CN1883704A - Hepatitis A-hepatitis E combined vaccine and preparation method thereof - Google Patents
Hepatitis A-hepatitis E combined vaccine and preparation method thereof Download PDFInfo
- Publication number
- CN1883704A CN1883704A CNA2005100407339A CN200510040733A CN1883704A CN 1883704 A CN1883704 A CN 1883704A CN A2005100407339 A CNA2005100407339 A CN A2005100407339A CN 200510040733 A CN200510040733 A CN 200510040733A CN 1883704 A CN1883704 A CN 1883704A
- Authority
- CN
- China
- Prior art keywords
- hepatitis
- vaccine
- group
- virus
- hav
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Disclosed are a combined vaccine for hepatitis A and hepatitis E, and preparation method thereof. Said vaccine comprises hepatitis E virus recombined peoteins, hepatitis A attenuated live vaccine and hepatitis A inactivated vaccine. Said method comprises before the paretion of the final combined vaccine, absorbing hepatitis A attenuated live vaccine viruses and/or hepatitis A inactivated vaccine viruses on aluminum hydroxide gel, absorbing hepatitis E virus recombined peoteins on aluminum hydroxide gel, adjusting the pH value of the two compositons, and mixing the two compositons together. The inventiion is provided with convenience, multiple-effect, low cost, and effective prevention of hepatitis A and hepatitis E for human and animals.
Description
Technical field
The present invention relates to a kind of combined vaccine and preparation method thereof, particularly relate to hepatitis A-hepatitis E combined vaccine and preparation method thereof.
Background technology
Along with China's rapid economy development, flow of personnel increases day by day in recent years, and the generation of multiple infectious disease is also frequent day by day, the serious threat public's health, and caused huge financial burden to country.Therefore in order effectively to control the popular of infectious disease, the research and development preventative vaccine has important significance for theories and realistic meaning.
Hepatitis A (hepatitis A) and hepatitis E (hepatitis E) are the acute viral hepatitis of propagating through fecal oral route, and the morbidity form of hepatitis A that China is common and hepatitis E has popular and distributes two kinds.Went up the edible Scapharca subcrenata of glycolylurea in 1988 and cause that hepatitis A is acute to be very popular, occur 30 surplus ten thousand routine hepatitis A cases; Hepatitis E takes place in 1986-1988 Xinjiang is very popular, and the people is infected surplus in the of 120,000, is that a hepatitis E burst of maximum in the world is popular.Show that according to China's statistical report in 2004 in the sickness rate of various hepatitis, the hepatitis E sickness rate is on the rise, the hepatitis A sickness rate is kept the level in former years substantially.
Hepatitis A vaccine has gone on the market for many years, and the hepatitis E vaccine is then still in development.Hepatitis A vaccine has two kinds of inactivated vaccine and attenuated live vaccines, and the former safety is good, and latter's production cost is lower.Developed country mainly uses inactivated vaccine, and China is based on attenuated live vaccine, and both production technologies are very ripe.And therefore hepatitis E virus is difficult to develop inactivated vaccine or attenuated live vaccine at present because cell culture is very difficult, and domestic and international research mostly concentrates on by gene recombination technology and develops genetic engineering subunit vaccine.
Contain two or more antigen, can prevent the research of the combined vaccine of two or more disease to receive numerous scholars' concerns always, and become the focus of vaccine research of new generation with its convenience, multiple-effect, low cost.Compare with single vaccine, combined vaccine can reduce the inoculation times of vaccine, avoids can not obtaining omnidistance immunity because of leaking to plant; In addition, vaccine is scarcely heat-resisting, and its production, transportation, storage, sale and even whole use all need be carried out at a lower temperature, and promptly so-called " cold chain ", this cold chain all linked with one another running, expense is high, makes the vaccine cost high.And the use combined vaccine then can reduce the expense of cold chain running greatly, so has significant superiority.Pertussis-diph/tet triple vaccine has used the example that is a success for many years in planned immunization.Some new combined vaccines such as hepatitis A and hepatitis B combined vaccine also patent (European patent 0339667) in recent years.But with the combined vaccine as the hepatitis A and the hepatitis E of intestinal transmitted hepatitis, its development does not up to now at home and abroad appear in the newspapers as yet.
Summary of the invention
The invention provides a kind of convenience, multiple-effect, low cost, also can effectively prevent hepatitis A-hepatitis E combined vaccine of people and animal hepatitis A and hepatitis E and preparation method thereof.
The present invention adopts following technical scheme:
A kind of hepatitis A-hepatitis E combined vaccine comprises hepatitis E virus recombiant protein and attenuated hepatitis A live vaccine or hepatitis A inactivated vaccine.Said attenuated hepatitis A live vaccine, its virus titer are 5-10LogCCID
50/ ml, or hepatitis A inactivated vaccine, its virus antigen content is 250-1000U/ml, the content of hepatitis E virus recombiant protein is 5-50ug/ml.
A kind of method that is used to prepare above-mentioned hepatitis A-hepatitis E combined vaccine:
(a) before preparing final hepatitis A-hepatitis E combined vaccine, attenuated hepatitis A live vaccine virus and/or hepatitis A inactivated vaccine virus are adsorbed in gel aluminum hydroxide, the hepatitis E virus recombiant protein is adsorbed in gel aluminum hydroxide, adjusts pH to 5.5-9.6;
(b) the above-mentioned component that will adjust pH mixes.
Compared with prior art, the present invention has following advantage:
Combined vaccine of the present invention can effectively be used to prevent hepatitis A and the hepatitis E of people and animal.Zoopery shows, attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine can obviously increase the immunogenicity of hepatitis E virus recombiant protein, the hepatitis E virus recombiant protein (≤40ug/ml) with the immune effect of the hepatitis A-hepatitis E combined vaccine of attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine preparation be better than high dose the hepatitis E virus recombiant protein (＞40ug/ml) with the immune effect of the hepatitis A-hepatitis E combined vaccine of attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine preparation.Therefore combined vaccine provided by the invention has the same even better immunogenicity of univalent vaccine.
Contain two or more antigen, can prevent the combined vaccine of two or more disease to become the focus of vaccine research of new generation with its convenience, multiple-effect, low cost.Compare with single vaccine, combined vaccine can reduce the inoculation times of vaccine, avoids can not obtaining omnidistance immunity because of leaking to plant; In addition, vaccine is scarcely heat-resisting, and its production, transportation, storage, sale and even whole use all need be carried out at a lower temperature, and promptly so-called " cold chain ", this cold chain all linked with one another running, expense is high, makes the vaccine cost high.And the use combined vaccine then can reduce the expense of cold chain running greatly, so has significant superiority.
Owing to used in the combined vaccine of the present invention and fully proved to have good safety and immunogenic attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine, so can reduce the production cost and the market price of combined vaccine greatly.
The present invention also provides the storage practice of combined vaccine, comprises gelatin is added hepatitis A-hepatitis E combined vaccine, or uses the storage bottle of the vial of silicon coating as combined vaccine.The concentration range of preferred gelatin is 0.5-0.7w/v%.
In the hepatitis A-hepatitis E combined vaccine of the present invention, the gel aluminum hydroxide of use can buy or adopt known method to be prepared.This adjuvant is well known to those skilled in the art, and is easy to obtain and preparation.
The preferred embodiment of combined vaccine according to the present invention, the virus titer of contained attenuated hepatitis A live vaccine is 5-10LogCCID in the combined vaccine
50The virus antigen content of/ml and/or hepatitis A inactivated vaccine is 250-1000U/ml, and the content of hepatitis E virus recombiant protein is 5-50ug/ml, and gel aluminum hydroxide concentration is 0.6-1.5mg/ml.
Zoopery shows, the hepatitis A-hepatitis E combined vaccine of the preferred embodiment of combined vaccine preparation can be induced high titre, the specific antibody of body generation at hepatitis A virus and hepatitis E virus according to the present invention, and experiment in vitro confirms, this combined vaccine inductive antibody have clear and definite neutralization.Particularly, attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine can obviously increase the immunogenicity of hepatitis E virus recombiant protein, the hepatitis E virus recombiant protein (≤40ug/ml) with the immune effect of the hepatitis A-hepatitis E combined vaccine of attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine preparation be better than high dose the hepatitis E virus recombiant protein (＞40ug/ml) with the immune effect of the hepatitis A-hepatitis E combined vaccine of attenuated hepatitis A live vaccine and/or hepatitis A inactivated vaccine preparation.Therefore combined vaccine provided by the invention has the same even better immunogenicity of univalent vaccine.
A large amount of in the past studies confirm that, the aminoacid that is arranged in hepatitis E virus open reading frame 2 c-terminuses 2/3 end contains the specific and epitope of hepatitis E virus.On the basis of this research, the present invention finds in hepatitis E virus the 4th genotype strain open reading frame 2 that the 474-619 amino acids of coding is to contain in the hepatitis E virus and the minimal segment of epitope, and then also the optimization protein fragment of discovery coding 453-631 amino acids can obtain to efficiently express in escherichia coli, can induce body to produce the specificity neutralizing antibody.
The specific embodiment
Hepatitis A-hepatitis E combined vaccine is represented with HAV-HEV or HAV-HEV combined vaccine among the embodiment.
Embodiment 1
A kind of HAV-HEV combined vaccine comprises hepatitis E virus recombiant protein and attenuated hepatitis A live vaccine or hepatitis A inactivated vaccine, and said attenuated hepatitis A live vaccine, its virus titer are 5-10LogCCID
50/ ml, or hepatitis A inactivated vaccine, its virus antigen content is 250-1000U/ml, the content of hepatitis E virus recombiant protein is 5-50ug/ml.
Present embodiment also comprises immunological adjuvant, and this immunological adjuvant is a gel aluminum hydroxide solution, and the concentration range of gel aluminum hydroxide is adjusted into 0.6-1.5mg/ml,
Above-mentioned attenuated hepatitis A live vaccine is attenuated hepatitis A live vaccine L-A-1, H2 vaccine strain or other available vaccine strains; Hepatitis A inactivated vaccine is hepatitis A virus HM175 strain or other available vaccine strains; The amino terminal of HEV recombinant protein 380 of HEV open reading frame 2 coding between 480 amino acids; Its carboxyl terminal is at 580 derivatives that produce to amino acid between 650 amino acids or thus, and its described sequence is: RGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQQ DKGIAIPHDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTA AEYDQTTYGSSTNPMYVSDTVTFVNVATGAQGVSRSLDWSKVTLDGRPLMTIQQYS KTFFVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQILIENAAGHRVCISTYTTNLG SGPVSISAVGVLAPHSALAALEDTVDYPARAHTFDDFCPECRALGLQ
Preferentially select the 453rd for use to 631 amino acids sequences (p179).Its described sequence is as follows: VIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNPMYV SDTVTFVNVATGAQGVSRSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVCISTYTTNLGSGPVSISAVGVLAPHSA LAVLEDTVDYP
HAV-HEV combined vaccine of the present invention also contains the gelatin of 0.5-0.7w/v% consumption.
Embodiment 2
A kind of method that is used to prepare above-mentioned HAV-HEV combined vaccine:
(a) before preparing final HAV-HEV combined vaccine, attenuated hepatitis A live vaccine virus and/or hepatitis A inactivated vaccine virus are adsorbed in gel aluminum hydroxide, the hepatitis E virus recombiant protein is adsorbed in gel aluminum hydroxide, adjusts pH to 5.5-9.6;
(b) the above-mentioned component that will adjust pH mixes.
Further illustrate below.
Embodiment 3: the preparation of attenuated hepatitis A live vaccine virus stock solution used
Cultivate human diploid fibroblasts MRC5 with the minimal medium (MEM) (pH 7.2-7.6) that contains 10% calf serum, cell discards grown cultures liquid after forming fine and close monolayer, and, inoculate previously prepared hepatitis A virus seed liquor with behind Hanks ' the liquid cyclic washing cell.34-36 ℃ of absorption was added the cell growth and is kept liquid, and in 34-36 ℃ of 4 weeks of cultivation, change liquid 1-2 time weekly after 2 hour in culture.Discard after the cultivation and keep liquid and residual calf serum, directly add to contain 3mM NaCl but do not contain 199 phenol red comprehensive culture fluid 34-36 ℃ of continuation and cultivated 3-4 days.Collecting cell then, through centrifugal behind multigelation and the cell breakage, the supernatant of collection is the attenuated hepatitis A live vaccine virus stock solution used.
Embodiment 4: the preparation of hepatitis A inactivated vaccine virus stock solution
According to the vaccine production requirement, adopt human diploid fibroblasts MRC5 to carry out the cell culture of Hepatitis A Vaccine strain HM175, use the formalin deactivation behind the viral purification with the cultivation gained, concrete preparation method and technology path are as follows:
(1) cultivate human diploid fibroblasts MRC5, treat that cell grows up to monolayer after, use Hanks ' liquid thorough washing cell monolayer, remove residual calf serum, inoculation Hepatitis A Vaccine strain HM175,37 ℃ adsorbed 2 hours, discard inoculum, washing again adds the culture fluid that does not contain calf serum then, 37 ℃ of cultivations, centrifugal after the results when treating that cytopathy reaches " +++", freeze thawing 3 times, preparation HAV seed lot, with its infection titer of plaque test titration, cryopreservation after the packing;
(2) as mentioned above, cultivate Hepatitis A Vaccine strain HM175 in a large number, it is 1%NP40 that results backs adds final concentration, centrifugal after the freeze thawing 3 times, collects the freeze thawing supernatant;
(3) use the ultrafiltration concentrating virus, reuse glucosan column chromatography or density purified virus;
(4) purified virus is after purity is identified, with 1: 4000 formalin deactivation of final concentration, 37 ℃ act on 15 days;
(5) method that repeatedly goes down to posterity with cell culture detects the noresidue live virus is arranged, and simultaneously inactivation of viruses is carried out the mensuration of protein concentration and antigen titre.
Embodiment 5: hepatitis E virus Recombinant Protein Expression and purification
(1) be template with hepatitis E virus IV type Chinese strain gene order, with the genetic fragment of primer 1 (5 '-CCC CCCATG GTT ATC CAG GAC TAT GAT AAT C-3 ') and primer 2 (5 '-CCC CTC GAG TCAAGG GTA ATC AAC AGT GTC CTC CA-3 ') amplification ORF2 coded polypeptide 453-631 (p179).The PCR condition is: 94 ℃-45 seconds, 52 ℃-45 seconds, 72 ℃-50 seconds, 35 circulations.The PCR product reclaims purification through agarose gel, be cloned into plasmid vector pET28 (a)+in.
(2) expression plasmid is transformed among the expression strain E.coli BL-21 (DE3), picking list bacterium colony is with containing the LB culture medium culturing of 50ug/ml kanamycin to OD
550=0.6～0.8, with final concentration is that 0.2～1.0mMIPTG induces, and inducing temperature is 37 ℃, and shaking table shakes speed and is 200rpm, centrifugal collection thalline after 3-4 hour, with cell pyrolysis liquid (50mM Tris-HCl, pH 7.2,300mM NaCl) suspension bacterial sediment, ultrasonication thalline after the freeze thawing 6 times, centrifugal collection supernatant, methods such as reuse ion exchange, glucosan chromatography are carried out purification, use UV at last
280, method such as SDS-PAGE detects.
Embodiment 6: preparation attenuated hepatitis A live vaccine virus and hepatitis E recombiant protein gel aluminum hydroxide adsorbent solution
In order to increase immunogenicity, virus stock solution used and the hepatitis E virus recombiant protein with attenuated hepatitis A live vaccine is adsorbed in gel aluminum hydroxide respectively: (1) mixes the virus stock solution used and the gel aluminum hydroxide of attenuated hepatitis A live vaccine; (2) hepatitis E recombiant protein and gel aluminum hydroxide are mixed.Solution with (1) and (2) gained mixes again, and the virus titer of adjusting attenuated hepatitis A live vaccine is 6.5LogCCID
50/ ml, hepatitis E recombiant protein concentration is 20ug/ml, the concentration of gel aluminum hydroxide is 1.0mg/ml; The mixed solution of gained is attenuated hepatitis A live vaccine and hepatitis E virus recombiant protein gel aluminum hydroxide adsorbent solution.
Embodiment 7: preparation hepatitis A inactivated vaccine and hepatitis E virus recombiant protein gel aluminum hydroxide adsorbent solution
In order to increase immunogenicity, virus stock solution used and the hepatitis E recombiant protein with hepatitis A inactivated vaccine is adsorbed in gel aluminum hydroxide respectively: (1) mixes the virus stock solution used and the gel aluminum hydroxide of hepatitis A inactivated vaccine; (2) hepatitis E recombiant protein and gel aluminum hydroxide are mixed.Solution with (1) and (2) gained mixes again, and the virus antigen content of adjusting hepatitis A inactivated vaccine is 500U/ml, and hepatitis E recombiant protein concentration is 20ug/ml, and the concentration of gel aluminum hydroxide is 1.0mg/ml; The mixed solution of gained is hepatitis A inactivated vaccine and hepatitis E virus recombiant protein gel aluminum hydroxide adsorbent solution.
Embodiment 8: the immunogenicity experiments of attenuation HAV-HEV combined vaccine
A: laboratory animal grouping and immunization protocol
Select 6-8 240 of the female BALB/C mouse inbred liness (Yangzhou University comparative medicine experimental center provides) in age in week for use, be divided into 24 groups at random, 10 every group.The A group: the blank group, injection gel aluminum hydroxide (concentration is 1.0mg/ml), 0.1ml/ are only; The B group: the Live Attenuated HAV group, (virus titer is 3.25LogCCID to the injection Live Attenuated HAV
50/ ml), 0.1ml/ is only; The C group: the Live Attenuated HAV group, (virus titer is 6.5LogCCID to the injection Live Attenuated HAV
50/ ml), 0.1ml/ is only; The D group: the Live Attenuated HAV group, (virus titer is 10LogCCID to the injection Live Attenuated HAV
50/ ml), 0.1ml/ is only; The E group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (5ug/ml), 0.1ml/ is only; The F group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (10ug/ml), 0.1ml/ is only; The G group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (20ug/ml), 0.1ml/ is only; The H group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (40ug/ml), 0.1ml/ is only; The I group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (80ug/ml), 0.1ml/ is only; The J group: attenuation HAV-HEV combined vaccine group, recombiant protein (5ug/ml)+(virus titer is 3.25LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The K group: attenuation HAV-HEV combined vaccine group, recombiant protein (10ug/ml)+(virus titer is 3.25LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The L group: attenuation HAV-HEV combined vaccine group, recombiant protein (20ug/ml)+(virus titer is 3.25LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The M group: attenuation HAV-HEV combined vaccine group, recombiant protein (40ug/ml)+(virus titer is 3.25LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The N group: attenuation HAV-HEV combined vaccine group, recombiant protein (80ug/ml)+(virus titer is 3.25LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The O group: attenuation HAV-HEY combined vaccine group, recombiant protein (5ug/ml)+(virus titer is 6.5LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The P group: attenuation HAV-HEV combined vaccine group, recombiant protein (10ug/ml)+(virus titer is 6.5LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The Q group: attenuation HAV-HEV combined vaccine group, recombiant protein (20ug/ml)+(virus titer is 6.5LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The R group: attenuation HAV-HEV combined vaccine group, recombiant protein (40ug/ml)+(virus titer is 6.5LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The S group: attenuation HAV-HEV combined vaccine group, recombiant protein (80ug/ml)+(virus titer is 6.5LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The T group: attenuation HAV-HEV combined vaccine group, recombiant protein (5ug/ml)+(virus titer is 10LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The U group: attenuation HAV-HEV combined vaccine group, recombiant protein (10ug/ml)+(virus titer is 10LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The V group: attenuation HAV-HEV combined vaccine group, recombiant protein (20ug/ml)+(virus titer is 10LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The W group: attenuation HAV-HEV combined vaccine group, recombiant protein (40ug/ml)+(virus titer is 10LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; The X group: attenuation HAV-HEV combined vaccine group, recombiant protein (80ug/ml)+(virus titer is 10LogCCID to Live Attenuated HAV to injection hepatitis E virus
50/ ml), 0.1ml/ is only; Each organizes laboratory animal respectively at the corresponding vaccine of 0,4,6 week injections three times, the corresponding vaccine of the subcutaneous multi-point injection 0.1ml in 0 all backs wherein, the corresponding vaccine of 4,6 all lumbar injection 0.05ml.
B: detection method:
B-1: the external neutralization experiment of hepatitis A antibody
Adopt in the quick plaque and laboratory method detection hepatitis A antibody.With the antiserum 100ul of dilution in 1: 1000 with contain 100TCID
50/ 100ul hepatitis A virus (HAV) suspension mixes, and establishes matched group simultaneously, and 37 ℃ of effects added 24 porocyte culture plates after 1 hour, and adds the FRHK4 cell suspension 0.4ml/ hole (about 4 * 10 that contains 10% calf serum
5Cell), mixing is put CO
2Incubator is hatched after 60-90 minute for 37 ℃ and is exhausted liquid, add and contain 10% calf serum alimentary gel (containing 1% agarose) 0.5ml/ hole, inversion was hatched 72 hours, add dimethyl diaminophenazine chloride gel 0.25ml/ hole again, continued to hatch 72 hours, the counting plaque, the antiserum that can reduce virus plaque number 90% at last is judged to positive serum.
B-2: the external neutralization experiment of hepatitis E antibody
Adopt in PCR-based external and experimental technique, with the antiserum 100ul of dilution in 1: 40 with contain 100TCID
50/ 100ul hepatitis E viral suspension mixes, the PLC/PRF/5 cell is inoculated in 37 ℃ of effects after 1 hour, cultivate after 2 hours for 37 ℃, Hank ' s liquid washed cell 3 times, use the Trizol method to extract nucleic acid, adopt primer 3 (5 '-CCG ACA GAA TTG ATT TCG TCG GC-3 '), primer 4 (5 '-GTT GTC TCG GCCAAT GGC GAG CC-3 '), primer 5 (5 '-TCG GCG GCG GTG AGA GAG AGC CA-3 '), primer 6 (5 '-CCG TAA GTG GAC TGG TCG TAC TC-3 ') carries out reverse transcription-nest-type PRC and detects hepatitis E virus nucleic acid, the nest-type PRC condition is: the first round: 94 ℃-45 seconds, 50 ℃-45 seconds, 72 ℃-50 seconds, 35 circulations, primer are primer 3 and primer 6; Second takes turns: 94 ℃-45 seconds, 52 ℃-45 seconds, 72 ℃-50 seconds, 30 circulations, primer is primer 4 and primer 5; The PCR feminine gender is judged to the neutralization test positive, and the antiserum of the virus that will neutralize at last is judged to positive serum.
C: result
C-1: as shown in Table 1, use the result of the Live Attenuated HAV immune mouse of various dose to show, the percent of generation positive serum mice raises with the raising of Live Attenuated HAV immunizing dose.
The Live Attenuated HAV of table one various dose induces the result of mouse anti HAV positive serum
| The A group | The B group | The C group | The D group | |
| Produce the percent of positive serum mice | 0 | 60 | 90 | 100 |
C-2: as shown in Table 2, use the result of the hepatitis E vaccine immune mouse of various dose to show, the percent that produces the positive serum mice raises with the raising of hepatitis E recombiant protein immunizing dose, and when hepatitis E recombiant protein immunizing dose 〉=20ug/ml, all mices all can produce positive serum.
The hepatitis E recombiant protein of table two various dose induces the result of mouse anti HEV positive serum
| The A group | The E group | The F group | The G group | The H group | The I group | |
| Produce the percent of positive serum mice | 0 | 80 | 80 | 100 | 100 | 100 |
C-3: as shown in Table 3, (virus titer is 3.25LogCCID to Live Attenuated HAV
50/ the result that ml) carries out the combined immunization mice with the hepatitis E recombiant protein of various dose shows, B, J, K, L, M group have 60% animal capable to induce the positive serum of anti-HAV, and the N group has 30% animal capable to induce the positive serum of anti-HAV.
(virus titer is 3.25LogCCID to table three hepatitis A attenuated live vaccine
50/ ml) the hepatitis E recombiant protein with various dose carries out the result that combined immunization induces mouse anti HAV positive serum
| The B group | The J group | The K group | The L group | The M group | The N group | |
| Produce the percent of positive serum mice | 60 | 60 | 60 | 60 | 60 | 30 |
C-4: as shown in Table 4, (virus titer is 6.5LogCCID to Live Attenuated HAV
50/ the result that ml) carries out the combined immunization mice with the hepatitis E recombiant protein of various dose shows that the animal of C, O, P, Q, R group all can induce the positive serum of anti-HAV, and the S group has only 60% animal capable to induce the positive serum of anti-HAV.
(virus titer is 6.5LogCCID to table tetramethyl liver attenuated live vaccine
50/ ml) the hepatitis E recombiant protein with various dose carries out the result that combined immunization induces mouse anti HAV positive serum
| The C group | The O group | The P group | The Q group | The R group | The S group | |
| Produce the percent of positive serum mice | 90 | 100 | 100 | 100 | 100 | 60 |
C-5: as shown in Table 5, (virus titer is 10LogCCID to Live Attenuated HAV
50/ the result that ml) carries out the combined immunization mice with the hepatitis E recombiant protein of various dose shows that the animal of D, T, U, V, W group all can induce the positive serum of anti-HAV, and the X group has only 60% animal capable to induce the positive serum of anti-HAV.
(virus titer is 10LogCCID to table five Live Attenuated HAV
50/ ml) the hepatitis E recombiant protein with various dose carries out the result that combined immunization induces mouse anti HAV positive serum
| The D group | The T group | The U group | The V group | The W group | The X group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 | 100 | 60 |
C-6: as shown in Table 6, the result that the Live Attenuated HAV of hepatitis E recombiant protein (5ug/ml) and various dose carries out the combined immunization mice shows, E group has 80% animal capable to induce the positive serum of anti-HEV, and the animal of J, O, T group all can induce the positive serum of anti-HEV.
Table six hepatitis E recombiant protein (5ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the Live Attenuated HAV of various dose
| The E group | The J group | The O group | The T group | |
| Produce the percent of positive serum mice | 80 | 100 | 100 | 100 |
C-7: as shown in Table 7, the result that the Live Attenuated HAV of hepatitis E recombiant protein (10ug/ml) and various dose carries out the combined immunization mice shows, F group has 80% animal capable to induce the positive serum of anti-HEV, and the animal of K, P, U group all can induce the positive serum of anti-HEV.
Table seven hepatitis E recombiant protein (10ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the Live Attenuated HAV of various dose
| The F group | The K group | The P group | The U group | |
| Produce the percent of positive serum mice | 80 | 100 | 100 | 100 |
C-8: as shown in Table 8, the result that the Live Attenuated HAV of hepatitis E recombiant protein (20ug/ml) and various dose carries out the combined immunization mice shows that the animal of G, L, Q, V group all can induce the positive serum of anti-HEV.
Table eight hepatitis E recombiant protein (20ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the Live Attenuated HAV of various dose
| The G group | The L group | The Q group | The V group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 |
C-9: as shown in Table 9, the result that the Live Attenuated HAV of hepatitis E recombiant protein (40ug/ml) and various dose carries out the combined immunization mice shows that the animal of H, M, R, W group all can induce the positive serum of anti-HEV.
Table nine hepatitis E recombiant protein (40ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the Live Attenuated HAV of various dose
| The H group | The M group | The R group | The W group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 |
C-10: as shown in Table 10, the result that the Live Attenuated HAV of hepatitis E recombiant protein (80ug/ml) and various dose carries out the combined immunization mice shows that the animal of I, N, S, X group all can induce the positive serum of anti-HEV.
Table ten hepatitis E recombiant protein (80ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the Live Attenuated HAV of various dose
| The I group | The N group | The S group | The X group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 |
Above embodiment result shows that when the hepatitis E recombiant protein of the Live Attenuated HAV of various dose and various dose carried out the combined immunization mice, the Live Attenuated HAV of various dose all can strengthen the immune effect (table six, table seven) of hepatitis E recombiant protein; During hepatitis E recombiant protein dosage≤40ug/ml, the immune effect of Live Attenuated HAV there is not influence (table three, table four, table five).
Embodiment nine: the immunogenicity experiments of deactivation HAV-HEV combined vaccine
A: laboratory animal grouping and immunization protocol
Select 6-8 240 of the female BALB/C mouse inbred liness (Yangzhou University comparative medicine experimental center provides) in age in week for use, be divided into 24 groups at random, 10 every group.The A group: the blank group, injection gel aluminum hydroxide (concentration is 1.0mg/ml), 0.1ml/ are only; The B group: the hav inactivated vaccine group, injection hav inactivated vaccine (virus antigen content is 200U/ml), 0.1ml/ are only; The C group: the hav inactivated vaccine group, injection hav inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ are only; The D group: the hav inactivated vaccine group, injection hav inactivated vaccine (virus antigen content is 1000U/ml), 0.1ml/ are only; The E group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (5ug/ml), 0.1ml/ is only; The F group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (10ug/ml), 0.1ml/ is only; The G group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (20ug/ml), 0.1ml/ is only; The H group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (40ug/ml), 0.1ml/ is only; The I group: the hepatitis E vaccine group, injection hepatitis E virus recombiant protein (80ug/ml), 0.1ml/ is only; The J group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (5ug/ml)+hav inactivated vaccine (virus antigen content is 200U/ml), 0.1ml/ is only; The K group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (10ug/ml)+hav inactivated vaccine (virus antigen content is 200U/ml), 0.1ml/ is only; The L group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (20ug/ml)+hav inactivated vaccine (virus antigen content is 200U/ml), 0.1ml/ is only; The M group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (40ug/ml)+hav inactivated vaccine (virus antigen content is 200U/ml), 0.1ml/ is only; The N group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (80ug/ml)+hav inactivated vaccine (virus antigen content is 200U/ml), 0.1ml/ is only; The O group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (5ug/ml)+hav inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ is only; The P group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (10ug/ml)+hav inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ is only; The Q group: deactivation HAV-HE combined vaccine group, injection hepatitis E virus recombiant protein (20ug/ml)+hav inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ is only; The R group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (40ug/ml)+hav inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ is only; The S group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (80ug/ml)+hav inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ is only; The T group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (5ug/ml)+hav inactivated vaccine (virus antigen content is 1000U/ml), 0.1ml/ is only; The U group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (10ug/ml)+hav inactivated vaccine (virus antigen content is 1000U/ml), 0.1ml/ is only; The V group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (20ug/ml)+hav inactivated vaccine (virus antigen content is 1000U/ml), 0.1ml/ is only; The W group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (40ug/ml)+hav inactivated vaccine (virus antigen content is 1000U/ml), 0.1ml/ is only; The X group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (80ug/ml)+hav inactivated vaccine (virus antigen content is 1000U/ml), 0.1ml/ is only; Each organizes laboratory animal respectively at the corresponding vaccine of 0,4,6 week injections three times, the corresponding vaccine of the subcutaneous multi-point injection 0.1ml in 0 all backs wherein, the corresponding vaccine of 4,6 all lumbar injection 0.05ml.
B: detection method:
B-1: the external neutralization experiment of hepatitis A antibody
Adopt in the quick plaque and laboratory method detection hepatitis A antibody.With the antiserum 100ul of dilution in 1: 1000 with contain 100TCID
50/ 100ul hepatitis A virus (HAV) suspension mixes, and establishes matched group simultaneously, and 37 ℃ of effects added 24 porocyte culture plates after 1 hour, and adds the FRHK4 cell suspension 0.4ml/ hole (about 4 * 10 that contains 10% calf serum
5Cell), mixing is put CO
2Incubator is hatched after 60-90 minute for 37 ℃ and is exhausted liquid, add and contain 10% calf serum alimentary gel (containing 1% agarose) 0.5ml/ hole, inversion was hatched 72 hours, add dimethyl diaminophenazine chloride gel 0.25ml/ hole again, continued to hatch 72 hours, the counting plaque, the antiserum that can reduce virus plaque number 90% at last is judged to positive serum.
B-2: the external neutralization experiment of hepatitis E antibody
Adopt in PCR-based external and experimental technique, with the antiserum 100ul of dilution in 1: 40 with contain 100TCID
50/ 100ul hepatitis E viral suspension mixes, the PLC/PRF/5 cell is inoculated in 37 ℃ of effects after 1 hour, cultivate after 2 hours for 37 ℃, Hank ' s liquid washed cell 3 times, use the Trizol method to extract nucleic acid, adopt primer 3 (5 '-CCG ACA GAA TTG ATT TCG TCG GC-3 '), primer 4 (5 '-GTT GTC TCG GCCAAT GGC GAG CC-3 '), primer 5 (5 '-TCG GCG GCG GTG AGA GAG AGC CA-3 '), primer 6 (5 '-CCG TAA GTG GAC TGG TCG TAC TC-3 ') carries out reverse transcription-nest-type PRC and detects hepatitis E virus nucleic acid, the nest-type PRC condition is: the first round: 94 ℃-45 seconds, 50 ℃-45 seconds, 72 ℃-50 seconds, 35 circulations, primer are primer 3 and primer 6; Second takes turns: 94 ℃-45 seconds, 52 ℃-45 seconds, 72 ℃-50 seconds, 30 circulations, primer is primer 4 and primer 5; The PCR feminine gender is judged to the neutralization test positive, and the antiserum of the virus that will neutralize at last is judged to positive serum.
C: result
C-1: as shown in Table 1, use the result of the hav inactivated vaccine immune mouse of various dose to show, the percent of generation positive serum mice raises with the raising of hav inactivated vaccine immunizing dose.
The hav inactivated vaccine of table one various dose induces the result of mouse anti HAV positive serum
| The A group | The B group | The C group | The D group | |
| Produce the percent of positive serum mice | 0 | 60 | 100 | 100 |
C-2: as shown in Table 2, use the result of the hepatitis E vaccine immune mouse of various dose to show, the percent that produces the positive serum mice raises with the raising of hepatitis E recombiant protein immunizing dose, and when hepatitis E recombiant protein immunizing dose 〉=20ug/ml, all mices all can produce positive serum.
The hepatitis E recombiant protein of table two various dose induces the result of mouse anti HEV positive serum
| The A group | The E group | The F group | The G group | The H group | The I group | |
| Produce the percent of positive serum mice | 0 | 80 | 80 | 100 | 100 | 100 |
C-3: as shown in Table 3, the result that the hepatitis E recombiant protein of hav inactivated vaccine (virus antigen content is 200U/ml) and various dose carries out the combined immunization mice shows, B, J, K, L, M group have 60% animal capable to induce the positive serum of anti-HAV, and the N group has 30% animal capable to induce the positive serum of anti-HAV.
Table three hepatitis A inactivated vaccine (virus antigen content is 200U/ml) carries out the result that combined immunization induces mouse anti HAV positive serum with the hepatitis E recombiant protein of various dose
| The B group | The J group | The K group | The L group | The M group | The N group | |
| Produce the percent of positive serum mice | 60 | 60 | 60 | 60 | 60 | 30 |
C-4: as shown in Table 4, the result that the hepatitis E recombiant protein of hav inactivated vaccine (virus antigen content is 500U/ml) and various dose carries out the combined immunization mice shows, the animal of C, O, P, Q, R group all can induce the positive serum of anti-HAV, and the S group has only 60% animal capable to induce the positive serum of anti-HAV.
Table tetramethyl liver inactivated vaccine (virus antigen content is 500U/ml) carries out the result that combined immunization induces mouse anti HAV positive serum with the hepatitis E recombiant protein of various dose
| The C group | The O group | The P group | The Q group | The R group | The S group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 | 100 | 60 |
C-5: as shown in Table 5, the result that the hepatitis E recombiant protein of hav inactivated vaccine (virus antigen content is 1000U/ml) and various dose carries out the combined immunization mice shows, the animal of D, T, U, V, W group all can induce the positive serum of anti-HAV, and the X group has only 60% animal capable to induce the positive serum of anti-HAV.
Table five hav inactivated vaccine (virus antigen content is 1000U/ml) carries out the result that combined immunization induces mouse anti HAV positive serum with the hepatitis E recombiant protein of various dose
| The D group | The T group | The U group | The V group | The W group | The X group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 | 100 | 60 |
C-6: as shown in Table 6, hepatitis E recombiant protein (5ug/ml) shows with the result that the various dose hav inactivated vaccine carries out the combined immunization mice, E group has 80% animal capable to induce the positive serum of anti-HEV, and the animal of J, O, T group all can induce the positive serum of anti-HEV.
Table six hepatitis E recombiant protein (5ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the hav inactivated vaccine of various dose
| The E group | The J group | The O group | The T group | |
| Produce the percent of positive serum mice | 80 | 100 | 100 | 100 |
C-7: as shown in Table 7, hepatitis E recombiant protein (10ug/ml) shows with the result that the various dose hav inactivated vaccine carries out the combined immunization mice, F group has 80% animal capable to induce the positive serum of anti-HEV, and the animal of K, P, U group all can induce the positive serum of anti-HEV.
Table seven hepatitis E recombiant protein (10ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the hav inactivated vaccine of various dose
| The F group | The K group | The P group | The U group | |
| Produce the percent of positive serum mice | 80 | 100 | 100 | 100 |
C-8: as shown in Table 8, the result that the hav inactivated vaccine of hepatitis E recombiant protein (20ug/ml) and various dose carries out the combined immunization mice shows that the animal of G, L, Q, V group all can induce the positive serum of anti-HEV.
Table eight hepatitis E recombiant protein (20ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the hav inactivated vaccine of various dose
| The G group | The L group | The Q group | The V group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 |
C-9: as shown in Table 9, the result that the hav inactivated vaccine of hepatitis E recombiant protein (40ug/ml) and various dose carries out the combined immunization mice shows that the animal of H, M, R, W group all can induce the positive serum of anti-HEV.
Table nine hepatitis E recombiant protein (40ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the hav inactivated vaccine of various dose
| The H group | The M group | The R group | The W group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 |
C-10: as shown in Table 10, the result that the hav inactivated vaccine of hepatitis E recombiant protein (80ug/ml) and various dose carries out the combined immunization mice shows that the animal of I, N, S, X group all can induce the positive serum of anti-HEV.
Table ten hepatitis E recombiant protein (80ug/ml) carries out the result that combined immunization induces mouse anti HEV positive serum with the hav inactivated vaccine of various dose
| The I group | The N group | The S group | The X group | |
| Produce the percent of positive serum mice | 100 | 100 | 100 | 100 |
Above experimental result shows that when the hepatitis E recombiant protein of the hav inactivated vaccine of various dose and various dose carried out the combined immunization mice, the hav inactivated vaccine of various dose all can strengthen the immune effect (table six) of hepatitis E recombiant protein; During hepatitis E recombiant protein dosage≤40ug/ml, the immune effect of hav inactivated vaccine there is not influence (table three, table four, table five).
Embodiment 10: the immunogenicity of attenuation HAV-HEV combined vaccine and deactivation HAV-HEV combined vaccine relatively
A: laboratory animal grouping and immunization protocol
Select 6-8 week 20 of female BALB/C mouse inbred liness in age (Yangzhou University comparative medicine experimental center provides) for use, be divided into 2 groups at random, every group 10, the A group: attenuation HAV-HEV combined vaccine group, (virus titer is 6.5LogCCID to injection hepatitis E virus recombiant protein (20ug/ml)+attenuated hepatitis A live vaccine
50/ ml), 0.1ml/ is only; The B group: deactivation HAV-HEV combined vaccine group, injection hepatitis E virus recombiant protein (20ug/ml)+hepatitis A inactivated vaccine (virus antigen content is 500U/ml), 0.1ml/ are only.Each organizes laboratory animal respectively at the corresponding vaccine of 0,4,6 week injections three times, the corresponding vaccine of the subcutaneous multi-point injection 0.1ml in 0 all backs wherein, the corresponding vaccine of 4,6 all lumbar injection 0.05ml.
B: detection method:
B-1: the external neutralization experiment of hepatitis A antibody
Adopt in the quick plaque and laboratory method detection hepatitis A antibody.With the antiserum 100ul of dilution in 1: 1000 with contain 100TCID
50/ 100ul hepatitis A virus (HAV) suspension mixes, and establishes matched group simultaneously, and 37 ℃ of effects added 24 porocyte culture plates after 1 hour, and adds the FRHK4 cell suspension 0.4ml/ hole (about 4 * 10 that contains 10% calf serum
5Cell), mixing is put CO
2Incubator is hatched after 60-90 minute for 37 ℃ and is exhausted liquid, add and contain 10% calf serum alimentary gel (containing 1% agarose) 0.5ml/ hole, inversion was hatched 72 hours, add dimethyl diaminophenazine chloride gel 0.25ml/ hole again, continued to hatch 72 hours, the counting plaque, the antiserum that can reduce virus plaque number 90% at last is judged to positive serum.
B-2: the external neutralization experiment of hepatitis E antibody
Adopt in PCR-based external and experimental technique, with the antiserum 100ul of dilution in 1: 40 with contain 100TCID
50/ 100ul hepatitis E viral suspension mixes, the PLC/PRF/5 cell is inoculated in 37 ℃ of effects after 1 hour, cultivate after 2 hours for 37 ℃, Hank ' s liquid washed cell 3 times, use the Trizol method to extract nucleic acid, adopt primer 3 (5 '-CCG ACA GAA TTG ATT TCG TCG GC-3 '), primer 4 (5 '-GTT GTC TCG GCCAAT GGC GAG CC-3 '), primer 5 (5 '-TCG GCG GCG GTG AGA GAG AGC CA-3 '), primer 6 (5 '-CCG TAA GTG GAC TGG TCG TAC TC-3 ') carries out reverse transcription-nest-type PRC and detects hepatitis E virus nucleic acid, the nest-type PRC condition is: the first round: 94 ℃-45 seconds, 50 ℃-45 seconds, 72 ℃-50 seconds, 35 circulations, primer are primer 3 and primer 6; Second takes turns: 94 ℃-45 seconds, 52 ℃-45 seconds, 72 ℃-50 seconds, 30 circulations, primer is primer 4 and primer 5; The PCR feminine gender is judged to the neutralization test positive, and the antiserum of the virus that will neutralize at last is judged to positive serum.
C: result
The result uses the attenuation HAV-HEV combined vaccine (A group) in this scheme and the immune result of deactivation HAV-HEV combined vaccine (B group) to show shown in table one, table two, and the laboratory animal that A group and B organize all can induce the positive serum of anti-HAV, anti-HEV.
Table one does not carry out the result that immunity induces mouse anti HAV positive serum on the same group
| The A group | The B group | |
| Produce the percent of positive serum mice | 100 | 100 |
Table two does not carry out the result that immunity induces mouse anti HEV positive serum on the same group
| The A group | The B group | |
| Produce the percent of positive serum mice | 100 | 100 |
Embodiment 11: the use of gelatin
In order to increase the stability of prepared HAV-HEV combined vaccine, adding final concentration is the gelatin of 0.5-0.7w/v%, and the result does not observe the gathering of vaccine and to storing sticking with vial 2-8 ℃ of storage after 3 months.
Claims (7)
1, a kind of hepatitis A-hepatitis E combined vaccine is characterized in that comprising hepatitis E virus recombiant protein and attenuated hepatitis A live vaccine or hepatitis A inactivated vaccine, and said attenuated hepatitis A live vaccine, its virus titer are 5-10LogCCID
50/ ml, said hepatitis A inactivated vaccine, its virus antigen content is 250-1000U/ml, the content of hepatitis E virus recombiant protein is 5-50ug/ml.
2, hepatitis A-hepatitis E combined vaccine according to claim 1 is characterized in that comprising immunological adjuvant, and this immunological adjuvant is a gel aluminum hydroxide solution, and the concentration range of gel aluminum hydroxide is adjusted into 0.6-1.5mg/ml.
3, hepatitis A-hepatitis E combined vaccine according to claim 1, the virus that it is characterized in that attenuated hepatitis A live vaccine are L-A-1, H2 attenuated vaccine strain or other available vaccine strains.
4, hepatitis A-hepatitis E combined vaccine according to claim 1, the virus that it is characterized in that hepatitis A inactivated vaccine are HM175 vaccine strain or other available vaccine strains.
5, hepatitis A-hepatitis E combined vaccine according to claim 1, to between 480 amino acids, its carboxyl terminal is 580 derivants that produce to protein fragments between 650 amino acids or thus 380 of its open reading frame 2 encoding proteins for the amino terminal that it is characterized in that the hepatitis E virus recombiant protein.
6, hepatitis A-hepatitis E combined vaccine according to claim 1 is characterized in that containing the gelatin of 0.5-0.7w/v% consumption.
7, a kind of method that is used to prepare the described hepatitis A-hepatitis E combined vaccine of claim 1 is characterized in that:
(a) before preparing final hepatitis A-hepatitis E combined vaccine, attenuated hepatitis A live vaccine virus and/or hepatitis A inactivated vaccine virus are adsorbed in gel aluminum hydroxide, the hepatitis E virus recombiant protein is adsorbed in gel aluminum hydroxide, adjusts pH to 5.5-9.6;
(b) the above-mentioned component that will adjust pH mixes.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNB2005100407339A CN100446813C (en) | 2005-06-24 | 2005-06-24 | Hepatitis A-hepatitis E combined vaccine and preparation method thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNB2005100407339A CN100446813C (en) | 2005-06-24 | 2005-06-24 | Hepatitis A-hepatitis E combined vaccine and preparation method thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN1883704A true CN1883704A (en) | 2006-12-27 |
| CN100446813C CN100446813C (en) | 2008-12-31 |
Family
ID=37582088
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CNB2005100407339A Expired - Fee Related CN100446813C (en) | 2005-06-24 | 2005-06-24 | Hepatitis A-hepatitis E combined vaccine and preparation method thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN100446813C (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101085347B (en) * | 2007-06-15 | 2010-05-19 | 东南大学 | Hepatitis A, hepatitis B and hepatitis E combination vaccine |
| CN104862287A (en) * | 2015-05-21 | 2015-08-26 | 中国医学科学院医学生物学研究所 | Preparation method of genetic engineering recombinant combined vaccine against hepatitis A and hepatitis E |
| CN110013549A (en) * | 2019-04-29 | 2019-07-16 | 青岛易邦生物工程有限公司 | A kind of Hepatitis E subunit vaccine |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0784631B1 (en) * | 1994-10-03 | 2011-08-03 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES | Method of producing a partial orf2 protein of hepatitis e virus |
| CN1596978A (en) * | 2004-07-23 | 2005-03-23 | 中国医学科学院医学生物学研究所 | Combined vaccine for hepatitis A, B virus and its preparation method |
-
2005
- 2005-06-24 CN CNB2005100407339A patent/CN100446813C/en not_active Expired - Fee Related
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101085347B (en) * | 2007-06-15 | 2010-05-19 | 东南大学 | Hepatitis A, hepatitis B and hepatitis E combination vaccine |
| CN104862287A (en) * | 2015-05-21 | 2015-08-26 | 中国医学科学院医学生物学研究所 | Preparation method of genetic engineering recombinant combined vaccine against hepatitis A and hepatitis E |
| CN110013549A (en) * | 2019-04-29 | 2019-07-16 | 青岛易邦生物工程有限公司 | A kind of Hepatitis E subunit vaccine |
| CN110013549B (en) * | 2019-04-29 | 2022-09-30 | 青岛易邦生物工程有限公司 | Subunit vaccine for hepatitis E |
Also Published As
| Publication number | Publication date |
|---|---|
| CN100446813C (en) | 2008-12-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Zhang et al. | Enterovirus 71 vaccine: close but still far | |
| CN1022801C (en) | Process for the preparation of canine parvovirus vaccines | |
| WO2018000708A1 (en) | Muscovy duck parvovirus subunit vaccine | |
| CN104693310A (en) | Chimeric protein, virus-like particle and application thereof | |
| CN104628871B (en) | A kind of preparation for recombinating bursal disease protein engineering vaccine | |
| CN101883580B (en) | Subunit vaccine for aquaculture | |
| CN110124025B (en) | Avian influenza and avian adenovirus type 4 bigeminal genetic engineering subunit vaccine and preparation method thereof | |
| CN103540605A (en) | Capsid protein phage display particle of recombinant II porcine circovirus as well as preparation method and application thereof | |
| CN102584992A (en) | Colon bacillus outer membrane protein monoclonal antibody and preparation method and application thereof | |
| CN101880647A (en) | Recombinant salmonella choleraesuis, bivalent genetic engineering vaccine and application | |
| CN1883704A (en) | Hepatitis A-hepatitis E combined vaccine and preparation method thereof | |
| CN101730544B (en) | Adaptation of pitman moore strain of rabies virus to primary chick embryo fibroblast cell cultures | |
| CN117018174B (en) | Saccharomyces cerevisiae oral vaccine for avian bacillus paragallinarum A and application | |
| CN108018261B (en) | Canine parainfluenza virus strain and application thereof | |
| CN105349578A (en) | Chicken GM-CSF protein, and preparation method and application thereof | |
| CN110981945B (en) | Expression preparation and application of porcine circovirus type 2 recombinant Cap protein | |
| CN105541976B (en) | Recombinant antigen and its application is transformed in porcine circovirus 2 type Cap gene modification | |
| CN110128545B (en) | Fusion gene, recombinant expression vector, antigen, preparation method and application thereof | |
| CN116813718A (en) | Recombinant porcine circovirus 2 type Cap protein trimer, expression system and application thereof | |
| CN101085347B (en) | Hepatitis A, hepatitis B and hepatitis E combination vaccine | |
| KR101987775B1 (en) | Soluble Multi-Epitope Antigen of Foot-and-Mouth Disease Virus and Uses Thereof | |
| CN1357047A (en) | Recombinant fusion protein (vaccine) compsn. contg. same and method for prodn. thereof | |
| CN113322241B (en) | Bovine parainfluenza virus 3 virus strain BPIV3-NM and application thereof | |
| CN1814286A (en) | B-type hepatitis and E-type hepatitis combined vaccine and preapring method | |
| CN110101854B (en) | Carp herpesvirus III type vaccine and preparation method thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20081231 Termination date: 20150624 |
|
| EXPY | Termination of patent right or utility model |