DE10234975A1 - Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung - Google Patents

Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung Download PDF

Info

Publication number
DE10234975A1
DE10234975A1 DE10234975A DE10234975A DE10234975A1 DE 10234975 A1 DE10234975 A1 DE 10234975A1 DE 10234975 A DE10234975 A DE 10234975A DE 10234975 A DE10234975 A DE 10234975A DE 10234975 A1 DE10234975 A1 DE 10234975A1
Authority
DE
Germany
Prior art keywords
dione
dihydroxy
tetramethyl
oxacyclohexadec
dioxa
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
DE10234975A
Other languages
English (en)
Inventor
Markus Berger
Ulrich Klar
Gerhard Siemeister
Jörg WILLUDA
Andreas Menrad
Klaus Bosslet
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bayer Pharma AG
Original Assignee
Schering AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Schering AG filed Critical Schering AG
Priority to DE10234975A priority Critical patent/DE10234975A1/de
Priority to ARP030102734A priority patent/AR040956A1/es
Priority to EA200500223A priority patent/EA200500223A1/ru
Priority to NZ537870A priority patent/NZ537870A/en
Priority to EP03743752A priority patent/EP1524979A2/de
Priority to JP2005506073A priority patent/JP2006505627A/ja
Priority to PE2003000756A priority patent/PE20040747A1/es
Priority to BR0313043-6A priority patent/BR0313043A/pt
Priority to PL03374528A priority patent/PL374528A1/xx
Priority to IL16603903A priority patent/IL166039A0/xx
Priority to TW092121014A priority patent/TW200404065A/zh
Priority to CA002492437A priority patent/CA2492437A1/en
Priority to US10/631,011 priority patent/US7129254B2/en
Priority to CNA038181118A priority patent/CN1812785A/zh
Priority to UY27915A priority patent/UY27915A1/es
Priority to PCT/EP2003/008483 priority patent/WO2004012735A2/en
Priority to KR1020057001569A priority patent/KR20050026033A/ko
Priority to AU2003253365A priority patent/AU2003253365A1/en
Priority to YUP-2005/0082A priority patent/RS20050082A/sr
Priority to MXPA05001282A priority patent/MXPA05001282A/es
Publication of DE10234975A1 publication Critical patent/DE10234975A1/de
Priority to IS7708A priority patent/IS7708A/is
Priority to ZA200501648A priority patent/ZA200501648B/xx
Priority to EC2005005626A priority patent/ECSP055626A/es
Priority to CO05017568A priority patent/CO5700741A2/es
Priority to NO20051038A priority patent/NO20051038L/no
Priority to HR20050186A priority patent/HRP20050186A2/hr
Priority to US11/509,557 priority patent/US7335775B2/en
Priority to US12/000,258 priority patent/US20080166362A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
    • C07D405/02—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
    • C07D405/06—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
    • A61K47/6809—Antibiotics, e.g. antitumor antibiotics anthracyclins, adriamycin, doxorubicin or daunomycin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/04—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D413/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/06—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/04—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/06—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/14—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing three or more hetero rings
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D493/00—Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system
    • C07D493/02—Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system in which the condensed system contains two hetero rings
    • C07D493/04—Ortho-condensed systems

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Epidemiology (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)

Abstract

Konjugate von Epothilonen und Epothilonderivaten (als Effektoren) mit geeigneten Biomolekülen (als Erkennungseinheiten) werden beschrieben. Ihre Herstellung erfolgt, indem die Effektoren mit geeigneten Linkern umgesetzt werden und die entstehenden Verbindungen an die Erkennungseinheit konjugiert werden. Die pharmazeutische Verwendung der Konjugate zur Behandlung von proliferativen oder Angiogenese-assoziierten Prozessen wird beschrieben.

Description

  • Die Entwicklung des Verständnisses betreffend die Erkennung von Bindungsregionen, insbesondere auf dem Gebiet der monoklonalen Antikörper oder deren Fragmente gegen spezifische Tumor-Antigene, ermöglicht es, an eine selektive Tumor-Therapie durch gezielte Freisetzung eines Anti-Tumor-Wirkstoffes am Zielort zu denken.
  • Voraussetzung für einen derartigen Ansatz, bei dem ein hoch aktiver (toxischer) Wirkstoff (Effektor) an eine hochmolekulare Tumor-spezifische Erkennungseinheit wie beispielsweise an einen Antikörper gekuppelt wird, ist eine weitgehende Inaktivität des Konjugates, dessen Mindestbestandteile eine Erkennungseinheit und einen Effektor darstellen, bis dieses den Zielort (Tumor) erreicht hat. Am Zielort angelangt, bindet das Konjugat an der Zelloberfläche und der Wirkstoff kann, gegebenenfalls nach vorangegangener Internalisierung des gesamten Komplexes, freigesetzt werden.
  • Die erfolgreiche Therapie solider Tumore, insbesondere mit monoklonalen Antikörpern, kann jedoch eingeschränkt werden durch eine unzureichende Penetration des Antikörpers in den Tumor sowie die heterogene Verteilung des entsprechenden tumorassoziierten Antigens im Tumorgewebe.
  • Diese Einschränkungen könnten dadurch umgangen werden, dass man in spezifischer Weise das Tumor-Gefäßsystem angreift. Das Wachstum von Tumoren unterhalb eines Volumens von etwa 2 mm3 ist abhängig von einer Neoangiogenese. Das weitere Tumorwachstum basiert auf einem intakten Gefäßsystem, das die Versorgung mit Nährstoffen bzw. Entsorgung von Abfallprodukten gewährleistet. Die selektive Zerstörung dieses Systems sollte deshalb zu einem Absterben des Tumors führen. Der Angriff auf das Gefäßsystem des Tumors verspricht gegenüber dem direkten Angriff auf den Tumor selbst eine Reihe von Vorteilen. Im Vergleich zu Tumorzellen sind Endothelzellen leichter zugänglich, da kein Tumorgewebe penetriert werden muß. Die Schädigung eines einzelnen Tumorgezfäßes sollte zum Absterben tausender Tumorzellen führen. Um ein Tumorgefäß zu schädigen, besteht keine Notwendigkeit, alle Endothelzellen abzutöten. Der spezifische Angriff von Endothelzellen in oder in der Nähe von Tumoren minimiert systemische Nebenwirkungen. Endothelzellen sind genetisch sehr stabil, so dass die Wahrscheinlichkeit einer Resistenzentwicklung gegen das Tumortherapeutikum gering ist.
  • Im Rahmen der vorliegenden Erfindung wurde nun überraschenderweise eine Möglichkeit gefunden, die chemisch sehr empfindliche, hochfunktionalisierte Wirkstoffklasse der Epothilone und ihrer Analoga mit einer hochmolekularen Erkennungseinheit über unterschiedliche Linker an unterschiedliche Positionen des Wirkstoffes zu knüpfen.
  • Der vorliegenden Erfindung liegt somit unter anderem die Aufgabe zugrunde,
    • 1. eine Methode zu finden, hoch aktive Wirkstoffe aus der Strukturklasse der Epothilone und Epothilon-Derivate mit geeigneten Linkern zu verknüpfen,
    • 2. geeignete Linker zu synthetisieren,
    • 3. eine Methode zu entwickeln, diese Epothilon-Linker Konjugate mit Erkennungseinheiten wie beispielsweise monoklonalen Antikörpern oder deren Fragmenten zu Immunkonjugaten zu verknüpfen, die sowohl chemisch als auch metabolisch für eine Arzneimittelentwicklung ausreichend stabil sind und die hinsichtlich ihrer therapeutischen Breite, ihrer Selektivität der Wirkung und/oder unerwünschter toxischer Nebenwirkungen und/oder ihrer Wirkstärke den zu Grunde liegenden Epothilonen bzw. Epothilon-Derivaten überlegen sind.
  • Die vorliegende Erfindung umfasst entsprechend Effektorkonjugate der allgemeinen Formel 1
    Figure 00030001
    worin
    R1a, R1b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, oder gemeinsam eine -(CH2)m-Gruppe sind, worin m 2 bis 5 ist,
    R2a, R2b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, oder gemeinsam eine -(CH2)n-Gruppe sind, worin n 2 bis 5 ist, oder C2-C10 Alkenyl, oder C2-C10 Alkinyl,
    R3 Wasserstoff, C1-C10 Alkyl, Aryl oder Aralkyl, und
    R4a, R4b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, oder gemeinsam eine -(CH2)p-Gruppe sind, worin p 2 bis 5 ist,
    R5 Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, CO2H, CO2Alkyl, CH2OH, CH2OAlkyl, CH2OAcyl, CN, CH2NH2, CH2N(Alkyl, Acyl)1,2, oder CH2Hal,
    Hal ein Halogen-Atom,
    R6, R7 jeweils Wasserstoff, oder gemeinsam eine zusätzliche Bindung, oder gemeinsam ein Sauerstoff-Atom, oder gemeinsam eine NH-Gruppe, oder gemeinsam eine N-Alkyl-Gruppe, oder gemeinsam eine CH2-Gruppe, und
    G ein Sauerstoffatom oder CH2 sind,
    D–E eine Gruppe H2C-CH2, HC=CH, C≡C, CH(OH)-CH(OH), CH(OH)-CH2,
    CH2-CH(OH), HC O / -CH, O-CH2, oder, falls G eine CH2-Gruppe darstellt, CH2-O ist,
    W eine Gruppe C(=X)R8, oder ein bi- or tricyclischer aromatischer oder heteroaromatischer Rest ist,
    L3 Wasserstoff ist, oder, falls ein Rest in W eine Hydroxyl-Gruppe enthält, mit dieser eine Gruppe O-L4 bildet, oder, falls ein Rest in W eine Amino-Gruppe enthält, mit dieser eine Gruppe NR25-L4 bildet,
    R25 Wasserstoff oder C1-C10 Alkyl ist,
    X ein Sauerstoffatom, oder zwei OR20-Gruppen, oder eine C2-C10 Alkylendioxy Gruppe, die geradkettig oder verzweigt sein darf, oder H/OR9, oder eine CR10R11-Gruppe,
    R8 Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, Halogen oder CN, und
    R9 Wasserstoff oder eine Schutzgruppe PGX sind,
    R10, R11 jeweils unabhängig voneinander Wasserstoff, C1-C20 Alkyl, Aryl, Aralkyl sind, oder gemeinsam mit einem Methylenkohlenstoffatom einen 5- bis 7-gliedrigen carbocyclischen Ring bilden,
    Z Sauerstoff oder H/OR12,
    R12 Wasserstoff oder eine Schutzgruppe PGZ,
    A-Y eine Gruppe O-C(=O), O-CH2, CH2-C(=O), NR21-C(=O) oder NR21-SO2,
    R20 C1-C20 Alkyl,
    R21 ein Wasserstoffatom oder C1-C10 Alkyl,
    PGX, PGY, PGZ eine Schutzgruppe PG, und
    L1, L2, L4 unabhängig voneinander Wasserstoff, eine Gruppe C(=O)Cl, eine Gruppe C(=S)CI, eine Gruppe PGY oder einen Linker der allgemeinen Formel III darstellen können;
    mit der Bedingung, dass mindestens ein Substituent L1, L2 oder L4 einen Linker der allgemeinen Formel (III) darstellt;
    der Linker der allgemeinen Formel (III) folgende Struktur hat,
    Figure 00050001
    worin
    T Sauerstoff oder Schwefel,
    U Sauerstoff, CHR22, CHR22-NR23-C(=O)-, CHR22-NR23-C(=S)-, O-C(=O)-CHR22-NR23-C(=O)-, O-C(=O)-CHR22-NR23-C(=S)- oder NR24a,
    o 0 bis 15,
    V eine Bindung, Aryl, eine Gruppe
    Figure 00050002
    oder eine Gruppe
    Figure 00050003
    s 0 bis 4,
    Q eine Bindung, O-C(=O)-NR24c, O-C(=S)-NR24c,
    Figure 00060001
    R22 Wasserstoff, C1-C10 Alkyl, Aryl oder Aralkyl
    R23 Wasserstoff oder C1-C10 Alkyl,
    R24a, R24b, R24c unabhängig voneinander Wasserstoff oder C1-C10 Alkyl,
    q 0 bis 15,
    Figure 00060002
    darstellen können;
    als einheitliches Isomer oder eine Mischung unterschiedlicher Isomere und/oder als ein pharmazeutisch akzeptables Salz hiervon.
  • Die Erfindung beschreibt weiterhin die Herstellung von Effektor-Erkennungseinheit-Konjugaten der allgemeinen Formel (1), wobei die Substituenten darin die obengenannten Bedeutungen haben, jedoch mindestens eine Gruppe FG1 durch eine Gruppe FG2 ersetzt ist, wobei FG2 die folgenden Bedeutungen haben kann:
    Figure 00060003
    und wobei eine Erkennungseinheit über ein Schwefelatom mit der Gruppe FG2 konjugiert ist;
    wobei die Erkennungseinheit beispielsweise ein Peptid, ein löslicher Rezeptor, ein Cytokin, ein Lymphokin, ein Aptamer, ein Spiegelmer, ein rekombinantes Protein, eine Framework-Struktur, ein monoklonaler Antikörper oder ein Fragment eines monoklonalen Antikörpers sein kann.
  • Gemäss dieser Erfindung können die genannten Effektor-Erkennungseinheit-Konjugate eine oder mehrere Erkennungseinheiten umfassen; dabei können die einem Konjugat zugehörigen Erkennungseinheiten identisch oder verschieden sein. Es ist bevorzugt, dass die Erkennungseinheiten eines Konjugats identisch sind.
  • Die erfindungsgemäßen Konjugate werden vorzugsweise für die Behandlung von Erkrankungen, die mit proliferativen Prozessen verknüpft sind, eingesetzt. Beispielsweise genannt seien die Therapie unterschiedlichster Tumore, die Therapie entzündlicher und/oder neurodegenerativer Erkrankungen wie der Multiplen Sklerose oder der Alzheimerschen Erkrankung, die Therapie Angiogenese-assoziierter Erkankungen wie das Wachstum solider Tumore, die rheumatoide Arthritis oder Erkrankungen des Augenhintergrundes.
  • Die Darstellung der Epothilone, ihrer Vorstufen und Derivate der allgemeinen Formel I erfolgt nach den dem Fachmann bekannten Methoden wie sie beispielsweise in DE 19907588 , WO 98/25929, WO 99/58534, WO 99u/2514, WO 99/67252, WO 99/67u253, WO 99/7692, EP 99/4915, WO 00/485, WO 00/1333, WO 00/u66589, WO 00/49019, WO 00/49020, WO 00/49021, WO 00/71521, WO 00/37473, WO 00/57874, WO 01/92255, WO 01/81342, WO 01/73103, WO 01/64650, WO 01/70716, US 6204388, US 6387927, US 6380394, US 02/52028, US 02/u58286, US 02/62030, WO 02/32844, WO 02/30356, WO 02/32844, WO 02/14323, WO 02/8440 beschrieben sind.
  • Als Alkylgruppen R1 a, R1b, R2a, R2b, R3, R4a, R4b, R5, R8, R10, R11, R20, R21, R22, R23, R24a, R24b, R24c, R25 und R26 sind gerad- oder verzweigtkettige Alkylgruppen mit 1–20 Kohlenstoffatomen zu betrachten, wie beispielsweise Methyl, Ethyl, Propyl, Isopropyl, Butyl, Isobutyl, tert.-Butyl, Pentyl, Isopentyl, Neopentyl, Heptyl, Hexyl, Decyl.
  • Die Alkylgruppen R1a, R1b, R2a, R2b, R3, R4a, R4b, R5, R8, R10, R11, R20, R21, R22, R23, R24a, R24b, R24c, R25 und R26 können ferner perfluoriert oder substituiert sein durch 1-5 Halogenatome, Hydroxygruppen, C1-C4-Alkoxygruppen oder C6-C12-Arylgruppen (die durch 1-3 Halogenatome substituiert sein können).
  • Als Arylrest R1a, R1b, R2a, R2b, R3, R4a, R4b, R5, R8, R10, R11, R22, R26 und V kommen substituierte und unsubstituierte carbocyclische oder heterocyclische Reste mit einem oder mehreren Heteroatomen wie Phenyl, Naphthyl, Furyl, Thienyl, Pyridyl, Pyrazolyl, Pyriumidinyl, Oxazolyl, Pyridazinyl, Pyrazinyl, Chinolyl, Thiazolyl, Benzothiazolyl oder Benzoxazolyl, die einfach oder mehrfach substituiert sein können durch Halogen, OH, O-Alkyl, CO2H, CO2-Alkyl, -NH2, -NO2, -N3, -CN, C1-C20-Alkyl, C1-C20-Acyl oder C1-C20-Acyloxy-Gruppen, in Frage. Die Heteroatome können oxidiert sein, sofern dadurch der aromatischen Charakter nicht verloren geht, wie beispielsweise die Oxidation eines Pyridyls zu einem Pyridyl-N-Oxid.
  • Als bi- und tricyclische Arylreste W kommen substituierte und unsubstituierte carbocyclische oder heterocyclische Reste mit einem oder mehreren Heteroatomen wie Naphthyl, Anthryl, Benzothiazolyl, Benzoxazolyl, Benzimidazolyl, Chinolyl, Isochinolyl, Benzoxaziyl, Benzofuranyl, Indolyl, Indazolyl, Chinoxalinyl, Tetrahydroisochinolinyl, Tetrahydrochinolinyl, Thienopyridinyl, Pyridopyridinyl, Benzopyrazolyl, Benzotriazolyl, oder Dihydroindolyl, die einfach oder mehrfach substituiert sein können durch Halogen, OH, O-Alkyl, CO2H, CO2-Alkyl, -NH2, -NO2, -N3, -CN, C1-C20-Alkyl, C1-C20-Acyl oder C1-C20-Acyloxy-Gruppen, in Frage. Die Heteroatome können oxidiert sein, sofern dadurch der aromatische Charakter nicht verloren geht, wie beispielsweise die Oxidation eines Chinolyls zu einem Chinolyl-N-Oxid.
  • Die Aralkylgruppen in R1a, R1b, R2a, R2b, R3, R4a, R4b, R5, R8, R10, R11, R22 und R26 können im Ring bis 14 C-Atome, bevorzugt 6 bis 10 und in der Alkylkette 1 bis 8, bevorzugt 1 bis 4 Atome enthalten. Als Aralkylreste kommen beispielweise in Betracht Benzyl, Phenylethyl, Naphthylmethyl, Naphthylethyl, Funlmethyl, Thienylethyl oder Pyridylpropyl. Die Ringe können einfach oder mehrfach substituiert sein durch Halogen, OH, O-Alkyl, CO2H, CO2-Alkyl, -NO2, -N3, -CN, C1-C20-Alkyl, C1-C20-Acyl oder C1-C20-Acyloxy-Gruppen.
  • Als Vertreter für die Schutzgruppen PG sind tris(C1-C20 Alkyl)silyl, bis(C1-C20 Alkyl)-Arylsilyl, (C1-C20 Alkyl)-Dianlsilyl, tris(Aralkyl)-Silyl, C1-C20-Alkyl, C4-C7-Cycloalkyl, das im Ring zusätzlich ein Sauerstoffatom enthalten kann, Alkyl, C7-C20-Aralkyl, C1-C20-Acyl, Aroyl, C1-C20-Alkylsulfonyl sowie Arylsulfonyl zu nennen.
  • Als Alkyl-, Silyl- und Acylreste für die Schutzgruppen PG kommen insbesondere die dem Fachmann bekannten Reste in Betracht. Bevorzugt sind aus den entsprechenden Alkyl- und Silylethern leicht abspaltbare Alkyl- bzw. Silylreste, wie beispielsweise der Methoxymethyl-, Methoxyethyl, Ethoxyethyl-, Tetrahydropyranyl-, Tetrahydrofuranyl-, Trimethylsilyl-, Triethylsilyl-, tert.-Butyldimethylsilyl-, tert.-Butyldiphenylsilyl-, Tribenzylsilyl-, Triisopropylsilyl-, Benzyl, para-Nitrobenzyl-, para-Methoxybenzyl-Rest sowie Alkylsulfonyl- und Arylsulfonylreste. Als Acylreste kommen z.B. Formyl, Acetyl, Propionyl, Isopropionyl, Trichlormethylcarbonyl, Pivalyl-, Butyryl oder Benzoyl, die mit Amino- und/oder Hydroxygruppen substituiert sein können, in Frage.
  • Als Aminoschutzgruppen PG kommen die dem Fachmann bekannten Reste in Betracht. Beispielsweise genannt seien die Alloc-, Boc-, Z-, Benzyl, f-Moc-, Troc-, Stabase- oder Benzostabase-Gruppe.
  • Als Halogen-Atome kommen in Betracht Fluor, Chlor, Brom oder Iod.
  • Die Acylgruppen können 1 bis 20 Kohlenstoffatome enthalten, wobei Formyl-, Acetyl-, Propionyl-, Isopropionyl und Pivalylgruppen bevorzugt sind.
  • Die für X mögliche C2-C10-Alkylen-α,ω-dioxygruppe ist vorzugsweise eine Ethylenketal- oder Neopentylketalgruppe.
  • Bevorzugte Verbindungen der allgemeinen Formel 1 sind solche, bei denen A-Y O-C(=O) oder NR21-C(=O), D-E eine H2C-CH2-Gruppe, G eine CH2-Gruppe, Z ein Sauerstoffatom, R1a, R1b jeweils C1-C10 Alkyl oder zusammen eine -(CH2)p-Gruppe mit p gleich 2 oder 3 oder 4, R2a, R2b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, C2-C10 Alkenyl, oder C2-C10 Alkinyl, R3 Wasserstoff; R4a, R4b unabhängig voneinander Wasserstoff oder C1-C10 Alkyl; R5 Wasserstoff, oder C1-C4 Alkyl oder CH2OH oder CH2NH2 oder CH2N(Alkyl, Acyl)1,2 oder CH2Hal, R6 und R7 gemeinsam eine zusätzliche Bindung oder gemeinsam eine NH-Gruppe oder gemeinsam eine N-Alkyl-Gruppe oder gemeinsam eine CH2-Gruppe oder gemeinsam ein Sauerstoffatom, W eine Gruppe C(=X)R8 oder ein 2-Methylbenzothiazol-5-yl-Radikal oder ein 2-Methylbenzoxazol-5-yl-Radikal oder ein Chinolin-7-yl-Radikal oder ein 2-Aminomethylbenzothiazol-5-yl-Radikal oder ein 2-Hydroxymethylbenzothiazol-5-yl-Radikal oder ein 2-Aminomethylbenzoxazol-5-yl-Radikal oder ein 2-Hydroxymethylbenzoxazol-5-yl-Radikal, X eine CR10R11-Gruppe, R8 Wasserstoff oder C1-C4 Alkyl oder ein Fluoratom oder ein Chloratom oder ein Bromatom, R10/R11 Wasserstoff/2-Methylthiazol-4-yl oder Wasserstoff/2-Pyridyl oder Wasserstoff/2-Methyloxazol-4-yl oder Wasserstoff/2-Aminomethylthiazol-4-yl oder Wasserstoff/2-Aminomethyloxazol-4-yl oder Wasserstoff/2-Hydroxymethylthiazol-4-yl oder Wasserstoff/2-Hydroxymethyloxazol-4-yl darstellen.
  • Als Linker der allgemeinen Formel (III) sind Verbindungen bevorzugt, bei denen V eine Bindung oder einen Arylrest und T Sauerstoff darstellen und o gleich Null ist.
  • Als rekombinante Proteine zur Verwendung als Erkennungseinheit kommen beispielsweise aus von Antikörpern abgeleitete Bindungsregionen, sogenannte CDRs in Frage.
  • Als Framework-Strukturen zur Verwendung als Erkennungseinheit kommen beispielsweise hochmolekulare Strukturen, die nicht von Antikörpern abgeleitet sind, in Frage. Beispielsweise genannt seien Strukturen vom Fibronektin-Typ 3 und von Crystallinen.
  • Als Fragmente monoklonaler Antikörper zur Verwendung als Erkennungseinheit seien beispielsweise genannt single-chain Fuv, Fab, F(ab) sowie rekombinante Multimere.
  • Als bevorzugte Erkennungseinheiten kommen solche in Betracht, die sich beispielweise für die Erkennung und/oder Diagnose und/oder Therapie von soliden Tumoren und malignen Erkrankungen des hämatopoetischen Systems eignen.
  • Als weiterhin bevorzugte Erkennungseinheiten kommen solche in Betracht, die eine selektive Erkennung des erkrankungsspezifischen Gefäßsystems, vorzugsweise der Angiogenese, ermöglichen.
  • Tabelle 1 führt Beispiele für besonders bevorzugte Erkennungseinheiten zur Behandlung solider Tumoren auf. TABELLE 1
    Figure 00110001
    Figure 00120001
    Figure 00130001
    Figure 00140001
    Figure 00150001
    Figure 00160001
    Figure 00170001
    Figure 00180001
    Figure 00190001
  • Als besonders bevorzugte Erkennungseinheiten zur Behandlung hämatologischer Tumore seien ferner Antikörper oder Antikörperfragmente wie CD19, CD20, CD40, CD22, CD25, CD5, CD52, CD10, CD2, CD7, CD33, CD38, CD40, CD72, CD4, CD21, CD5, CD37 und CD30 genannt.
  • Als besonders bevorzugte Erkennungseinheiten zur anti-angiogenen Therapie seien ferner Antikörper oder deren Fragmente wie VCAM, CD31, ELAM, Endoglin, VEGFRI/II, αvβ3, Tie1/2, TES23 (CD44ex6), Phosphatidylserin, PSMA, VEGFR/VEGF-Komplex oder ED-B-Fibronectin genannt.
  • Die nachstehend genannten Verbindungen sind als Effektor-Grundkörper erfindungsgemäß besonders bevorzugt:
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-methyl-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-(2-hydroxymethyl-thiazol-4-yl)-1-methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-methylvinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-methyl-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-methyl-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1-methyl-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-methylvinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-(2-(2-hydroxymethyl-thiazol-4-yl)-1-fluor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluor-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1-fluor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluor-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-chlor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlor-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1-chlor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlor-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-fluor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluor-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1-fluor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11 S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluor-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-chlor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlor-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-1-chlor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlor-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-methyl-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-fluor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-fluor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-chlor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-chlor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-fluor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-fluor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-chlor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-chlor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-16-(2-(2-Aminomethyl-oxazol-4-yl)-1-methyl-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1-methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-methylvinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-(2-(2-hydroxymethyl-oxazol-4-yl)-1-methyl-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-methyl-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1-methyl-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-methylvinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-fluor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluor-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1-fluor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluor-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-chlor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlor-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1-chlor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlor-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-fluor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-l3-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluor-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1-fluor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluor-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-chlor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlor-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-oxazol-4-yl)-1-chlor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlor-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-8, 8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methylbenzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methylbenzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-propyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methylbenzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-l0-butyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-allyl-5,5,9,13-tetramethyl-16-(2-methylbenzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-l3-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazolu-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzothiazol-5-yl)-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methylbenzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methylbenzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-propyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methylbenzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-butyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-allyl-5,5,9,13-tetramethyl-16-(2-methylbenzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo(14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-ene-2,6-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethyl-benzoxazol-5-yl)-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecane-5,9-dion,
    (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxabicyclo[14.1.0]heptadecane-5,9-dion.
  • In einer erfindungsgemäßen Verbindung der allgemeinen Formel (1), enthaltend einen der obengenannten Grundkörper, sind die Wasserstoffatome in den obengenannten Grundkörpern an den in Formel (1) angegebenen Positionen durch Reste L1-L3 ersetzt, wobei die Reste L1-L3 die oben angegebenen Bedeutungen haben.
  • Die Erfindung betrifft ferner Linker der allgemeinen Formel III1
    Figure 00340001
    worin
    RG1 eine O=C=N-Gruppe oder eine S=C=N-Gruppe sein kann, und o, V, q und
    FG1 die bereits oben genannten Bedeutungen haben,
    sowie Linker der allgemeinen Formel III2
    Figure 00340002
    worin
    RG2 eine Hal-C(=T)-CHR22-Gruppe oder eine Hal-C(=T)-CHR22-NR23-C(=T)-Gruppe oder eine R26-C(=O)-O-C(=T)-CHR22-Gruppe oder eine R26-C(=O)-O-C(=T)-CHR22-NR23-C(=T)-Gruppe sein kann, R26 C1-C10 Alkyl, Aryl, Aralkyl sein kann, und o, V, q, T und FG1 die bereits oben genannten Bedeutungen haben,
    sowie Linker der allgemeinen Formel III3
    Figure 00350001
    worin
    RG3 eine OH-Gruppe oder eine NHR24a-Gruppe oder eine COOH-Gruppe sein kann, und o, V, q und FG1 die bereits oben genannten Bedeutungen haben; jedoch mit der Bedingung, dass die Verbindung 1-(4-Amino-phenyl)-pyrrol-2,5-dion nicht umfasst ist.
  • Erfindungsgemäss besonders bevorzugt sind Linker der allgemeinen Formeln III1, III2 oder III3, wobei V eine Bindung oder einen Arylrest darstellt, o gleich Null ist und T ein Sauerstoffatom ist.
  • Die Erfindung betrifft ferner Verfahren,
    einen Linker der allgemeinen Formel III1
    mit einer Verbindung der allgemeinen Formel 1, worin die Bedingung, dass mindestens eine Gruppe L1, L2 oder L4 einen Linker darstellt, nicht erfüllt sein muss, und worin L1 und/oder L2 und/oder L4 die Bedeutung eines Wasserstoffatomes haben und freie, für die Umsetzung nicht benötigte Hydroxyl- und/oder Amino-Gruppen gegebenenfalls geschützt sind, umzusetzen,
    einen Linker der allgemeinen Formel III2
    mit einer Verbindung der allgemeinen Formel I, worin die Bedingung, dass mindestens eine Gruppe L1, L2 oder L4 einen Linker darstellt, nicht erfüllt sein muss, und L1 und/oder L2 und/oder L4 die Bedeutung eines Wasserstoffatomes haben und freie, für die Umsetzung nicht benötigte Hydroxyl- und/oder Amino-Gruppen gegebenenfalls geschützt sind, umzusetzen, oder
    einen Linker der allgemeinen Formel III3
    mit einer Verbindung der allgemeinen Formel 1, worin die Bedingung, dass mindestens eine Gruppe L1, L2 oder L4 einen Linker darstellt, nicht erfüllt sein muss, und L1 und/oder L2 und/oder L4 die Bedeutung einer C(=O)Hal-Gruppe oder einer C(=S)Hal-Gruppe haben und freie, für die Umsetzung nicht benötigte Hydroxyl- und/oder Amino-Gruppen gegebenenfalls geschützt sind, umzusetzen.
  • Die Erfindung betrifft ferner die Verwendung einer Verbindung der allgemeinen Formel 1, wobei die Substituenten die oben genannten Bedeutungen haben, jedoch die Bedingung, dass mindestens ein Substituent L1, L2 oder L4 einen Linker der allgemeinen Formel III darstellt, nicht erfüllt sein muss, und mindestens ein Substituent L1, L2 oder L4 Wasserstoff, eine Gruppe C(=O)Cl, oder eine Gruppe C(S)Cl darstellt, in einem Verfahren wie oben beschrieben.
  • Die Erfindung betrifft ferner die Verwendung einer Verbindung der allgemeinen Formel 1, wobei die Substituenten die oben genannten Bedeutungen haben, jedoch die Bedingung, dass mindestens ein Substituent L1, L2 oder L4 einen Linker der allgemeinen Formel III darstellt, nicht erfüllt sein muss, und mindestens ein Substituent L1, L2 oder L4 Wasserstoff, eine Gruppe C(=O)Cl, oder eine Gruppe C(S)Cl darstellt, zur Herstellung eines Effektor-Erkennungseinheit-Konjugats wie oben beschrieben.
  • Die Erfindung betrifft ferner die Verwendung eines Linkers der allgemeinen Formel III1, III2 oder III3 zur Herstellung eines Effektor-Konjugats, wie oben beschrieben.
  • Die Erfindung betrifft ferner die Verwendung eines Linkers der allgemeinen Formel III1, III2 oder III3 zur Herstellung eines Effektor-Erkennungseinheit-Konjugats wie oben beschrieben.
  • Die Erfindung betrifft ferner die Verwendung einer Erkennungseinheit, wie vorstehend beschrieben, in einem der erfindungsgemäßen Verfahren zur Herstellung eines Eftektor-Erkennungseinheit-Konjugats, wie oben beschrieben.
  • Die Erfindung betrifft ferner die erfindungsgemäßen Effektor-Erkennungseinheit-Konjugate zur Verwendung als Medikament oder zur Herstellung eines Medikaments oder einer pharmazeutischen Zusammensetzung.
  • Die Erfindung betrifft schließlich die Verwendung der erfindungsgemäßen Effektor-Erkennungseinheit-Konjugate zur Herstellung von Medikamenten für die Behandlung von Erkrankungen, die mit proliferativen Prozessen verknüpft sind, wie Tumore, entzündliche und/oder neurodegenerative Erkrankungen, Multiple Sklerose, Morbus Alzheimer, oder für die Behandlung von Angiogenese-assoziierten Erkrankungen, wie Tumorwachstum, rheumatoide Arthritis oder Erkrankungen des Augenhintergrundes.
  • Beispiele zur Synthese von Linkern (L)
  • Beispiel L1
  • (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-propansäure
  • Beispiel L1a
  • (S) 2-[(3-Acetylsulfanyl-propionyl)-methyl-amino]-propansäure ethylester
  • Die Lösung von 15 g (89,5 mmol) N-Methylalaninethylester-Hydrochlorid in 850 ml wasserfreiem Tetrahydrofuran versetzt man bei 23°C mit 4,1 g einer ca. 60%igen Natriumhydrid-Dispersion und nach 3 Stunden mit 23,5 g 3-Acetylsulfanylpropansäurechlorid. Man lässt 2 Tage reagieren, versetzt mit gesättigter Natriumhydrogencarbonatlösung und extrahiert mehrfach mit Ethylacetat. Die vereinigten organischen Extrakte wäscht man mit gesättigter Natriumchloridlösung, trocknet über Natriumsulfat und reinigt den nach Filtration und Lösungsmittelabzug erhaltenen Rückstand durch Chromatographie an feinem Kieselgel. Isoliert werden 17,6 g (67,3 mmol, 75%) der Titelverbindung als farbloses Öl.
  • Beispiel L1b
  • (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-propansäure
  • Die Lösung von 17,6 g (67,3 mmol) der nach Beispiel L1a dargestellten Verbindung in 150 ml Methanol versetzt man bei 23°C mit 44 ml einer 5M Natronlauge und rührt 5 Stunden. Durch Zugabe einer 4N Salzsäure stellt man einen pH von 2 ein und extrahiert mit Dichlormethan. Die vereinigten organischen Extrakte wäscht man mit gesättigter Natriumchloridlösung und trocknet über Natriumsulfat. Den nach Filtration und Lösungsmittelabzug erhaltenen Rückstand (13,0 g, max. 67,3 mmol) setzt man ohne Reinigung weiter um.
  • Beispiel L1c
  • (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-propansäure methylester
  • Die Lösung von 4,53 g (max. 23,7 mmol) des nach Beispiel L1 b dargestellten Rohproduktes in 135 ml Diethylether verestert man bei 0°C mit einer etherischen Lösung von Diazomethan. Nach Lösungsmittelabzug isoliert man 4,59 g (22,4 mmol, 94%) der Titelverbindung als blass gelbes Öl, das man ohne Reinigung weiter umsetzt.
  • Beispiel L1d
  • (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-propansäure methylester
  • Zu der Lösung von 21 g 2-Methyldisulfanyl-isoindol-1,3-dion in 420 ml Trichlormethan gibt man die Lösung von 14 g (68,2 mmol) der nach Beispiel L1c dargestellten Verbindung in 180 ml Trichlormethan und rührt 16 Stunden bei 23°C. Man engt ein, nimmt in Dichlormethan auf und rührt 0,5 Stunden. Feststoff wird abfiltriert, das Filtrat eingeengt und der Rückstand durch Chromatographie an feinem Kieselgel gereinigt. Isoliert werden 16,2 g (57,2 mmol, 84%) der Titelverbindung als farbloses Öl.
  • Beispiel L1
  • (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-propansäure
  • Die Lösung von 10 g (35,3 mmol) der nach Beispiel L1d dargestellten Verbindung in 20 ml Ethanol versetzt man mit 1 l pH 7 Phosphatpuffer, Schweineleberesterase und inkubiert bei 27°C 46 Stunden. Durch Zugabe einer 4N Salzsäure stellt man auf pH 1 ein, extrahiert mit Dichlormethan, trocknet über Natriumsulfat und isoliert nach Filtration und Lösungsmittelabzug 8,3 g (30,8 mmol, 87%) der Titelverbindungn als farbloses Öl, das ohne weitere Reinigung umgesetzt wird.
    1H-NMR (CDCl3): δ = 1,43+1,51 (3H), 2,55+2,63 (3H), 2,87 (2H), 2,88+3,00 (3H), 3,08–3,26 (2H), 4,63+5,19 (1H), 7,90 (1H) ppm.
  • Beispiel L2
  • [(3-Methyltrisulfanyl-propionyl)-methyl-amino]-essigsäure
  • Beispiel L2a
  • 2-[(3-Acetylsulfanyl-propionyl)-methyl-amino]-essigsäure ethylester
  • 7,13 g (46,4 mmol) N-Methylglycinethylester-Hydrochlorid setzt man in Analogie zu Beispiel L1a um und isoliert 6,9 g (27,9 mmol, 60%) der Titelverbindung als farbloses Öl.
  • Beispiel L2b
  • [(3-Mercapto-propionyl)-methyl-amino]-essigsäure
  • 7,6 g (30,7 mmol) der nach Beispiel L2a dargestellten Verbindung setzt man in Analogie zu Beispiel L1 b um und isoliert 4,92 g (27,8 mmol, 90%) der Titelverbindung als farbloses Öl.
  • Beispiel L2c
  • [(3-Mercapto-propionyl)-methyl-amino]-essigsäure methylester
  • 4,92 g (27,8 mmol) der nach Beispiel L2b dargestellten Verbindung setzt man in Analogie zu Beispiel L1c um und isoliert 5,01 g (26,2 mmol, 94%) der Titelverbindung als farbloses Öl.
  • Beispiel L2d
  • [(3-Methyltrisulfanyl-propionyl)-methyl-amino]-essigsäure methylester
  • 2,00 g (10,5 mmol) der nach Beispiel L2c dargestellten Verbindung setzt man in Analogie zu Beispiel L1d um und isoliert 2,33 g (8,65 mmol, 82%) der Titelverbindung als farbloses Öl.
  • Beispiel L2
  • [(3-Methyltrisulfanyl-propionyl)-methyl-amino]-essigsäure
  • 2,00 g (7,83 mmol) der nach Beispiel L2d dargestellten Verbindung setzt man in Analogie zu Beispiel L1 um und isoliert 0,64 g (2,51 mmol, 32%) der Titelverbindung als farbloses Öl.
    1H-NMR (CDCl3): δ = 2,41 + 2,56 (3H), 2,61-3,27 (7H), 3,98 (2H), 4,38 (1H) ppm.
  • Beispiel L3
  • (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-3-phenyl-propionsäure
  • Beispiel L3a
  • (S) 2-[(3-Acetylsulfanyl-propionyl)-methyl-amino]-3-phenyl-propansäure ethylester
  • 7,73 g (31,7 mmol) N-Methylphenylalaninethylester-Hydrochlorid setzt man in Analogie zu Beispiel L1a um und isoliert 2,3 g (6,82 mmol, 22%) der Titelverbindung als farbloses Öl.
  • Beispiel L3b
  • (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-3-phenyl-propansäure
  • 1,09 g (3,23 mmol) der nach Beispiel L3a dargestellten Verbindung setzt man in Analogie zu Beispiel L1 b um und isoliert 0,744 g (2,78 mmol, 86%) der Titelverbindung als farbloses Öl.
  • Beispiel L3c
  • (S) 2-[(3-Mercapto-propionyl)-methyl-amino]-3-phenyl-propansäure methylester
  • 0,74 g (2,77 mmol) der nach Beispiel L3b dargestellten Verbindung setzt man in Analogie zu Beispiel L1c um und isoliert 0,77 g (2,74 mmol, 99%) der Titelverbindung als farbloses Öl.
  • Beispiel L3
  • (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-3-phenyl-propansäure methylester
  • 0,77 g (2,74 mmol) der nach Beispiel L3c dargestellten Verbindung setzt man in Analogie zu Beispiel L1d um und isoliert 0,72 g (2,00 mmol, 73%) der Titelverbindung als farbloses Öl.
  • Beispiel L3
  • (S) 2-[(3-Methyltrisulfanyl-propionyl)-methyl-amino]-3-phenyl-propansäure
  • 0,72 g (2,00 mmol) der nach Beispiel L3d dargestellten Verbindung setzt man in Analogie zu Beispiel L1 um und isoliert 0,49 g (1,42 mmol, 71%) der Titelverbindung als farbloses Öl.
  • Beispiel L4
  • 4-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-butansäure
  • 20,0 g (193,9 mmol) 4-Aminobuttersäure versetzt man mit 19 g Maleinsäureanhydrid, 290 ml Essigsäure und erhitzt 4 Stunden im 130°C heissen Ölbad. Man engt unter wiederholtem Zusatz von Toluol azeotrop ein, nimmt den Rückstand in Dichlormethan auf und reinigt durch Chromatographie an feinem Kieselgel. Isoliert werden 17,1 g (93,4 mmol, 48%) der Titelverbindung als kristallinen Feststoff.
    1H-NMR (CDCl3): δ = 1,93 (2H), 2,38 (2H), 3,60 (2H), 6,71 (2H) ppm.
  • Beispiel L4a
  • 1-(3-Isocyanato-propyl)-pyrrol-2,5-dion
  • 5,0 g (27,3 mmol) der nach Beispiel L4 dargestellten Verbindung löst man in 90 ml Tetrahydrofuran, versetzt mit 8 ml Triethylamin, 6,17 ml Phosphorsäurediphenylesterazid und rührt 1,5 Stunden bei 23°C. Anschließend versetzt man mit 110 ml Toluol, destilliert das Tetrahydrofuran ab und erwärmt 2 Stunden auf 70°C. Das Rohprodukt reinigt man durch Chromatographie an feinem Kieselgel. Isoliert werden 1,77 g (9,82 mmol, 36%) der Titelverbindung.
  • Beispiel L5
  • 6-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-hexansäure
  • 100 g (762 mmol) 6-Aminocapronsäure setzt man in Analogie zu Beispiel L5 um und isoliert 93,8 g (444 mmol, 58%) der Titelverbindung als kristallinen Feststoff.
    1H-NMR (CDCl3): δ = 1,34 (2H), 1,55-1,70 (4H), 2,34 (2H), 3,51 (2H), 6,69 (2H) ppm.
  • Beispiel L5a
  • 1-(5-Isocyanato-pentyl)-pyrrol-2,5-dion
  • 10,0 g (47,3 mmol) der nach Beispiel L5 dargestellten Verbindung setzt man in Analogie zu Beispiel L4a um und isoliert 3,19 g (15,3 mmol, 32%) der Titelverbindung als farbloses Öl.
  • Beispiel L6
  • 11-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-undecansäure
  • 10 g (49,7 mmol) 11-Aminoundecansäure setzt man in Analogie zu Beispiel L5 um und isoliert 6,29 g (22,4 mmol, 45%) der Titelverbindung als kristallinen Feststoff.
    1H-NMR (CDCl3): δ = 1,19–1,36 (12H), 1,51-1,67 (4H), 2,34 (2H), 3,49 (2H), 6,68 (2H) ppm.
  • Beispiel L6a
  • 1-(10-Isocyanato-decyl)-pyrrol-2,5-dion
  • 5,28 g (18,8 mmol) der nach Beispiel L6 dargestellten Verbindung setzt man in Analogie zu Beispiel L4a um und isoliert 3,37 g (12,1 mmol, 64%) der Titelverbindung als farbloses Öl.
  • Beispiel L7
  • 1-(4-Amino-phenyl)-pyrrol-2,5-dion
  • Die Lösung von 21,6 g (200 mmol) 1,4-Phenylendiamin in 200 ml Tetrahydrofuran versetzt man über 1,5 Stunden mit der Lösung von 19,6 g Maleinsäureanhydrid und rührt 22 Stunden bei 23°C. Man filtriert, wäscht mit Tetrahydrofuran nach und trocknet das Filtrat. Isoliert werden 37,1 g (197 mmol, 98%) der Titelverbindung als kristalliner Feststoff.
    1H-NMR (d6-DMSO): δ = 6,28 (1H), 6,48 (1H), 6,53 (2H), 7,30 (2H), 7,50–9,00 (2H) ppm.
  • Beispiel L8
  • 1-(4-Hydroxy-phenyl)-pyrrol-2,5-dion
  • Die Suspension aus 5,0 g (45,8 mmol) 4-Aminophenol, 4,49 g Maleinsäureanhydrid und 40 ml Essigsäure erhitzt man 3 Stunden unter Rückfluss. Man engt ein, entfernt restliche Essigsäure azeotrop durch wiederholte Destillation mit Essigsäure und reinigt den Rückstand durch Chromatographie an feinem Kieselgel. Isoliert werden 2,83 g (15,0 mmol, 33%) der Titelverbindung.
    1H-NMR (d6-DMSO): δ = 6,83 (2H), 7,09 (2H), 7,13 (2H), 9,71 (1H) ppm.
  • Beispiele zur Synthese von Effektor-Linker-Konjugaten (EL)
  • Beispiel EL1
  • (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]carbaminsäure-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • Beispiel EL1a
  • (4S,7R,8S,9S,13Z,16S)-7-Allyl-8-(terf-butyl-dimethyl-silanyloxy)-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion
  • Die Lösung von 6,0 g (7,93 mmol) (4S,7R,8S,9S,13Z,16S)-7-Allyl-4,8-bis(terfbutyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)oxacyclohexadec-13-en-2,6-dion, das man in Analogie zu dem in WO 00/66589 beschrieben Verfahren hergestellt hat, in 186 ml wasserfreiem Dichlormethan versetzt man bei 0°C mit 26,4 ml einer 20%igen Lösung von Trifluoressigsäure in Dichlormethan und rührt 6 Stunden bei 0°C. Man gießt in gesättigte Natriumhydrogencarbonatlösung, extrahiert mit Dichlormethan, wäscht die vereinigten organischen Extrakte mit Wasser und trocknet über Magnesiumsulfat. Den nach Filtration und Lösungsmittelabzug erhaltenen Rückstand reinigt man durch Chromatographie an feinem Kieselgel. Isoliert werden 3,32 g (5,17 mmol, 65%) der Titelverbindung als farbloser Feststoff.
    1H-NMR (CDCl3): δ = 0,09 (3H), 0,12 (3H), 0,93 (9H), 1,00 (3H), 1,06 (3H), 1,22 (3H), 1,70 (3H), 1,03-1,77 (5H), 1,95 (1H), 2,31-2,56 (6H), 2,83 (3H), 2,87 (1H), 3,00 (1H), 3,30 (1H), 3,90 (1H), 4,09 (1H), 4,94-5,03 (2H), 5,20 (1H), 5,77 (1H), 5,88 (1H), 7,34 (1H), 7,78 (1H), 7,95 (1H) ppm.
  • Beispiel EL1b
  • (4S,7R,8S,9S,13Z,16S)-3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-7-allyl-8-tert-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • 50 mg (78 μmol) der nach Beispiel EL1a dargestellten Verbindung löst man in einem Gemisch aus 1,5 ml Trichlormethan und 1,5 ml Dimethylformamid, versetzt mit 144 mg des nach Beispiel L4a dargestellten Linkers, 79 mg Kupfer-(I)-Chlorid und erhitzt 18 Stunden auf 70°C. Das Rohgemisch reinigt man durch Chromatographie an Dünnschichtplatten und isoliert 51 mg (62 μmol, 80%) der Titelverbindung als farbloses Öl.
  • Beispiel EL1
  • (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • Die Lösung von 41 mg (50 μmol) der nach Beispiel 1b dargestellten Verbindung in einem Gemisch aus 0,8 ml Tetrahydrofuran und 0,8 ml Acetonitril versetzt man 310 μl Hexafluorkieselsäure, 310 μl Fluorwasserstoff-Pyridin-Komplex und rührt 23 Stunden bei 23°C. Man gießt in eine 5%ige Natronlauge, extrahiert mit Ethylacetat, wäscht die vereinigten organischen Extrakte mit einer gesättigten Natriumchloridlösung und trocknet über Natriumsulfat. Den nach Filtration und Lösungsmittelabzug erhaltenen Rückstand reinigt man durch Chromatographie an Dünnschichtplatten und isoliert 26 mg (36,7 μmol, 73%) der Titelverbindung als farblosen Schaum.
    1H-NMR (CDCl3): δ = 0,99 (3H), 1,14 (3H), 1,17 (3H), 1,20-1,51 (3H), 1,54-1,87 (6H), 1,70 (3H), 2,22 (1 H), 2,28–3,02 (9H), 2,83 (3H), 3,31 (1H), 3,45 (1H), 3,68 (1H), 4,44+4,83 (1H), 4,99 (1H), 5,03 (1H), 5,15 (1H), 5,61 (1H), 5,72 (1H), 5,91 (1H), 6,68 (2H), 7,36 (1H), 7,78 (1H), 7,90 (1H) ppm.
  • Beispiel EL2
  • (1S,3S,7S,10R,11 S,12S,16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (A) und
  • (1R,3S,7S,10R,11S,12S,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (B)
  • Die Lösung von 44 mg (62,2 μmol) der nach Beispiel 1 dargestellten Verbindung in 2,0 ml Dichlormethan kühlt man auf -50°C und versetzt portionsweise über einen Zeitraum von 1,5 Stunden mit insgesamt 1,7 ml einer ca. 0,1 M Lösung von Dimethyldioxiran in Aceton. Man gießt in eine gesättigte Natriumthiosulfatlösung, extrahiert mit Dichlormethan und trocknet die vereinigten organischen Extrakte über Natriumsulfat. Den nach Filtration und Lösungsmittelabzug erhaltenen Rückstand reinigt man durch Chromatographie an Dünnschichtplatten und isoliert 22,7 mg (31,4 μmol, 50%) der Titelverbindung A sowie 7,6 mg (10,5 μmol, 17%) der Titelverbindung B jeweils als farblosen Schaum.
    1H-NMR (CDCl3) von A: δ = 1,01 (3H), 1,14 (3H), 1,16 (3H), 1,20-1,94 (8H), 1,32 (3H), 2,11-2,74 (9H), 2,82 (1H), 2,84 (3H), 3,30 (2H), 3,48 (2H), 3,68 (1H), 4,36+4,93 (1H), 4,99 (1H), 5,04 (1H), 5,54 (1H), 5,69 (1H), 6,05 (1H), 6,68 (2H), 7,32 (1H), 7,80 (1H), 7,88 (1 H) ppm.
    1H-NMR (CDCl3) von B: δ = 1,02 (6H), 1,26 (3H), 1,33 (1H), 1,23–2,27 (12H), 2,54-2,78 (4H), 2,82 (3H), 2,91 (1H), 3,13 (1H), 3,40 (2H), 3,66 (1H), 4,11 (1H), 4,84 (1H), 4,95 (1H), 5,01 (1H), 5,70 (1H), 5,81+5,93 (1H), 6,04+6,13 (1H), 6,69 (2H), 7,35 (1H), 7,75 (1H), 7,90+7,99 (1H) ppm.
  • Beispiel EL3
  • (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • Beispiel EL3a
  • (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-7-allyl-8-tert-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-l3-en-4-yl ester
  • 50 mg (78 μmol) der nach Beispiel EL1a dargestellten Verbindung setzt man in Analogie zu Beispiel EL1b mit dem nach Beispiel L5a hergestellten Linker um und isoliert nach Reinigung 39 mg (45,9 μmol, 59%) der Titelverbindung als farbloses Öl.
  • Beispiel EL3
  • (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • 84 mg (98,8 μmol) der nach Beispiel EL3a dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 um und isoliert nach Reinigung 43 mg (58,4 μmol, 59%) der Titelverbindung als farblosen Schaum.
    1H-NMR (CDCl3): δ = 0,89 (3H), 0,96 (3H), 0,85-1,97 (17H), 1,12 (3H), 2,16-3,01 (10H), 2,82 (3H), 3,44 (1H), 3,65 (1H), 4,41 + 4,53 (1H), 4,98 (1H), 5,03 (1H), 5,15 (1H), 5,60 (1H), 5,71 (1H), 5,90 (1H), 6,68 (2H), 7,35 (1H), 7,77 (1H), 7,89 + 7,96 (1H) ppm.
  • Beispiel EL4
  • (1S,3S,7S,10R,11S,12S,16R)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (A) und
  • 1R,3S,7S,10R,11S,12S,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (B)
  • 26 mg (35,3 μmol) der nach Beispiel EL3 dargestellten Verbindung setzt man in Analogie zu Beispiel EL2 um und isoliert nach Reinigung 9,1 mg (12,1 μmol, 34%) der Titelverbindung A sowie 3,0 mg (4,0 μmol, 11 %) der Titelverbindung B jeweils als farblosen Schaum.
    1H-NMR (CDCl3) von A: δ = 0,83-1,94 (15H), 0,98 (3H), 1,14 (3H), 1,16 (3H), 1,32 (3H), 2,15-2,82 (8H), 2,84 (3H), 3,44 (2H), 3,51 (1H), 3,66 (1H), 4,46 (1H), 4,99 (1H), 5,04 (1H), 5,54 (1H), 5,69 (1H), 6,06 (1H), 6,68 (2H), 7,33 (1H), 7,80
    (1H), 7,89 (1H) ppm. 1H-NMR (CDCl3) von B: δ = 0,78-2,74 (23H), 1,01 (3H), 1,03 (3H), 1,33 (3H), 2,82 (3H), 2,91 (1H), 3,14 (1H), 3,39 (1H), 3,47 (2H), 3,67 (1H), 4,12 (1H), 4,49 (1H), 4,92-5,06 (2H), 5,53+5,80 (1H), 5,69 (1H), 6,11 (1H), 6,68 (2H), 7,34 (1H), 7,74+7,79 (1H), 7,89+8,02 (1H) ppm.
  • Beispiel EL5
  • (4S,7R,8S,9S,13Z,16S)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-decyl]-carbaminsäure-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • Beispiel EL5a
  • (4S,7R,8S,9S,13Z,16S)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-decyl]-carbaminsäure-7-allyl-8-tert-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • 50 mg (78 μmol) der nach Beispiel EL1a dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 b mit dem nach Beispiel L6a hergestellten Linker um und isoliert nach Reinigung 56 mg (60,8 μmol, 78%) der Titelverbindung als farbloses Öl.
  • Beispiel EL5
  • (4S,7R,8S,9S,13Z,16S)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-decyl]-carbaminsäure-7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester
  • 20 mg (21,7 μmol) der nach Beispiel EL5a dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 um und isoliert nach Reinigung 10 mg (12,4 μmol, 57%) der Titelverbindung als farblosen Schaum.
    1H-NMR (CDCl3): δ = 0,91-1,87 (22H), 0,97 (3H), 1,13 (3H), 1,17 (3H), 1,70 (3H), 2,18-2,69 (8H), 2,80 (1H), 2,82 (3H), 2,96 (1H), 3,47 (1H), 3,50 (2H), 3,66 (1H), 3,97 + 4,36 (1H), 4,98 (1H), 5,04 (1H), 5,16 (1H), 5,61 (1H), 5,72 (1H), 5,91 (1H), 6,68 (2H), 7,37 (1H), 7,77 (1H), 7,90 + 7,97 (1H) ppm.
  • Beispiel EL6
  • (1S,3S,7S,10R,11S,12S,16R)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-decyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (A) und
  • (1R,3S,7S,10R,11S,12S,16S)-[10-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-decyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester (B)
  • 18 mg (22 μmol) der nach Beispiel EL5 dargestellten Verbindung setzt man in Analogie zu Beispiel EL2 um und isoliert nach Reinigung 9,2 mg (11,2 μmol, 51 %) der Titelverbindung A sowie 3,2 mg (3,9 μmol, 18%) der Titelverbindung B jeweils als farblosen Schaum.
    1H-NMR (CDCl3) von A: δ = 0,98 (3H), 1,14 (3H), 1,16 (3H), 1,32 (3H), 1,03-1,67 (21H), 1,71-1,94 (3H), 2,18-2,78 (9H), 2,83 (3H), 3,50 (3H), 3,66 (1H), 3,87 + 4,43 (1H), 4,98 (1H), 5,04 (1H), 5,53 (1H), 5,69 (1H), 6,07 (1H), 6,68 (2H), 7,33 (1H), 7,80 (1H), 7,89 + 7,93 (1H) ppm.
    1H-NMR (CDCl3) von B: δ = 0,80-1,64 (21H), 1,01 (3H), 1,03 (3H), 1,25 (3H), 1,33 (3H), 1,79-2,25 (5H), 2,34 + 3,14 (1H), 2,52-2,76 (4H), 2,81 (3H), 2,91 (1H), 3,40 (1H), 3,51 (2H), 3,67 + 3,82 (1H), 4,13 + 4,26 (1H), 4,46 (1H), 4,94 (1H), 5,01 (1H), 5,70 (1H), 5,81 + 5,94 (1H), 6,05 + 6,12 (1H), 6,68 (2H), 7,36 (1H), 7,74 (1H), 7,91 + 8,02 (1H) ppm.
  • Beispiel EL7
  • (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester
  • Beispiel EL7a
  • (4S,7R,8S,9S,13Z,16S)-7-Allyl-4-(tert-butyl-dimethyl-silanyloxy)-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion
  • Die Lösung von 5,3 g (7,01 mmol) (4S,7R,8S,9S,13Z,16S)-7-Allyl-4,8-bis(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion, das man in Analogie zu dem in WO 00/66589 beschrieben Verfahren hergestellt hat, in einem Gemisch aus 85 ml Tetrahydrofuran und 85 ml Acetonitril versetzt man mit 31,7 ml Hexafluorkieselsäure, kühlt auf 0°C, tropft 8,1 ml Trifluoressigsäure zu und rührt 20 Stunden bei 0°C. Man gießt in Wasser, neutralisiert durch Zugabe einer gesättigten Natriumhydrogencarbonatlösung und extrahiert mehrfach mit Ethylacetat. Die vereinigten organischen Extrakte wäscht man mit gesättigter Natriumchloridlösung, trocknet über Natriumsulfat und reinigt den nach Filtration und Lösungsmittelabzug gewonnenen Rückstand durch Chromatographie an feinem Kieselgel. Isoliert werden 2,82 g (4,39 mmol, 63%) der Titelverbindung als farbloser Feststoff.
    1H-NMR (CDCl3): δ = -0,09 (3H), 0,08 (3H), 0,84 (9H), 1,08 (3H), 1,10 (3H), 1,12 (3H), 1,21-1,86 (5H), 1,70 (3H), 2,15 (1H), 2,29-2,97 (8H), 2,84 (3H), 3,14 (1H), 3,96 (1H), 4,03 (1H), 4,97-5,06 (2H), 5,23 (1H), 5,61 (1H), 5,77 (1H), 7,35 (1H), 7,79 (1H), 7,93 (1H) ppm.
  • Beispiel EL7b
  • (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-7-allyl-4-terf-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-l3-en-8-yl ester
  • 100 mg (156 μmol) der nach Beispiel EL7a dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 b mit dem nach Beispiel L4a hergestellten Linker um und isoliert nach Reinigung 121 mg (147 μmol, 94%) der Titelverbindung als farbloses Öl.
  • Beispiel EL7
  • (4S,7R,8S,9S,13Z,16S)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester
  • 46 mg (56 μmol) der nach Beispiel EL7b dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 um und isoliert nach Reinigung 17 mg (24 μmol, 43%) der Titelverbindung als farblosen Schaum.
    1N-NMR (CDCl3): δ = 0,99-1,30 (2H), 1,03 (3H), 1,07 (3H), 1,21 (3H), 1,51-1,97 (6H), 1,72 (3H), 2,27-2,61 (6H), 2,83 (3H), 2,88 (1H), 3,09 (1H), 3,14 (2H), 3,51 (1H), 3,58 (2H), 4,04 (1H), 4,96-5,04 (2H), 5,12 (1H), 5,19 (1H), 5,28 (1H), 5,75 (1H), 5,86 (1H), 6,66 (2H), 7,35 (1H), 7,78 (1H), 7,96 (1H) ppm.
  • Beispiel EL8
  • (1S,3S,7S,10R,11S,12S,16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-11-yl ester (A) und
  • (1S,3S,7S,10R,11S,12S,16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]carbaminsäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-11-yl ester (B)
  • 29 mg (41 μmol) der nach Beispiel EL7 dargestellten Verbindung setzt man in Analogie zu Beispiel EL2 um und isoliert nach Reinigung 18 mg (24,9 μmol, 61 %) der Titelverbindung A sowie 3,0 mg (4,1 μmol, 10%) der Titelverbindung B jeweils als farblosen Schaum.
    1H-NMR (CDCl3) von A: δ = 0,98 (3H), 1,05 (3H), 1,24 (3H), 1,26 (3H), 1,12-1,83 (9H), 2,12-2,46 (4H), 2,59 (2H), 2,76 (1H), 2,84 (3H), 3,14 (2H), 3,59 (3H), 3,98 (1H), 4,10 (1H), 4,95-5,02 (2H), 5,17 (2H), 5,77 (1H), 6,19 (1H), 6,70 (2H), 7,38 (1H), 7,82 (1H), 7,97 (1H) ppm.
    1H-NMR (CDCl3) von B: δ = 0,96 (3H), 1,01 (3H), 1,13-1,86 (11H), 1,28 (3H), 1,32 (1H), 2,16-2,50 (6H), 2,84 (3H), 3,02 (1H), 3,15 (2H), 3,50 (1H), 3,61 (2H), 3,88 (1H), 4,19 (1H), 4,96-5,04 (2H), 5,13 (1H), 5,28 (1H), 5,78 (1H), 6,33 (1H), 6,71 (2H), 7,36 (1H), 7,81 (1H), 7,96 (1H) ppm.
  • Beispiel EL9
  • (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester
  • Beispiel EL9a
  • (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-7-allyl-4-tert-butyl-dimethylsilyloxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester
  • 100 mg (156 μmol) der nach Beispiel EL7a dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 b mit dem nach Beispiel L5a hergestellten Linker um und isoliert nach Reinigung 56 mg (65,9 μmol, 42%) der Titelverbindung als farbloses Öl.
  • Beispiel EL9
  • (4S,7R,8S,9S,13Z,16S)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester
  • 56 mg (65,9 μmol) der nach Beispiel EL7b dargestellten Verbindung setzt man in Analogie zu Beispiel EL1 um und isoliert nach Reinigung 24,7 mg (33,6 μmol, 51 %) der Titelverbindung als farblosen Schaum.
    1H-NMR (CDCl3): δ = 0,97-1,84 (11H), 1,02 (3H), 1,07 (3H), 1,20 (3H), 1,71 (3H), 1,91 (1H), 2,27-2,57 (6H), 2,84 (3H), 2,88 (1H), 2,95 (1H), 3,16 (2H), 3,51 (3H), 4,02 (1H), 4,46 + 4,83 (1H), 4,94-5,03 (2H), 5,15 (1H), 5,20 (1H), 5,74 (1H), 5,84 (1H), 6,68 (2H), 7,35 (1H), 7,80 (1H), 7,96 (1H) ppm.
  • Beispiel EL10
  • (1S,3S,7S,10R,11 S,12S,16R)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]-carbaminsäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-11-yl ester (A) und
  • (1S,3S,7S,10R,11S,12S,16R)-[5-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-pentyl]carbaminsäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-11-yl ester (B)
  • 24,7 mg (33,6 μmol) der nach Beispiel EL9 dargestellten Verbindung setzt man in Analogie zu Beispiel EL2 um und isoliert nach Reinigung 16,7 mg (22,2 μmol, 66%) der Titelverbindung A sowie 2,0 mg (2,7 μmol, 8%) der Titelverbindung B jeweils als farblosen Schaum.
    1H-NMR (CDCl3) von A: δ = 0,98 (3H), 1,04 (3H), 1,10-1,75 (13H), 1,23 (3H), 1,26 (3H), 2,09-2,62 (6H), 2,75 (1H), 2,84 (3H), 3,15 (2H), 3,51 (2H), 3,57 (1H), 3,99 (1H), 4,08 (1H), 4,46+4,74 (1H), 4,93-5,02 (2H), 5,18 (1H), 5,76 (1H), 6,18 (1H), 6,68 (2H), 7,38 (1H), 7,82 (1H), 7,97 (1H) ppm.
    1H-NMR (CDCl3) von B: δ = 0,83–1,85 (13H), 0,95 (3H), 1,01 (3H), 1,27 (3H), 1,32 (3H), 2,17-2,49 (6H), 2,84 (3H), 3,03 (1H), 3,17 (2H), 3,48 (1H), 3,53 (2H), 3,86 (1H), 4,18 (1H), 4,66 (1H), 4,94-5,03 (2H), 5,27 (1H), 5,76 (1H), 6,33 (1H), 6,69 (2H), 7,35 (1H), 7,81 (1H), 7,96 (1H) ppm.
  • Beispiel EL11
  • (1 S,3S(E),7S,10R,11S,12S,16R)-[3-(2,5-Dioxo-2,5-dihydro-pyrrol-1-yl)-propyl]-carbaminsäure 7-[3-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-propylcarbamoyloxy]-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-11-yl ester
  • 10 mg (19,7 μmol) (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadecan setzt man in Analogie zu Beispiel EL1b mit dem nach Beispiel L4a hergestellten Linker um und isoliert nach Reinigung 7 mg (8,06 μmol, 41 %) der Titelverbindung als farbloses Öl.
    1H-NMR (CDCl3): δ = 0,88-2,20 (13H), 1,03 (3H), 1,05 (3H), 1,10 (3H), 1,24 (3H), 1,28 (3H), 2,08 (3H), 2,63-2,85 (4H), 2,71 (3H), 2,99-3,25 (3H), 3,41-3,50 (3H), 3,62 (2H), 4,88-5,70 (5H), 6,52 (1 H), 6,69 (2H), 6,71 (2H), 7,02 (1 H) ppm.
  • Analog zu den genannten Beispielen werden folgende Effektorkonjugate erhalten:
  • Beispiel EL12
  • (4S,7R,8S,9S,13Z,16S)-Kohlensäure 7-allyl-8-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-phenyl ester
  • (Als Zwischenprodukt wird (4S,7R,8S,9S,13Z,16S)-Kohlensäure 7-allyl-8-(tertbutyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-4-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-phenyl ester isoliert.)
  • Beispiel EL13
  • (1 S,3S,7S,10R,11S,12S,16R)-Kohlensäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo(14.1.0]heptadec-7-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-phenyl ester
  • Beispiel EL14
  • (4S,7R,8S,9S,13Z,16S)-Kohlensäure 7-allyl-4-hydroxy-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-phenyl ester
  • (Als Zwischenprodukt wird (4S,7R,8S,9S,13Z,16S)-Kohlensäure 7-allyl-4-(tert-butyl-dimethyl-silanyloxy)-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-2,6-dioxo-oxacyclohexadec-13-en-8-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-phenyl ester isoliert.)
  • Beispiel EL15
  • (1S,3S,7S,10R,11S,12S,16R)-Kohlensäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-11-yl ester 4-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-phenyl ester
  • Beispiele zur Synthese von Effektor-Linker-Erkennungseinheiten (ELE)
  • Beispiel ELE1
  • [3-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-propyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester
  • Beispiel ELE1a
  • Reduktion eines Antikörperfragments mit endständigem Cystein
  • Ein einzelsträngiges Protein bestehend aus den variablen Domänen der schweren und leichten Antikörper Kette (single-chain Fv, scFv) der Aminosäurenabfolge EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFSMSWV RQAPGKGLEVWSSISGSSGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAED TAVyyCAKPFPYFDYWGQGTLVTVSSGDGSSGGSGGASEIVLTQSPGTLSLSP GERATLSCRASQSVSSSFLAWYQQKPGQAPRLLIYYASSRATGIPDRFSGSGS GTDFTLTISRLEPEDFAVYYCQQTGRIPPTFGQGTKVEIKGGGCA, das spezifisch die Fibronektin Domäne B (ED-B) erkennt und als AP39 bezeichnet wird, wird nach Reduktion des c-terminalen Cysteins zur Kopplung verwendet. Zur Reduktion wird die Lösung von 661 μg Tri(2-carboxyethyl)phosphin-Hydrochlorid in 236 μl PBS mit der Lösung von 1,54 mg AP39 in 1,12 ml PBS versetzt und für 1,5 Stunden bei 25°C inkubiert. Man entsalzt mit einer voräquilibrierten NAP5-Säule bei einer Beladung mit 450 μl AP39r und 50 μl PBS. Nach Elution mit 1 ml PBS isoliert man das reduzierte Antikörperfragment AP39r in einer Konzentration von 0,7 mg/ml.
  • Beispiel ELE1
  • (1S,3S,7S(3RS),10R,11S,12S,16R)-[3-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-propyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxa-bicyclo(14.1.0]heptadec-7-yl ester
  • Zu 400 μl der nach Beispiel ELE1 a dargestellten Lösung des reduzierten Antikörperfragmentes gibt man 22,5 μl einer 1,38 mM Lösung des nach Beispiel EL2 dargestellten Effektor-Linker-Konjugates A in DMSO, versetzt mit 77,5 μl PBS und inkubiert bei 25°C für 1 Stunde. Man entsalzt mit einer voräquilibrierten NAP5-Säule bei einer Beladung mit 500 μl der Reaktionslösung. Nach Elution mit PBS isoliert man die Lösung der Titelverbindung. Der Verdünnungsfaktor bezogen auf das Antikörperfragment beträgt ca. 2,5.
  • Beispiel ELE2
  • (1S,3S,7S(3RS),10R,11S,12S,16R)-[5-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-pentyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester
  • In Analogie zu Beispiel ELE1 setzt man das nach Beispiel ELE1a reduzierte Antikörperfragment mit dem nach Beispiel EL4 dargestellten Effektor-Linker-Konjugat A um und isoliert die Lösung der Titelverbindung. Der Verdünnungsfaktor bezogen auf das Antikörperfragment beträgt ca. 2,5.
  • Beispiel ELE3
  • (1S,3S,7S(3RS),10R,11S,12S,16R)-[10-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-decyl]-carbaminsäure-10-allyl-11-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-7-yl ester
  • In Analogie zu Beispiel ELE1 setzt man das nach Beispiel ELE1a reduzierte Antikörperfragment mit dem nach Beispiel EL6 dargestellten Effektor-Linker-Konjugat A um und isoliert die Lösung der Titelverbindung. Der Verdünnungsfaktor bezogen auf das Antikörperfragment beträgt ca. 2,5.
  • Beispiel ELE4
  • (1S,3S,7S,10R,11S(3RS),12S,16R)-[3-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-propyl]-carbaminsäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-11-yl ester
  • In Analogie zu Beispiel ELE1 setzt das nach Beispiel ELE1a reduzierte Antikörperfragment mit dem nach Beispiel EL8 dargestellten Effektor-Linker-Konjugat A um und isoliert die Lösung der Titelverbindung. Der Verdünnungsfaktor bezogen auf das Antikörperfragment beträgt ca. 2,5.
  • Beispiel ELE5
  • (1S,3S,7S,10R,11S(3RS),12S,16R)-[5-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-pentyl]-carbaminsäure-10-allyl-7-hydroxy-8,8,12,16-tetramethyl-3-(2-methylbenzothiazol-5-yl)-5,9-dioxo-4,17-dioxabicyclo[14.1.0]heptadec-11-yl ester
  • In Analogie zu Beispiel ELE1 setzt das nach Beispiel ELE1a reduzierte Antikörperfragment mit dem nach Beispiel EL10 dargestellten Effektor-Linker-Konjugat A um und isoliert die Lösung der Titelverbindung. Der Verdünnungsfaktor bezogen auf das Antikörperfragment beträgt ca. 2,5.
  • Beispiel ELE6
  • (1S,3S(E),7S,10R,11 S,12S,16R)-[3-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-propyl]-carbaminsäure-7-[3-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-propylcarbamoyloxy]-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-1l-yl ester (A) und
  • (1S,3S(E),7S,10R,11S,12S,16R)-[3-(3-(AP39r)-sulfanyl-2,5-dioxo-pyrrolidin-1-yl)-propyl]-carbaminsäure-11-[3-(2,5-dioxo-2,5-dihydro-pyrrol-1-yl)-propylcarbamoyloxy]-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-5,9-dioxo-4,17-dioxa-bicyclo[14.1.0]heptadec-7-yl ester (B)
  • In Analogie zu Beispiel ELE1 setzt das nach Beispiel ELE1a reduzierte Antikörperfragment mit dem nach Beispiel EL11 dargestellten Effektor-Linker-Konjugat um und isoliert die Lösung der Titelverbindungen. Der Verdünnungsfaktor bezogen auf das Antikörperfragment beträgt ca. 2,5.

Claims (19)

  1. Effektor-Konjugat der allgemeinen Formel (I):
    Figure 00580001
    worin R1a, R1b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, oder gemeinsam eine -(CH2)m-Gruppe sind, worin m 2 bis 5 ist, R2a, R2b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, oder gemeinsam eine -(CH2)n-Gruppe sind, worin n 2 bis 5 ist, oder C2-C10 Alkenyl, oder C2-C10 Alkinyl, R3 Wasserstoff, C1-C10Alkyl, Aryl oder Aralkyl, und R4a, R4b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, oder gemeinsam eine -(CH2)p-Gruppe sind, worin p 2 bis 5 ist, R5 Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, CO2H, CO2Alkyl, CH2OH, CH2OAlkyl, CH2OAcyl, CN, CH2NH2, CH2N(Alkyl, Acyl)1,2, oder CH2Hal, Hal ein Halogen-Atom, R6, R7 jeweils Wasserstoff, oder gemeinsam eine zusätzliche Bindung, oder gemeinsam ein Sauerstoff-Atom, oder gemeinsam eine NH-Gruppe, oder gemeinsam eine N-Alkyl-Gruppe, oder gemeinsam eine CH2-Gruppe, und G ein Sauerstoffatom oder CH2 sind, D–E eine Gruppe H2C-CH2, HC=CH, C≡C, CH(OH)-CH(OH), CH(OH)-CH2, CH2 CH((OH), HC O / -CH, O-CH2, O-CH2 oder, falls G eine CH2-Gruppe darstellt, CH2-O ist, W eine Gruppe C(=X)R8, oder ein bi- oder tricyclischer aromatischer oder heteroaromatischer Rest ist, L3 Wasserstoff ist, oder, falls ein Rest in W eine Hydroxyl-Gruppe enthält, mit dieser eine Gruppe O-L4 bildet, oder, falls ein Rest in W eine Amino-Gruppe enthält, mit dieser eine Gruppe NR25-L4 bildet, R25 Wasserstoff oder C1-C10 Alkyl ist, X ein Sauerstoffatom, oder zwei OR20-Gruppen, oder eine C2-C10 Alkylendioxy-Gruppe, die geradkettig oder verzweigt sein darf, oder H/OR9, oder eine CR10R11-Gruppe, R8 Wasserstoff, C1-C10 Alkyl, Aryl, Aralkyl, Halogen oder CN, und R9 Wasserstoff oder eine Schutzgruppe PGX sind, R10, R11 jeweils unabhängig voneinander Wasserstoff, C1-C20 Alkyl, Aryl, Aralkyl sind, oder gemeinsam mit einem Methylenkohlenstoffatom einen 5- bis 7-gliedrigen carbocyclischen Ring bilden, Z Sauerstoff oder H/OR12, R12 Wasserstoff oder eine Schutzgruppe PGZ, A-Y eine Gruppe O-C(=O), O-CH2, CH2-C(=O), NR21-C(=O) oder NR21-SO2, R20 C1-C20 Alkyl, R21 ein Wasserstoffatom oder C1-C20 Alkyl, PGX, PGY, PGZ eine Schutzgruppe PG, und L1, L2, L4 unabhängig voneinander Wasserstoff, eine Gruppe C(=O)Cl, eine Gruppe C(=S)Cl, eine Gruppe PGY oder einen Linker der allgemeinen Formel (III) darstellen können; mit der Bedingung, dass mindestens ein Substituent L1, L2 oder L4 einen Linker der allgemeinen Formel (III) darstellt; der Linker der allgemeinen Formel (III) folgende Struktur hat,
    Figure 00610001
    worin T Sauerstoff oder Schwefel, U Sauerstoff, CHR22, CHR22-NR23-C(=O)-, O-C(=O)-CHR22-NR23-C(=O)-, O-C(=O)-CHR22-NR23-C(=S)-, CHR22-NR23-C(=S)- oder NR24a, o 0 bis 15, V eine Bindung, Aryl, eine Gruppe
    Figure 00610002
    oder eine Gruppe
    Figure 00610003
    s 0 bis 4, Q eine Bindung, O-C(=O)-NR24c, O-C(=S)-NR24c,
    Figure 00610004
    R22 Wasserstoff, C1-C10 Alkyl, Aryl oder Aralkyl R23 Wasserstoff oder C1-C10 Alkyl, R24a, R24b, R24c unabhängig voneinander Wasserstoff oder C1-C10 Alkyl, q 0 bis 15, FG1 C1-C10Alkyl-S3- oder
    Figure 00620001
    darstellen können; als einheitliches Isomer oder eine Mischung unterschiedlicher Isomere und/oder als ein pharmazeutisch akzeptables Salz hiervon.
  2. Effektor-Konjugat gemäß Anspruch 1, wobei: A-Y O-C(=O) oder NR21-C(=O), D-E eine H2C-CH2-Gruppe, G eine CH2-Gruppe, Z ein Sauerstoffatom, R1a, R1b jeweils C1-C10 Alkyl oder zusammen eine -(CH2)p-Gruppe mit p gleich 2 oder 3 oder 4, R2a, R2b unabhängig voneinander Wasserstoff, C1-C10 Alkyl, C2-C10 Alkenyl, oder C2-C10 Alkinyl, R3 Wasserstoff; R4a, R4b unabhängig voneinander Wasserstoff oder C1-C10 Alkyl; R5 Wasserstoff, oder C1-C4 Alkyl oder CH2OH oder CH2NH2 oder CH2N(Alkyl, Acyl)1,2 oder CH2Hal, R6 und R7 gemeinsam eine zusätzliche Bindung oder gemeinsam eine NH-Gruppe oder gemeinsam eine N-Alkyl-Gruppe oder gemeinsam eine CH2-Gruppe, oder gemeinsam ein Sauerstoffatom, W eine Gruppe C(=X)R8 oder ein 2-Methylbenzothiazol-5-yl-Radikal oder ein 2-Methylbenzoxazol-5-yl-Radikal oder ein Chinolin-7-yl-Radikal oder ein 2-Aminomethylbenzothiazol-5-yl-Radikal oder ein 2-Hydroxymethylbenzothiazol-5-yl-Radikal oder ein 2-Aminomethyl-benzoxazol-5-yl-Radikal oder ein 2-Hydroxymethylbenzoxazol-5-yl-Radikal, X eine CR10R11-Gruppe R8 Wasserstoff oder C1-C4 Alkyl oder ein Fluoratom oder ein Chloratom oder ein Bromatom, R10/R11 Wasserstoff/2-Methylthiazol-4-yl oder Wasserstoff/2-Pyridyl oder Wasserstoff/2-Methyloxazol-4-yl oder Wasserstoff/2-Aminomethylthiazol-4-yl oder Wasserstoff/2-Aminomethyloxazol-4-yl oder Wasserstoff/2-Hydroxymethylthiazol-4-yl oder Wasserstoff/2-Hydroxymethyloxazol-4-yl darstellen.
  3. Effektor-Konjugat gemäß Anspruch 1 oder 2, wobei der Effektor-Grundkörper ausgewählt ist aus der Gruppe bestehend aus: (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-methylvinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-1-methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-methyl-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-methyl-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-methylvinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-methyl-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-1-methyl-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-methyl-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-fluor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluorvinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-1-fluor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluorvinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-chlor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlorvinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-1-chlor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlorvinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-fluor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluorvinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-fluor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-1-fluor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-fluorvinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-1-chlor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlorvinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8;12,16-tetramethyl-3-[1-chlor-2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-1-chlor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-1-chlorvinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-methyl-2-(2-pyridyl)-vinyl]-oxacyclohexadec-l3-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-methyl-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-fluor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-fluor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-chlor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-chlor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-fluor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-fluor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-l6-[1-chlor-2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(1-chlor-2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-methyl-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-methylvinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyloxazol-4-yl)-1-methyl-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11 S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-methyl-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-methyl-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-methylvinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-methyl-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-(2-hydroxymethyloxazol-4-yl)-1-methyl-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxabicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-methyl-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-fluor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluorvinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-(2-hydroxymethyloxazol-4-yl)-1-fluor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluorvinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-chlor-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlorvinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyloxazol-4-yl)-1-chlor-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlorvinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-fluor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluorvinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-fluor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyloxazol-4-yl)-1-fluor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-fluorvinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-oxazol-4-yl)-1-chlor-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(Z))-16-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlorvinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[1-chlor-2-(2-methyl-oxazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethyloxazol-4-yl)-1-chlor-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(Z),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-oxazol-4-yl)-1-chlorvinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8;10,12,16-pentamethyl-3-[2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-vinyl]-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[2-(2-methyl-thiazol-4-yl)-vinyl]-oxacyclohexadec-l3-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-16-[2-(2-hydroxymethyl-thiazol-4-yl)-vinyl]-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S(E))-16-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[2-(2-methyl-thiazol-4-yl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-[2-(2-hydroxymethylthiazol-4-yl)-vinyl]-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S(E),7S,10R,11S,12S,16R)-3-[2-(2-Aminomethyl-thiazol-4-yl)-vinyl]-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-[2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-[2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S(E))-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-[2-(2-pyridyl)-vinyl]-oxacyclohexadec-13-en-2,6-dion; (1S,3S(E),7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-[2-(2-pyridyl)-vinyl]-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S, 3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-propyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-l3-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-butyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-butyl-8,8;12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-allyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzothiazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzothiazol-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzothiazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzothiazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzothiazol-5-yl)-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,12S,16R)-3-(2-Aminomethyl-benzothiazol-5-yl)-7,11-dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-5,5,7,9,13-pentamethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-5,5,7,9,13-pentamethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-8,8,10,12,16-pentamethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-8, 8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-8,8,10,12,16-pentamethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-ethyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-ethyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-ethyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-ethyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-propyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-propyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-propyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-propyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-butyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-butyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-butyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxabicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-butyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-allyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-allyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-allyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-allyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-prop-2-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-prop-2-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-l3-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-enyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1 S,3S,7S,10R,11 S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-but-3-enyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo(14.1.0]heptadecan-5,9-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-16-(2-methyl-benzoxazol-5-yl)-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-4,8-Dihydroxy-16-(2-hydroxymethyl-benzoxazol-5-yl)-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (4S,7R,8S,9S,13Z,16S)-16-(2-Aminomethyl-benzoxazol-5-yl)-4,8-dihydroxy-7-but-3-inyl-5,5,9,13-tetramethyl-oxacyclohexadec-13-en-2,6-dion; (1S,3S,7S,10R,11S,12S,16R)-7,11-Dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-3-(2-methyl-benzoxazol-5-yl)-4,17-dioxabicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11 ,12S,16R)-7,11-Dihydroxy-3-(2-hydroxymethylbenzoxazol-5-yl)-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion; (1S,3S,7S,10R,11 S,12S,16R)-3-(2-Aminomethyl-benzoxazol-5-yl)-7,11-dihydroxy-10-but-3-inyl-8,8,12,16-tetramethyl-4,17-dioxa-bicyclo[14.1.0]heptadecan-5,9-dion, wobei an den in Formel (1) angegebenen Positionen die Wasserstoffatome in den vorstehend genannten Effektor-Grundkörpern durch Reste L1-L3 ersetzt sind.
  4. Effektor-Konjugat gemäß einem der Ansprüche 1-3, wobei der Linker ausgewählt ist aus der Gruppe bestehend aus Verbindungen der allgemeinen Formel (III), wobei V eine Bindung oder einen Arylrest darstellt, o Null ist, und T ein Sauerstoffatom ist.
  5. Effektor-Erkennungseinheit-Konjugat der allgemeinen Formel (1),
    Figure 00800001
    wobei die Substituenten darin die in Anspruch 1 genannten Bedeutungen haben, jedoch mindestens eine Gruppe FG1 durch eine Gruppe FG2 ersetzt ist, wobei FG2 die folgenden Bedeutungen haben kann:
    Figure 00800002
    wobei eine Erkennungseinheit über ein Schwefelatom mit der Gruppe FG2 konjugiert ist; wobei die Erkennungseinheit ausgewählt ist aus der Gruppe bestehend aus Peptiden, löslichen Rezeptoren, Cytokinen, Lymphokinen, Aptameren, Spiegelmeren, rekombinanten Proteinen, neuen Framework-Strukturen, monoklonalen Antikörpern, und Fragmenten monoklonaler Antikörper; als einheitliches Isomer oder eine Mischung unterschiedlicher Isomere und/oder als ein pharmazeutisch akzeptables Salz hiervon.
  6. Effektor-Erkennungseinheit-Konjugat gemäß Anspruch 5, wobei das Konjugat mehr als eine Erkennungseinheit enthält, und wobei die Erkennungseinheiten identisch sind.
  7. Effektor-Erkennungseinheit-Konjugat gemäß Anspruch 5 oder 6, wobei die Erkennungseinheit ein Antikörper ist, oder ein antigen-bindendes Fragment desselben, welcher für ein Antuigen spezifisch ist, das ausgewählt ist aus der Gruppe bestehend aus den in Tabelle 1 aufgeführten Antigenen, sowie CD19, CD20, CD40, CD22, CD25, CDS, CD52, CD10, CD2, CD7, CD33, CD38, CD40, CD72, CD4, CD21, CD37, CD30, VCAM, CD31, ELAM, Endoglin, VEGFRI/II, αvβ3, Tie1/2, TES23 (CD44ex6), Phosphatidylserin, PSMA, VEGFR/VEGF-Komplex und ED-B-Fibronectin.
  8. Linker der allgemeinen Formel (III1:
    Figure 00810001
    worin RG1 eine O=C=N-Gruppe oder eine S=C=N-Gruppe ist, und o, V, q und FG1 die in Anspruch 1 genannten Bedeutungen haben; oder Linker der allgemeinen Formel (III2):
    Figure 00820001
    worin RG2 eine Hal-C(=T)-CHR22-Gruppe oder eine Hal-C(=T)-CHR22-NR23-C(=T)-Gruppe oder eine R26-C(=O)-O-C(=T)-CHR22-Gruppe oder eine R26-C(=O)-O-C(=T)-CHR22-NR23-C(=T)-Gruppe ist, wobei R26 C1-C10 Alkyl, Aryl, Aralkyl ist, und o, V, q und FG1 die in Anspruch 1 genannten Bedeutungen haben; oder Linker der allgemeinen Formel (III3):
    Figure 00820002
    worin RG3 eine OH-Gruppe oder eine NHR24a-Gruppe oder eine COOH-Gruppe ist, und o, V, q und FG1 die in Anspruch 1 genannten Bedeutungen haben; jedoch mit der Bedingung, dass die Verbindung 1-(4-Amino-phenyl)-pyrrol-2,5-dion nicht umfasst ist.
  9. Linker gemäß Anspruch 8, wobei V eine Bindung oder einen Arylrest darstellt, o gleich Null ist und T ein Sauerstoffatom ist.
  10. Verfahren zur Herstellung von Effektor-Konjugaten gemäß einem der Ansprüche 1–4, wobei eine Verbindung der allgemeinen Formel (I), wobei die Substituenten die in Anspruch 1 genannten Bedeutungen haben, jedoch die Bedingung, das mindestens ein Substituent L1, L2 oder L4 einen Linker der allgemeinen Formel (III) darstellt, nicht erfüllt sein muß, und mindestens ein Substituent L1, L2 oder L4 Wasserstoff, eine Gruppe C(=O)Cl, oder eine Gruppe C(=S)Cl darstellt; mit einem Linker, der ausgewählt ist aus der Gruppe bestehend aus einem Linker der allgemeinen Formel (III1) oder (III2) oder (III3), wie in Anspruch 8 beschrieben, umgesetzt wird.
  11. Verfahren zur Herstellung von Effektor-Erkennungseinheit-Konjugaten gemäß einem der Ansprüche 5 bis 7, wobei ein Effektor-Konjugat gemäß einem der Ansprüche 1–4 mit mindestens einer Erkennungseinheit, wie in Anspruch 5 und 7 definiert, umgesetzt wird.
  12. Verwendung einer Verbindung der allgemeinen Formel (I), wobei die Substituenten die in Anspruch 1 genannten Bedeutungen haben, jedoch die Bedingung, dass mindestens ein Substituent L1, L2 oder L4 einen Linker der allgemeinen Formel (III) darstellt, nicht erfüllt sein muß, und mindestens ein Substituent L1, L2 oder L4 Wasserstoff, eine Gruppe C(=O)Cl, oder eine Gruppe C(=S)Cl darstellt; in einem Verfahren gemäß Anspruch 10.
  13. Verwendung einer Verbindung der allgemeinen Formel (I) zur Herstellung eines Effektor-Erkennungseinheit-Konjugats gemäß den Ansprüchen 5 bis 7.
  14. Verwendung eines Linkers der allgemeinen Formel (III1), (III2) oder (III3) in einem Verfahren gemäß Anspruch 10.
  15. Verwendung eines Linkers der allgemeinen Formel (III1), (III2) oder (III3) zur Herstellung eines Effektor-Erkennungseinheit-Konjugats gemäß einem der Ansprüche 5 bis 7.
  16. Verwendung einer Erkennungseinheit, wie in Anspruch 5 oder 7 definiert, in einem Verfahren gemäß Anspruch 11.
  17. Effektor-Erkennungseinheit-Konjugat gemäß einem der Ansprüche 5 bis 7 zur Verwendung als Medikament.
  18. Effektor-Erkennungseinheit-Konjugat gemäß einem der Ansprüche 5 bis 7 zur Verwendung als Medikament zur Behandlung von Erkrankungen, die mit proliferativen Prozessen assoziiert sind.
  19. Effektor-Erkennungseinheit-Konjugat gemäß einem der Ansprüche 5 bis 7 zur Verwendung als Medikament zur Behandlung einer Krankheit, die ausgewählt ist aus der Gruppe bestehend aus Tumoren, entzündlichen Erkrankungen, neurodegenerativen Erkrankungen, Angiogenese-assoziierten Erkrankungen, Multipler Sklerose, Alzheimer, und rheumatoider Arthritis.
DE10234975A 2002-07-31 2002-07-31 Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung Withdrawn DE10234975A1 (de)

Priority Applications (28)

Application Number Priority Date Filing Date Title
DE10234975A DE10234975A1 (de) 2002-07-31 2002-07-31 Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung
ARP030102734A AR040956A1 (es) 2002-07-31 2003-07-30 Nuevos conjugados de efectores, procedimientos para su preparacion y su uso farmaceutico
CNA038181118A CN1812785A (zh) 2002-07-31 2003-07-31 新的效应物缀合物、其制备方法及药物用途
PCT/EP2003/008483 WO2004012735A2 (en) 2002-07-31 2003-07-31 New effector conjugates, process for their production and their pharmaceutical use
EP03743752A EP1524979A2 (de) 2002-07-31 2003-07-31 Neue effektor-konjugate, verfahren zu ihrer herstellung und ihre pharmazeutische verwendung
JP2005506073A JP2006505627A (ja) 2002-07-31 2003-07-31 新規エフェクター接合体、それらの生成方法及びそれらの医薬使用
PE2003000756A PE20040747A1 (es) 2002-07-31 2003-07-31 Nuevos conjugados de efectores y procedimientos para su preparacion
BR0313043-6A BR0313043A (pt) 2002-07-31 2003-07-31 Conjugados efetores, processo para sua produção e seu uso farmacêutico
PL03374528A PL374528A1 (en) 2002-07-31 2003-07-31 New effector conjugates, process for their production and their pharmaceutical use
IL16603903A IL166039A0 (en) 2002-07-31 2003-07-31 New effector conjugates process for their production and their pharmaceutical use
TW092121014A TW200404065A (en) 2002-07-31 2003-07-31 New effector conjugates, process for their production and their pharmaceutical use
CA002492437A CA2492437A1 (en) 2002-07-31 2003-07-31 New effector conjugates, process for their production and their pharmaceutical use
US10/631,011 US7129254B2 (en) 2002-07-31 2003-07-31 Effector conjugates, process for their production and their pharmaceutical use
EA200500223A EA200500223A1 (ru) 2002-07-31 2003-07-31 Новые конъюгаты - эффекторы, способ их получения и их фармацевтическое применение
UY27915A UY27915A1 (es) 2002-07-31 2003-07-31 Nuevos conjugados de efectores, procedimientos para su preparación y su uso farmacéutico.
NZ537870A NZ537870A (en) 2002-07-31 2003-07-31 New effector conjugates, process for their production and their pharmaceutical use
KR1020057001569A KR20050026033A (ko) 2002-07-31 2003-07-31 신규 효과기 접합체, 그의 제조 방법 및 그의 약학적 용도
AU2003253365A AU2003253365A1 (en) 2002-07-31 2003-07-31 New effector conjugates, process for their production and their pharmaceutical use
YUP-2005/0082A RS20050082A (en) 2002-07-31 2003-07-31 New efector conjugates,process for their production and their pharmaceutical use
MXPA05001282A MXPA05001282A (es) 2002-07-31 2003-07-31 Conjugados efectores nuevos, procedimiento para su produccion y su uso farmaceutico.
IS7708A IS7708A (is) 2002-07-31 2005-02-23 Tenglar fyrir stýrisameindir, efnasmíði þeirra oglyfjafræðileg notkun
ZA200501648A ZA200501648B (en) 2002-07-31 2005-02-24 New effector conjugates, process for their production and their pharmaceutical use
EC2005005626A ECSP055626A (es) 2002-07-31 2005-02-24 Nuevos conjugados de efectores, procedimientos para su preparación y su uso farmacéutico
CO05017568A CO5700741A2 (es) 2002-07-31 2005-02-24 Nuevos conjugados de efectores, procedimientos para su prepa racion y su uso farmaceutico
NO20051038A NO20051038L (no) 2002-07-31 2005-02-25 Nye effektorkonjugater, fremgangsmate for deres fremstilling, og deres farmasoytiske bruk
HR20050186A HRP20050186A2 (en) 2002-07-31 2005-02-25 New effector conjugates, process for their production and their pharmaceutical use
US11/509,557 US7335775B2 (en) 2002-07-31 2006-08-25 Effector conjugates, process for their production and their pharmaceutical use
US12/000,258 US20080166362A1 (en) 2002-07-31 2007-12-11 New effector conjugates, process for their production and their pharmaceutical use

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
DE10234975A DE10234975A1 (de) 2002-07-31 2002-07-31 Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung

Publications (1)

Publication Number Publication Date
DE10234975A1 true DE10234975A1 (de) 2004-02-12

Family

ID=30128566

Family Applications (1)

Application Number Title Priority Date Filing Date
DE10234975A Withdrawn DE10234975A1 (de) 2002-07-31 2002-07-31 Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung

Country Status (3)

Country Link
CN (1) CN1812785A (de)
DE (1) DE10234975A1 (de)
ZA (1) ZA200501648B (de)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005074901A2 (en) * 2004-01-30 2005-08-18 Schering Ag New effector conjugates, process for their production and their pharmaceutical use

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005074901A2 (en) * 2004-01-30 2005-08-18 Schering Ag New effector conjugates, process for their production and their pharmaceutical use
WO2005074901A3 (en) * 2004-01-30 2006-03-30 Schering Ag New effector conjugates, process for their production and their pharmaceutical use

Also Published As

Publication number Publication date
CN1812785A (zh) 2006-08-02
ZA200501648B (en) 2006-05-31

Similar Documents

Publication Publication Date Title
DE602005003453T2 (de) Neue effektor-konjugate, verfahren zu ihrer herstellung und ihre pharmazeutische verwendung
US7335775B2 (en) Effector conjugates, process for their production and their pharmaceutical use
AU2018267660B2 (en) Compounds and methods for the treatment of TROP2 positive diseases
DE69028678T2 (de) Maytansinoid enthaltende cytotoxische Mittel und ihre therapeutische Anwendung
HRP20050186A2 (en) New effector conjugates, process for their production and their pharmaceutical use
DE69925133T2 (de) Pyrrolobenzodiazepine
KR100208957B1 (ko) 신규한 cc-1065 유사체
US5208020A (en) Cytotoxic agents comprising maytansinoids and their therapeutic use
US20140178411A1 (en) Compounds and methods for the treatment of cd20 positive diseases
JP2024520283A (ja) 化学的カップリングリンカー及びその使用
KR20230137295A (ko) 접합체 및 이의 용도
DE10234975A1 (de) Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung
DE102004004787A1 (de) Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung
DE10305098A1 (de) Neue Effektor-Konjugate, Verfahren zu ihrer Herstellung und ihre pharmazeutische Verwendung
DE10256982A1 (de) Neue Effektor-Konjugate, Verfahren zu Ihrer Herstellung und Ihre Pharmazeutische Verwendung
CA3175426A1 (en) Drug antibody conjugates
DE10331004A1 (de) Verfahren für die Herstellung von C1-C15-Fragmenten von Epothilonen und deren Derivaten

Legal Events

Date Code Title Description
8127 New person/name/address of the applicant

Owner name: BAYER SCHERING PHARMA AG, 13353 BERLIN, DE

8127 New person/name/address of the applicant

Owner name: BAYER SCHERING PHARMA AKIENGESELLSCHAFT, 13353, DE

8141 Disposal/no request for examination