beliebig unterschiedliche und beliebig viele Allergenteilstücke (z.B. immundominante Peptide von Latexallergenen, Hausstaub-, Katzenallergenen etc.) eingefügt werden.In Further steps are the Phl p 1 and Phl p 5 cuts with the corresponding primers (1a-d, 2a-d, 3a-d, 4a-d), which also Contain interface and sequence parts, amplified. after cleaning and Enzyme digestion become the cuts inserted into the vector already containing the Bet v 1a sequence. With help The two interfaces, each at the 3'end and 5'end, can be any number of different in the future and any number of allergen sections (e.g., immunodominant peptides latex allergens, house dust, cat allergens, etc.).
Die so konstruierten Plasmide werden in BL21 (DE3) Zellen, einem E.Coli Stamm, transformiert, über LB-Amp (100 mg/l Ampicillin) Platten selektioniert und eine Einzelkolonie wird ausgewählt. Zur Proteinexpression wird dieser Klon in flüssigem LB-Amp Medium hochgezogen. Die Expression wird anschließend mittels 1mM IPTG induziert. Der Zellaufschluß und die Proteinreinigung über Ni-NTA erfolgen über bereits etablierte Protokolle (Quiagen).The Plasmids constructed in this way are expressed in BL21 (DE3) cells, an E.coli Strain, transformed, via LB-Amp (100 mg / l ampicillin) plates and a single colony will be chosen. For protein expression, this clone is raised in liquid LB-Amp medium. The expression is subsequently induced by 1mM IPTG. Cell disruption and protein purification via Ni-NTA done over already established protocols (Quiagen).
Table 1: PrimerTable 1: Primer
Construct 1: Pept 2 - Bet v 1a - Pept 4Construct 1: Pept 2 - Bet v 1a - Pept 4
- (1a) 5'-primer Phl p 1 fwd Nco 5' CATGCCATGGAGCAGAAGCTGCGCAGC 3' (1a) 5'primer Phl p 1 fwd Nco 5 'CATGCCATGGAGCAGAAGCTGCGCAGC 3 '
- (1b) 3'-primer Phl p 1 rev Eco 5' ATGAATTCCACCTTGGTGCCCTCCGG 3'(1b) 3'-primer Phl p 1 rev Eco 5 'ATGAATTCCACCTTGGTGCCCTCCGG 3 '
- (1c) 5'-primer Phl p 5 fwd Hind 5' ACCAAGCTTCAGGCCTACGCCGCCACC 3'(1c) 5'-primer Phl p 5 fwd Hind 5 'ACCAAGCTTCAGGCCTACGCCGCCACC 3 '
- (1d) 3'-primer Phl p 5 rev Xho Stop 5' CCGCTCGAGTTATTCGGACATGGCGGTGAT 3'(1d) 3'-primer Phl p 5 rev Xho Stop 5 'CCGCTCGAGTTATTCGGACATGGCGGTGAT 3 '
Construct 2: Pept 4 - Bet v 1a - Pept 2Construct 2: Pept 4 - Bet v 1a - Pept 2
- (2a) 5'-primer Phl p 1 fwd Hind ACCAAGCTTGAGCAGAAGCTGCGCAGC(2a) 5'-primer Phl p 1 fwd Hind ACCAAGCTTGAGCAGAAGCTGCGCAGC
- (2b) 3'-primer Phl p 1 rev Xho Stop 5' CCGCTCGAGTTACACCTTGGTGCCCTCCGG 3'(2b) 3'-primer Phl p 1 rev Xho Stop 5 'CCGCTCGAGTTACACCTTGGTGCCCTCCGG 3 '
- (2c) 5'-primer Phl p 5 fwd Nco 5' CATGCCATGGCCTACGCCGCCACCGTC 3'(2c) 5'-primer Phl p 5 fwd Nco 5 'CATGCCATGGCCTACGCCGCCACCGTC 3 '
- (2d) 3'-primer Phl p 5 rev Eco 5' ATGAATTCTTCGGACATGGCGGTGAT 3'(2d) 3'-primer Phl p 5 rev Eco 5 'ATGAATTCTTCGGACATGGCGGTGAT 3 '
Construct 3: Bet v 1a - Pept 2 - Pept 4Construct 3: Bet v 1a Pept 2 Pept 4
- (3a) 5'-primer Phl p 1 fwd Hind 5' ACCAAGCTTGAGCAGAAGCTGCGCAGC 3'(3a) 5'-primer Phl p 1 fwd Hind 5 'ACCAAGCTTGAGCAGAAGCTGCGCAGC 3 '
- (3b) 3'-primer Phl p 1 rev Spe 5' GGACTAGTCACCTTGGTGCCCTCCGG 3'(3b) 3'-primer Phl p 1 rev Spe 5'GGACTAGTCACCTTGGTGCCCTCCGG 3 '
- (3c) 5'-primer Phl p 5 fwd Spe 5'GGACTAGTCAGGCCTACGCCGCCACC 3'(3c) 5'-primer Phl p 5 fwd Spe 5'GGACTAGTCAGGCCTACGCCGCCACC 3 '
- (3d) 3'-primer Phl p 5 rev Xho Stop 5' CCGCTCGAGTTATTCGGACATGGCGGTGAT 3'(3d) 3'-primer Phl p 5 rev Xho Stop 5 'CCGCTCGAGTTATTCGGACATGGCGGTGAT 3 '
Construct 4: Pept 2 - Pept 4 - Bet v 1aConstruct 4: Pept 2 - Pept 4 - Bet v 1a
- (4a) 5'-primer Phl p 1 fwd Nco 5' CATGCCATGGAGCAGAAGCTGCGCAGC 3'(4a) 5'-primer Phl p 1 fwd Nco 5 'CATGCCATGGAGCAGAAGCTGCGCAGC 3 '
- (4b) 3'-primer Phl p 1 rev Spe 5' GGACTAGTCACCTTGGTGCCCTCCGGG 3'(4b) 3'-primer Phl p 1 rev Spe 5 'GGACTAGTCACCTTGGTGCCCTCCGGG 3 '
- (4c) 5'-primer Phl p 5 fwd Spe 5'GGACTAGTCAGGCCTACGCCGCCACC 3'(4c) 5'-primer Phl p 5 fwd Spe 5'GGACTAGTCAGGCCTACGCCGCCACC 3 '
- (4d) 3'-primer Phl p 5 rev Eco 5' ATGAATTCTTCGGACATGGCGGTGAT 3'(4d) 3'-primer Phl p 5 rev Eco 5 'ATGAATTCTTCGGACATGGCGGTGAT 3 '
Bet v 1aBet v 1a
- (5a) 5'-primer Bet Start Nco Eco 5' CATGCCATGGGAGAATTCGGTGTTTTCAATTACGAAACTG 3'(5a) 5'-primer Bet start Nco Eco 5 'CATGCCATGGGAGAATTCGGTGTTTTCAATTACGAAACTG 3 '
- (5b) 3'-primer Bet Stop Hind Xho 5' CCGCTCGAGTCCAAGCTTGTTGTAGGCATCGGAGTGTG 3'(5b) 3'-primer Bet Stop Hind Xho 5 'CCGCTCGAGTCCAAGCTTGTTGTAGGCATCGGAGTGTG 3 '
- (5c) 3'-primer Bet Stop +Stop Xho 5' CCGCTCGAGTTAGTTGTAGGCATCGGAGTG 3'(5c) 3'-primer Bet Stop + Stop Xho 5 'CCGCTCGAGTTAGTTGTAGGCATCGGAGTG 3 '
Sensibilisierungsensitization
Die Sensibilisierung wurde durch 3 Injektionen einer Mischung aus 5μg Bet v 1, 5μg Phl p 1 und 5 μg Phl p 5 adsorbiert an Al(OH)3 in einem Zeitabstand von 14 Tagen in die Bauchhöhle durchgeführt. Es wurde eine Polysensibilisierung durchgeführt (Gruppe 1, n = 5). Probeentnahme und Analyse wurden sieben Tage nach der letzten Immunisierung durchgeführt.Sensitization was carried out by 3 injections of a mixture of 5 μg Bet v 1, 5 μg Phl p 1 and 5 μg Phl p 5 adsorbed on Al (OH) 3 at a time interval of 14 days into the abdominal cavity. Polysensitization was performed (group 1, n = 5). Sampling and analysis were performed seven days after the last immunization.
Toleranzinduktiontolerance induction
Für die Toleranzinduktion wurde eine Mischung aus 3 Allergenen (je 10 μg) intranasal (i.n.) drei mal in einem Zeitabstand von sieben Tagen vor der Polysensibilisierung verabreicht (Gruppe 2, n = 5). Für Peptid-induzierte Toleranz wurde eine Mischung von 5 μg Bet v 1 Peptid, 5 μg Phl p 1 Peptid und je 5 μg von beiden Phl p 5 (Gruppe 3, n = 5) oder 20μg Hybridpeptide wie oben beschrieben benutzt. Die sensibilisierten Kontrollmäuse wurden scheinbehandelt indem 30μl von 0.9%NaCl intranasal verabreicht wurde. Probeentnahme und Analyse wurden sieben Tage nach der letzten Immunisierung durchgeführt.For tolerance induction was a mixture of 3 allergens (10 μg each) intranasally (i.n.) three times at a time interval of seven days prior to polysensitization administered (group 2, n = 5). For Peptide-induced tolerance was a mixture of 5 μg Bet v 1 Peptide, 5 μg Phl p 1 peptide and 5 μg each from both Phl p 5 (group 3, n = 5) or 20μg hybrid peptides as described above used. The sensitized control mice were sham-treated by 30μl of 0.9% NaCl was administered intranasally. Sampling and analysis were performed seven days after the last immunization.
Kutane Typ 1 HypersensibilisierungsreaktionCutaneous type 1 hypersensitivity reaction
Sieben Tage nach der letzten Immunisierung wurden intradermale Hauttests durchgeführt. 100 Mikroliter von 0.5% Evans blue (Sigma.St. Louis, Mo) wurden intravenös in die Schwanzvene der Mäuse injiziert. Daraufhin wurden 30 μl Bet v 1 oder Phl p 1 oder Phl p 5 (2,5 μg/ml) intradermal in die rasierte abdominale Haut injiziert. Die Mastzell-degranulierende Substanz 48/80 (20μg/ml; Sigma) diente als positive Kontrolle und PBS wurde als negative Kontrolle genutzt. Nach 20 Minuten wurden die Mäuse getötet und die Farbintensität der Reaktion wurde mit der individuellen positiven Kontrolle an der Innenseite der Bauchhaut verglichen.seven Days after the last immunization were intradermal skin tests carried out. 100 microliters of 0.5% Evans blue (Sigma, Louis, Mo) intravenous into the tail vein of the mice injected. Thereupon, 30 μl Bet v 1 or Phl p 1 or Phl p 5 (2.5 μg / ml) intradermally into the shaved abdominal skin injected. The mast cell degranulating substance 48/80 (20 μg / ml; Sigma) served as a positive control and PBS was considered negative Control used. After 20 minutes, the mice were killed and the color intensity of the reaction was with the individual positive control on the inside compared to the abdominal skin.
ProbentnahmeProbentnahme
Blutproben wurden vor und sieben Tage nach der Sensibilisierung aus den Schwanzvenen entnommen, das Serum wurde gewonnen und bei –20°C bis zur Analyse gelagert. Milzen wurden unter sterilen Bedingungen entnommen. Die Organe wurden homogenisiert und, durch sterile Filter gefiltert. Die Erythrozyten wurden lysiert und in einem Zellmedium (RPMI, 10% FCS, 0.1 mg/ml Gentamycin, 2mmol/l Glutamin und 50μmol/l 2-Mercaptoethanol) resuspendiert.blood samples were measured before and seven days after sensitization from the tail veins The serum was collected and stored at -20 ° C until analysis. Spleens were removed under sterile conditions. The organs were homogenized and filtered through sterile filters. The erythrocytes were lysed and in a cell medium (RPMI, 10% FCS, 0.1 mg / ml gentamycin, 2mmol / l glutamine and 50μmol / l 2-mercaptoethanol).
Detektion der Allergen-spezifischen Antikörper im Serumdetection the allergen-specific antibody in the serum
Mikrotiterplatten (Nunc) wurden mit Bet v 1 (5 μg/ml), Phl p 1 (5 μg/ml) oder Phl p 5 (5 μg/ml) über Nacht bei 4°C beschichtet. Nach Waschung und Blockierung mit 1% BSA-PBS/Tween wurden Serumproben 1/1,000 für IgG 1-, 1 /500 für IgG2a- und 1/10 für IgE-Antikörper verdünnt. Ratten Anti-Maus IgG1, IgG2a und IgE Antikörper (1/500, Pharmingen, San Diego, Californien) und darauffolgend peroxidasekonjugierte Maus Anti-Ratten IgG-Antikörper (1/2000 Jackson Immuno Lab, West Grove, Pa.) wurden eingesetzt. Die Farbentwicklung ist wie früher beschrieben durchgeführt worden (Wiedermann et. al. 1999). Die Ergebnisse zeigen die OD-Werte nach Abzug der Grundwerte von preimmunen Seren.microtiter plates (Nunc) were incubated with Bet v 1 (5 μg / ml), Phl p 1 (5 μg / ml) or Phl p 5 (5 μg / ml) overnight at 4 ° C coated. After washing and blocking with 1% BSA-PBS / Tween serum samples were 1 / 1,000 for IgG 1-, 1/500 for IgG2a- and 1/10 for IgE antibodies diluted. Rats anti-mouse IgG1, IgG2a and IgE antibodies (1/500, Pharmingen, San Diego, California) and subsequently peroxidase-conjugated mouse anti-rat IgG antibody (1/2000 Jackson Immuno Lab, West Grove, Pa.) Were used. The color development is like before described carried out (Wiedermann et al 1999). The results show the OD values after deduction of the basic values of preimmune sera.
Lymphozyten-ProliferationsassayLymphocyte proliferation assay
Die Milzzellensuspensionen wurden bei einer Konzentration von 2 × 105 Zellen/Quelle auf 96 Platten (Nunc, Roshilde, Dänemark) ausplatiert und 4 Tage lang sowohl mit als auch ohne Concanvalin A (Con A; 0.5 μg/Quelle; Sigma), Bet v 1 (2 μg/Quelle)rPhl p 1 (2 μg/Quelle) oder Phl p 5 (2 μg/Platte) stimuliert. Dann wurden die Kulturen mit 0.5 μCi/Quelle 3H-Thymidin (Amersham, Buckinhamshire, UK) für 16 Stunden inkubiert. Die Proliferation wurde durch Szintillationszählung gemessen. Das Verhältnis der Proliferation nach Antigenenstimmulation (cpm) zur Proliferation nach Mediumbeigabe (cpm) wurde ermittelt (Stimulationsindex (SI)).The spleen cell suspensions were plated at a concentration of 2x10 5 cells / source on 96 plates (Nunc, Roshilde, Denmark) and incubated for 4 days both with and without concanvaline A (Con A; 0.5 μg / well, Sigma), Bet 1 (2 μg / well) rPhl p 1 (2 μg / well) or Phl p 5 (2 μg / well). The cultures were then incubated with 0.5 μCi / source 3 H-thymidine (Amersham, Buckinghamshire, UK) for 16 hours. Proliferation was measured by scintillation counting. The ratio of proliferation after antigenic stimulation (cpm) to proliferation after medium supplementation (cpm) was determined (stimulation index (SI)).
Die EpitopmappingThe epitope mapping
Um die immundominanten Peptide von Bet v 1, Phl p1 und Phl p 5 lokalisieren zu können, wurde ein T-Zellepitopmapping durchgeführt. Es wurden Dodekapeptide, die jeweils in 3 Aminosäuren überlappen, verwendet, die die gesamte Sequenz der einzelnen Proteine überspannen. 50 Bet v 1 Peptide, 77 Phl p 1 Peptide und 92 Phl p 5 Peptide wurden mit Milzzellen von immunisierten Mäusen inkubiert und die Proliferationsraten nach Inkorporation von 3H-Thymidin mittels eines Beta-Counters gemessen.In order to be able to localize the immunodominant peptides of Bet v 1, Phl p1 and Phl p 5, T cell epitope mapping was performed. Dodecapeptides, each overlapping 3 amino acids, were used, spanning the entire sequence of the individual proteins. 50 Bet v 1 peptides, 77 Phl p 1 peptides and 92 Phl p 5 peptides were incubated with spleen cells from immunized mice and the proliferation rates measured after incorporation of 3 H-thymidine using a beta-counter.
Messung der ZytokinproduktionMeasurement of cytokine production
Für die Bestimmung der IFN-γ, IL-4-, IL-5- und IL-10-Produktion wurde die Milzzellsuspension mit oder ohne Con A (2.5μg/Platte), Birkenpollen (25μg/Platte) oder Phleumextrakt (25μg/Platte) in 48 Platten (Costar, Cambridge, Mass.) bei einer Konzentration von 5 × 106 Zellen/Platte kultiviert. 40 Stunden später wurde der Überstand entnommen und bei –20°C bis zur Analyse gelagert.For the determination of IFN-γ, IL-4, IL-5 and IL-10 production, the spleen cell suspension with or without Con A (2.5 μg / plate), birch pollen (25 μg / plate) or phleum extract (25 μg / plate ) in 48 plates (Costar, Cambridge, Mass.) at a concentration of 5 x 10 6 cells / plate. Forty hours later, the supernatant was removed and stored at -20 ° C until analysis.
IL-4 und IL-10 Konzentrationen wurden mit Maus ELISA kits (Endogen, Cambridge, Mass.) gemessen. IFN-γ-Konzentrationen wurden folgendermaßen gemessen: Überstände wurden unverdünnt auf ELISA-Platten, die Anti-Maus-IFN-γ beschichtet waren, aufgetragen. Dann wurden Biotin-konjugierte Ratten Anti-Maus-IFN-γ Antikörper (0.1 μg/ml, Endogen), gefolgt von Peroxidase-konjugiertem Streptavidin (1:10.000 in PBS/4% Rinderserumalbumin (BSA); Endogen) angewandt. Die Zytokinkonzentration lagen im pg/ml-Bereich.IL-4 and IL-10 concentrations were measured with mouse ELISA kits (Endogen, Cambridge, Mass.) Measured. IFN-γ levels were as follows measured: supernatants were undiluted on ELISA plates, the anti-mouse IFN-γ coated were, applied. Then biotin-conjugated rats were given anti-mouse IFN-γ antibody (0.1 μg / ml, endogenous), followed by peroxidase-conjugated streptavidin (1: 10,000 in PBS / 4% Bovine serum albumin (BSA); Endogenous). The cytokine concentration were in the pg / ml range.
ErgebnisseResults
Charakterisierung der Immunantworten auf Bet v 1, Phl p 1 und Phl p 5 in polysensibilisierten MäusenCharacterization of the Immune responses on Bet v 1, Phl p 1 and Phl p 5 in polysensitized mice
Allergenspezifische
Antikörper
und Typ I Hauttests: Polysensibilisierte Mäuse zeigten hohe IgG 1 und IgE
Antikörperanteile
gegen alle drei Antigene. Bet v 1- und Phl p 1-spezifische IgG2a
Antikörperkonzentrationen
waren im Vergleich zur Phl p 5 spezifischen IgG2a Produktion (
Lymphoproliferation von Milzzellen und Zytokinproduktion in vitro: Eine starke Lymphoproliferation wurde nach Stimulation mit allen 3 Antigenen beobachtet. Die T-Zellproliferation (SI) war am stärksten nach Stimulation mit Phl p 5 und vergleichbar stark nach Stimulation mit Bet v 1 und Phl p 1 (Tabelle 2). Zusätzlich wurde eine ausgeprägte IL-4, IL-5 und IFN-γ-Produktion festgestellt, nachdem die Milzzellsuspension von polysensibilisierten Mäusen mit Birkenpollen und Phleumextrakt stimuliert wurde (Tabelle 2). Naive Splenozyten, die mit Bet v 1, Phl p 1, Phl p 5, BP oder Phleumextrakt behandelt wurden, unterschieden sich in ihrer Proliferationsantwort oder in der Zytokinanteil nicht von denen des Kontrollmediums, was die Antigen-spezifische Antwort von Milzzellkulturen von immunisierten Mäusen beweist (Daten nicht aufgeführt).lymphoproliferation of spleen cells and cytokine production in vitro: A strong lymphoproliferation was observed after stimulation with all 3 antigens. T cell proliferation (SI) was the strongest after stimulation with Phl p 5 and comparably strong after stimulation with Bet v 1 and Phl p 1 (Table 2). In addition, a pronounced IL-4, IL-5 and IFN-γ production detected, after the spleen cell suspension of polysensitized mice with Birch pollen and phlegm extract (Table 2). naive Splenocytes infected with Bet v 1, Phl p 1, Phl p 5, BP or phleum extract were treated differed in their proliferation response or in the cytokine portion does not differ from those of the control medium immunized the antigen-specific response of spleen cell cultures mice proves (data not listed).
Epitopmapping: Um reaktive T-Zell-Epitope von Bet v 1, Phl p 1 und Phl p 5 festzustellen wurde die Milzzellsuspension von polysensibilisierten Mäusen mit den entsprechenden Peptiden stimuliert.epitope mapping: To detect reactive T cell epitopes of Bet v 1, Phl p 1 and Phl p 5 was the spleen cell suspension of polysensitized mice with stimulated the corresponding peptides.
Für Bet v 1 (Zugangsnummer P 15494) haben diese Experimente ein immundominantes T-Zell-Epitop MGETLLRAVESY beim C-Terminus gezeigt, entsprechend der Position 139-150 der Aminosäuresequenz, welche von Bauer et. al. beschrieben und veröffentlicht wurde. Weiterhin wurde das gleiche Epitop als immundominantes Peptid bei auf Birkenpollen allergischen Patienten identifiziert (Ebner et. al.).For bet v 1 (accession number P 15494), these experiments have an immunodominant T-cell epitope MGETLLRAVESY shown at the C-terminus, corresponding to the position 139-150 of the amino acid sequence, which from Bauer et. al. described and published. Farther the same epitope was added as an immunodominant peptide to birch pollen allergic patients (Ebner et al.).
Für Phl p 1 (Zugangsnummer P43213) wurde eine immundominante Region AGELELQFRRVKCKY identifiziert, die der Position 127-141 der Aminosäuresequenz entspricht. Diese Epitope wurden auch als T-Zell-reaktive Regionen bei menschlichen in vitro-Studien mit Phl p 1-spezifischen T-Zelllinien und T-Zellklonen beschrieben (Schenk, Ebner). Phl p 5 betreffend (Zugangsnummer Q40960) wurden zwei immundominante Regionen identifiziert, nämlich KVDAAFKVAATAANA, was der Aminosäuresequenz 166-180 entspricht, und TVATAPEVKYTVFETALK, welches der Aminosäuresequenz 226-243 entspricht. Die gleichen Sequenzen wurden vorher in menschlichen in vitro Studien mit Phl p 5-spezifischen T-Zelllinien und T-Zellklonen bei auf Gräser allergischen Patienten (Müller) beschrieben, was die klinische Bedeutung dieses Tiermodells belegt.For Phl p 1 (accession number P43213), an immunodominant region AGELELQFRRVKCKY was identified, which corresponds to position 127-141 of the amino acid sequence. These Epitopes were also called T-cell reactive Regions in human in vitro studies with Phl p 1-specific T cell lines and T cell clones (Schenk, Ebner). Phl p 5 concerning (Accession number Q40960), two immunodominant regions were identified, namely KVDAAFKVAATAANA, representing the amino acid sequence 166-180, and TVATAPEVKYTVFETALK, which corresponds to the amino acid sequence 226-243 corresponds. The same sequences were previously used in human in vitro studies with Phl p 5-specific T cell lines and T cell clones at on grasses allergic patients (Müller) which demonstrates the clinical significance of this animal model.
Diese Ergebnisse waren die Grundlage für die Synthese allergenspezifischer Peptide und eines Hybridpeptids, das aus den immundominanten Eptiopen von Bet v 1, Phl p 1 und Phl p 5 (Tabelle 3) besteht. Folglich haben wir die Wirksamkeit einer Kombination der drei Allergene, einer Mischung der immundominanten Peptide oder des Hybridpeptids verglichen um mukosale Toleranz zur Verbindung von Polysensibilisierung zu induzieren.These Results were the basis for the synthesis of allergen-specific peptides and a hybrid peptide, that from the immunodominant eptiopenes of Bet v 1, Phl p 1 and Phl p 5 (Table 3). Consequently, we have the effectiveness of one Combination of the three allergens, a mixture of immunodominant peptides or the hybrid peptide compared to mucosal tolerance to the compound of polysensitization.
Tabelle
2: T-Zell-Proliferation
und Zytokinproduktion in Milzzellkulturen von immunisierten Mäusen mit
einer Zusammensetzung aus Bet v 1/Phl p 5 adsorbiert an Al(OH)3. 
Millzellen von immunisierten Mäusen mit einer Zusammensetzung aus Bet v 1/Phl p 1/Phl p 5 wurden mit den entsprechenden Antigenen gezüchtet. Eine Proliferationsantwort wurde durch 3H-Inkorporation gemessen und als Stimulationsindex (SI) angegenben. IFN-γ, IL-4 und IL-5-Konzentrationen wurden in Überständen nach 40 Stunden Stimulation mit Birkenpollen (BP) oder Phleum-Extrakt mittels ELISA gemessen. Alle Ergebnisse sind Durchschnittswerte (± SD) aus drei unabhängigen Versuchen mit je fünf Tieren pro Experiment.Mill cells from immunized mice with a composition of Bet v 1 / Phl p 1 / Phl p 5 were cultured with the appropriate antigens. A proliferative response was measured by 3 H incorporation and reported as a stimulation index (SI). IFN-γ, IL-4 and IL-5 concentrations were measured in supernatants after 40 hours stimulation with birch pollen (BP) or phleum extract by ELISA. All results are mean values (± SD) from three independent experiments with five animals per experiment.
Tabelle
3: PEPTIDE
HYBRID-PEPTID 
Induktion von mukosaler Toleranz durch intranasale Coapplikation von Bet v 1, Phl p 1 und Phl p 5Induction of mucosal Tolerance by intranasal co-application of Bet v 1, Phl p 1 and Phl p 5
Allergen-spezifische Antikörperkonzentrationen, Lymphoproliferationsantwort von Milzzellen und Zytokinproduktion in vivo: Die Coapplikation einer Mischung aus Bet v 1, Phl p 1 und Phl p 5 vor der Polysensibilisierung führte zu einer Abnahme der Bet v 1-spezifischen IgG1, IgE und IgG2a Konzentration im Vergleich zu den polysensibilisierten Kontrolltieren. Im Gegensatz dazu ist die Phl p 1- und Phl p 5-spezifische Antikörperproduktion eher angestiegen, besonders die Phl p 5-spezifische IgG2a Konzentration (Daten nicht aufgezeigt). Es wurde keine bedeutende Wirkung bezüglich der Proliferation von Milzzellen oder der allergenspezifischen Zytokinproduktion in vitro gezeigt (Daten nicht aufgezeigt). Daher wurde die Toleranzinduktion bei einer Mischung von immundominanten Peptiden oder eines Hybridpeptids mit immundominanten Peptiden aller drei Allergene durchgeführt.Allergen-specific Antibody concentrations Lymphoproliferative response of spleen cells and cytokine production in vivo: The co-application of a mixture of Bet v 1, Phl p 1 and Phl p 5 prior to polysensitization resulted in a decrease in Bet v 1-specific IgG1, IgE and IgG2a concentration compared to the polysensitized control animals. In contrast, the Phl p 1 and Phl p 5 specific antibody production rather increased, especially the Phl p 5-specific IgG2a concentration (data not ) Pointed out. There was no significant effect on the Proliferation of spleen cells or allergen-specific cytokine production shown in vitro (data not shown). Therefore, the tolerance induction became in a mixture of immunodominant peptides or a hybrid peptide performed with immunodominant peptides of all three allergens.
Toleranzinduktion mit einer Mischung von immundominanten Peptiden im Vergleich zum Hybridpolypeptidtolerance induction with a mixture of immunodominant peptides compared to chimeric
Allergenspezifische
Antikörperkonzentration:
Die intranasale Vorbehandlung mit der Peptidmischung sowie auch
mit dem Hybridpeptid verringerte die Phl p 1-spezifische, jedoch
nicht die Bet v 1- oder Phl p 5-spezifische
IgG1-Produktion (Tabelle 4). Im Gegensatz dazu erhöhte sich
die IgG2a-Konzentration wesentlich bei mit der Peptidmischung behandelten
Mäusen
(Tabelle 4A), gleichzeitig verringerte sich bei den polytolerisierten
Mäusen
das IgE/IgG2a Verhältnis
für Bet
v 1 und Phl p1-spezifische
Antikörper
um 60 % und um 30% für die
Phl p 5-spezifischen Antikörper.
Bei der intranasalen Anwendung des Hybridpeptids wurden ähnliche
Ergebnisse bezüglich
der IgG2a-Antikörperproduktion
erzielt (Tabelle 4B). Jedoch führte
diese Vorbehandlung zu einer 80%-igen Abnahme der IgE/IgG2a Konzentration
in Bet v 1-spezifischen, und zu einer 80%-igen Abnahme in Phl p
5-spezifischen Antikörperkonzentrationen
im Vergleich zu den polysensibilisierten Kontrolltieren (
Tabelle
4: Allergen-spezifische Antikörper
in polysensibilisierten Sera im Vergleich zu poly-tolerisierten
(A, poly-tol) oder Hybrid-tolerisierten (B, Hybrid-tol) Mäusen A)
Toleranzinduktion mit einer Peptidmischung 
B)
Toleranzinduktion mit einem Hybridpeptid 
Poly-sensiblisiert: Durchschnittswerte (± SD) von fünf Mäusen mit einer Zusammensetzung aus Bet v 1/Phl p 1/Phl p 5 adsorbiert an Al(OH)3; polytolerisiert: Durchschnittswerte (+ SD) von fünf Mäusen, vorbehandelt mit einer Zusammensetzung aus den immundominanten Peptiden von Bet v 1, Phl p 1 und Phl p 5; Hybrid-tolerisiert: Durchschnittswerte (+ SD) von fünf Mäusen, vorbehandelt mit einem Hybridpeptid; OD = Optische Dichte.Poly-sensitized: averages (± SD) of five mice with a composition of Bet v 1 / Phl p 1 / Phl p 5 adsorbed on Al (OH) 3 ; polytolerized: averages (+ SD) of five mice pretreated with a composition of the immunodominant peptides of Bet v 1, Phl p 1 and Phl p 5; Hybrid tolerated: averages (+ SD) of five mice pretreated with a hybrid peptide; OD = optical density.
Zytokinproduktion
in vitro: Beide Vorbehandlungen führten zu einer bedeutenden
Abschwächung
der IL-4 und IL-10-Produktion in den polytolerisierten Tieren im
Vergleich zu den polysensibilisierten Kontrolltieren (
Claims (25)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE10351471A DE10351471A1 (en) | 2003-11-04 | 2003-11-04 | Polyvalent allergy vaccine |
| PCT/EP2004/010230 WO2005051986A1 (en) | 2003-11-04 | 2004-09-13 | Polyvalent allergy vaccine |
| EP04765148A EP1680445A1 (en) | 2003-11-04 | 2004-09-13 | Polyvalent allergy vaccine |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE10351471A DE10351471A1 (en) | 2003-11-04 | 2003-11-04 | Polyvalent allergy vaccine |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DE10351471A1 true DE10351471A1 (en) | 2005-06-09 |
Family
ID=34559328
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE10351471A Withdrawn DE10351471A1 (en) | 2003-11-04 | 2003-11-04 | Polyvalent allergy vaccine |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP1680445A1 (en) |
| DE (1) | DE10351471A1 (en) |
| WO (1) | WO2005051986A1 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AT503296B1 (en) * | 2006-05-03 | 2007-09-15 | Biomay Ag | Producing derivatives of wild-type protein allergen Phl p 1 with reduced allergenic activity by fragmenting wild-type protein allergen, the fragments having reduced allergenic activity, and rejoining the fragments |
| EP2924047A1 (en) * | 2006-06-09 | 2015-09-30 | Biomay Ag | Vaccine carrier |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1221317A1 (en) * | 2000-12-28 | 2002-07-10 | SHAN-Beteiligungsgesellschaft m.b.H. | Vaccines containing hybrid polypeptides consisting of at least two different allergenic proteins |
| AU2002347369A1 (en) * | 2001-12-05 | 2003-06-17 | Circassia Limited | Immunotherapeutic methods and systems |
| AUPS148202A0 (en) * | 2002-04-02 | 2002-05-09 | Monash University | Immunotherapeutic and immunoprophylactic reagents |
-
2003
- 2003-11-04 DE DE10351471A patent/DE10351471A1/en not_active Withdrawn
-
2004
- 2004-09-13 WO PCT/EP2004/010230 patent/WO2005051986A1/en active Application Filing
- 2004-09-13 EP EP04765148A patent/EP1680445A1/en not_active Withdrawn
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AT503296B1 (en) * | 2006-05-03 | 2007-09-15 | Biomay Ag | Producing derivatives of wild-type protein allergen Phl p 1 with reduced allergenic activity by fragmenting wild-type protein allergen, the fragments having reduced allergenic activity, and rejoining the fragments |
| EP2924047A1 (en) * | 2006-06-09 | 2015-09-30 | Biomay Ag | Vaccine carrier |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2005051986A1 (en) | 2005-06-09 |
| EP1680445A1 (en) | 2006-07-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69733145T2 (en) | METHOD FOR THE TREATMENT OF ALLERGIC LUNG DISEASES | |
| DE69814177T2 (en) | Vaccines with an LTB adjuvant | |
| DE69334066T2 (en) | Mucosal delivery vaccine compositions | |
| DE69435075T2 (en) | IMMUNOGENEOUS CHIMERAL COMPRISING NUCLEIC ACID SEQUENCES, THE ENDOPLASMATIC RETICULAR SIGNAL SEPARATIVE PEPTIDE AND AT LEAST ONE OTHER PEPTIDE, THEIR USE IN VACCINES, AND THE TREATMENT OF DISEASES | |
| AT410635B (en) | VACCINE COMPOSITION | |
| EP1113816B1 (en) | Influenza virus vaccine composition | |
| DE60110822T2 (en) | PREPARING FOR IMMUNIZING AGAINST THE AIDS VIRUS | |
| EP1144001A2 (en) | Inactivated influenza virus vaccine for nasal or oral administration | |
| DE69934179T2 (en) | A composition comprising an antigen, a TH-1 inducing adjuvant and a sparingly water soluble amino acid for use in immunization | |
| US20040028690A1 (en) | Nontoxic mucosal adjuvant | |
| DE3200813A1 (en) | "SYNTHETIC VACCINE AGAINST VIRUS INFECTIONS" | |
| DE60119959T2 (en) | M. TUBERCULOSIS CHAPERONIN 10 AND ITS USES | |
| DE60038099T2 (en) | NEISSERIA VACCINE COMPOSITIONS AND METHODS | |
| DE60019726T2 (en) | VACCINE ORGANIZATION WITH MONOGLYCERIDES OR FATTY ACIDS AS ADJUVANS | |
| DE60129528T2 (en) | Vaccines containing hybrid polypeptides with at least two different allergens | |
| DE69737659T2 (en) | PEPTIDES FROM T-CELL PITOPES | |
| DE69434000T2 (en) | VACCINE COMPOSITIONS | |
| DE1951256B2 (en) | Process for the preparation of a formalinized allergen and compositions containing this allergen | |
| DE69534922T2 (en) | INTERLEUKIN-12 AS ADJUVANS FOR PARAMYOXVIRIDAE VACCINES | |
| EP1709064B1 (en) | Dna sequence, and recombinant production of the grass pollen allergen lol p 4 | |
| DE10351471A1 (en) | Polyvalent allergy vaccine | |
| DE60205907T2 (en) | Hypoallergenic allergy vaccines based on Timothy grass pollen allergen Phl p 7 | |
| DE60033414T3 (en) | Allergy vaccines and their production | |
| WO2011012240A2 (en) | Lipopeptides for therapy and prophylaxis of allergic illnesses | |
| EP1709177B1 (en) | Dna-sequence and recombinant production of group 4 major allergens from cereals |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8139 | Disposal/non-payment of the annual fee |