CN1800409A - Exiguobacterium sp. MY02 strain pyrimidine nucleoside phosphorylase gene and its preparation method - Google Patents
Exiguobacterium sp. MY02 strain pyrimidine nucleoside phosphorylase gene and its preparation method Download PDFInfo
- Publication number
- CN1800409A CN1800409A CNA2005100218290A CN200510021829A CN1800409A CN 1800409 A CN1800409 A CN 1800409A CN A2005100218290 A CNA2005100218290 A CN A2005100218290A CN 200510021829 A CN200510021829 A CN 200510021829A CN 1800409 A CN1800409 A CN 1800409A
- Authority
- CN
- China
- Prior art keywords
- nucleoside phosphorylase
- pyrimidine
- gene
- dna
- reaction
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Landscapes
- Saccharide Compounds (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The invention relates to a structure gene of pyrimidine nucleoside phosphorylase which is characterized in that its coder is Exiguobacterium sp.MY02. When preparing for the gene, it first uses PCR method to sieve the gene group DNA base of the Exiguobacterium sp.MY02 strain and measures the sequence to ascertain the gene sequence of the pyrimidine nucleoside phosphorylase; it recombines the gene, purifies the recombining enzyme and measuring the activity in bacillus coli so that the result expresses that the pyrimidine nucleoside phosphorylase can coding generate recombining pyrimidine nucleoside phosphorylase with phosphorylation activity and higher transfer enzyme activity.
Description
Technical field
The present invention relates to a kind of pyrimidine nucleoside phosphorylase gene of Exiguobacterium sp.MY02 bacterial strain and prepare the method for pyrimidine nucleoside phosphorylase gene with Exiguobacterium sp.MY02 bacterial strain.
Background technology
In the last thirty years, the nucleoside active matter that plays an important role in metabolism (comprising natural structure base, nucleosides, nucleotide structure analogue and polymkeric substance) is indispensable clinical medicines such as mankind nowadays treatment virus, tumour, AIDS, existing thousands of kinds of the ucleosides antiviral compound of having developed at present.5 '-'-Deoxy-5-fluorouridine (5 '-deoxy-5-fluorouridine, 5 '-dFUrd) is a kind of good anti-cancer agent, and China formally is used for clinical in nineteen ninety-five, and clinical effectiveness is good, the huge market demand, the main at present chemical synthesis mass production that adopts.But in chemical production processes: (1) at first needs the part group of base and ribose residue is protected; (2) product is the mixture of multiple nucleosides isomer and other byproduct, further separation, so time and effort consuming, yield very low (about 10%); (3) environmental pollution is serious.So at the defective of existing production technology, the needs of seeking the satisfied a large amount of synthetic 5 '-dFUrd of novel method become new research focus.
The 5-floxuridine is the important intermediate of synthetic cancer therapy drug 5 '-dFUrd, has certain antitumour activity.Ribose in the 5-floxuridine upward can obtain 5 '-dFUrd after the deoxidation at 5 ', is a chemosynthesis step that process is fairly simple.Therefore, if can set up efficient, oligosaprobic 5-floxuridine new synthesis technology, the bottleneck technical problem of then setting up 5 '-dFUrd new synthetic process is readily solved.Studies show that, some pyrimidine-nucleoside phosphorylase (pyrimidine nucleotide phosphorylase, PyNPase) can show as higher transferase active, as: can be substrate with 5 FU 5 fluorouracil, uridine etc., by the synthetic 5-floxuridine of single step reaction method catalysis.This technology reaction conditions gentleness be easy to control, and environmental pollution is little.Therefore, this pyrimidine-nucleoside phosphorylase PyNPase with higher transferase active is an ideal tools of setting up 5-floxuridine and even 5 '-dFUrd new synthetic process, and its exploitation has important use and is worth and economic worth.
But the transferase active of all kinds of pyrimidine-nucleoside phosphorylases of having reported is not high, can't satisfy the demand of suitability for industrialized production.Therefore, seek and find that new pyrimidine-nucleoside phosphorylase with higher transferase active and genetic resources thereof become the task of top priority that solves associated problem.
Summary of the invention
The object of the present invention is to provide a kind of structure gene and preparation method thereof of pyrimidine-nucleoside phosphorylase of Exiguobacterium sp.MY02 bacterial strain.
Content of the present invention is: a kind of pyrimidine nucleoside phosphorylase gene, it is characterized in that it is the structure gene of Exiguobacterium sp.MY02 bacterial strain pyrimidine-nucleoside phosphorylase, and nucleotides sequence is classified as:
1 atgcgtatgg?tagatttgat?tgcaacaaaa?cgagacggtg?gcgaactcgc?aacagctgat 60
61 attcaagcaa?tggtagaagg?attcacgaat?ggtgagattc?cagattacca?aatgtcagcg 120
121 atgtcgatgg?cgattttcta?tcaaggaatg?tcagatcgtg?aaatcgctga?tttgacgatg 180
181 gcgatggtca?actcgggcga?cgtgatcgac?ctttcacgta?tccacggtaa?aaaagtcgat 240
241 aaacgctcga?caggcggtgt?tggtgacaag?atcagtctga?tcgtcgcacc?gctcgttgcg 300
301 tcaatcggca?ttccggttgc?gaagatgagc?ggtcgtggac?tcggtcatac?aggtggaacc 360
361 atcgacaaac?tcgaagcgtt?ccctggtttt?gacgtcgagc?tttctgaaga?agcgttcgtc 420
421 tcacaagtca?acgacatcaa?gatggcgatc?atcggtcaaa?cgggtaacct?gacgcctgca 480
481 gacaaaaaac?tctacgcatt?acgtgacgtc?acggcgacgg?tcaactcgat?cccattgatc 540
541 gcaagttcaa?tcatgtcgaa?aaaaatcgca?gcaggagcag?acagcatcgt?actcgacgtc 600
601 aagacaggtt?ctggtgcctt?catgaaatcg?tttgaagatg?caaaagcact?cgcgacagag 660
661 atggtttcaa?tcggtaagag?tgtcaaccgt?aagacggttg?ctatcattac?agacatggat 720
721 cagccgctcg?gctttgaaat?cggaaacgca?aacgaagtca?aggaagcgat?cgaagtcctt 780
781 caagggaaag?atgtccgtga?cttgaaagtc?atcgccttga?cgattgcatc?acacatggcg 840
841 gtcctcggtg?atttctaccc?gacattcgac?gaagcatatg?cggatctcga?aacacgtctc 900
901 ggtaacggag?cagcacttga?cgtcttcaag?aagttcatcg?cagcgcaagg?tggcgacgcg 960
961 tcactcgttg?acgatatgac?aaaagcactt?gaaacgaaat?acgaaaaaac?attcgtcgct 1020
1021 tcaaaagcag?gttatgtctc?tgaaatcatc?gctgacgaag?tcggtgttgc?agcaatgatc 1080
1081 ctcggtgcag?gacgcgtgac?gaaagcagat?gagatcgatc?acgcagcaag?cgttacgctg 1140
1141 cacaagaaag?tcggcgatcg?tgtcgaagtc?ggtgatgtca?tcgcaacact?tcgttcaaac 1200
1201 aaagatacac?tcgatcaagc?aatcgaaaaa?atggatcacg?cgtaccacat?cagtgaaacg 1260
1261 aaaccggaag?cacgtccgct?cgtccacgct?gtcattcaat?aa 1302
" pyrimidine nucleoside phosphorylase gene " length overall 1302bp of Exiguobacterium sp.MY02 bacterial strain, judge according to procaryotic gene expression characteristics, preceding 3 characters " atg " are the initiator codons of this gene, calculate successively according to the triplet code rule, last 3 characters " taa " are the terminator codons of this gene.
Another content of the present invention is: a kind of preparation method of pyrimidine nucleoside phosphorylase gene is characterized in that taking following steps:
(1) for cloning the pyrimidine nucleoside phosphorylase gene that obtains unknown Exiguobacterium sp.MY02 bacterial strain, this bacterial strain is cultivated in containing Luria-Bertani (LB) substratum that NaCl 0.1-0.2mol/L and extractum carnis weight concentration are 0.5-1.0%, temperature is 18-37 ℃, shakes with the speed of 100-150r/min to be cultured to the exponential growth later stage;
(2) according to the centrifugal thalline that obtains of ordinary method, working concentration is that 10mmol/L, pH value are 8.0 the resuspended thalline of Tris-EDTA damping fluid, wash 2 times after, use the resuspended thalline of this damping fluid equally and place 4 ℃, time 6-8h;
(3) continuing to add N,O-Diacetylmuramidase to final concentration is 10-150mg/mL, and the concussion mixing, 37 ℃ of incubation 1-6h;
(4) continue to be equipped with the high molecular genomic dna, detect purity, its OD through UV spectrum according to conventional SDS-phenol legal system
260/ OD
280Ratio should be greater than 1.8;
(5) continuing with the high molecular genomic dna is material, use restriction endonuclease Sau3A I to cut at 37 ℃ of incomplete enzymes that carry out 30-120min, the weight percent of total DNA after enzyme is cut through containing the pyridine of bromination second is 0.8% agarose gel electrophoresis, finding molecular weight under ultraviolet lamp is the product zone of 5-10kb, use blade to cut out the gel in this product zone, reclaim dna segment wherein;
(6) handle the multiple clone site of commercial artificial cloning vector pUC18 with restriction endonuclease BamH I under aseptic condition, its complete degestion is linear, and dephosphorylation is handled;
(7) dna segment that reclaims is mixed with linear carrier, add the T4 dna ligase and connect 10-14h at 16 ℃, form recombinant plasmid and transformed competence colibacillus bacterial cell, obtain the genome dna library of Exiguobacterium sp.MY02 bacterial strain, the preferred intestinal bacteria of said competence bacterial cell, said conversion, conversion method preferably shocks by electricity;
(8) use penbritin concentration to cultivate mono-clonal in the said gene group DNA library respectively as the Luria-Bertani liquid nutrient medium of 100mg/mL, temperature is 37 ℃, speed concussion with 100-150r/min is cultured to the exponential growth later stage, be template with each monoclonal 1 μ L bacterium liquid respectively, use the degenerated primer of conjecture property to carry out conventional pcr amplification, primer sequence is as follows:
5’-GGYGTKCCAGTKGCSAAGATG-3’
5’-GAASGCRCCSGCGACCSGTCTT-3
Carry out conventional pcr amplification reaction, PCR reaction system and the mono-clonal reference numeral that is used as template, wherein the condition of PCR reaction is:
94 ℃ of pre-sex change 2min carry out 35 circulations with 94 ℃ of 30s, 55-63 ℃ 30s, 72 ℃ of 30s subsequently, extend 10min at 72 ℃ at last;
(9) weight percent that the product of above-mentioned different PCR reaction is contained the pyridine of bromination second respectively is 1.5% agarose gel electrophoresis, determine the PCR reaction system of the about 400bp of product size in electrophoresis result, determine to be used as the mono-clonal of this PCR reaction system template according to the described reference numeral of step (8), think and contain pyrimidine nucleoside phosphorylase gene in this monoclonal recombinant plasmid, measure the nucleotide sequence of foreign gene;
(10) by using BLAST software, information in resulting gene order of aforesaid method and the biometric database is carried out gene and the comparison of proteinic homology, the pyrimidine nucleoside phosphorylase gene that preliminary judgement wherein exists, the database of the preferred U.S. in said biological data storehouse.
Among the preparation method of described pyrimidine nucleoside phosphorylase gene, after the pyrimidine nucleoside phosphorylase gene that said preliminary judgement wherein exists in the step (10), continue to take following steps to have the function of coding pyrimidine-nucleoside phosphorylase to confirm this gene:
(1) according to a pair of primer of two ends sequences Design of this gene, comprising the restriction endonuclease recognition site identical with next step, be that template is carried out conventional pcr amplification with former reorganization plasmid, the sequence of primer is as follows:
5 ' GCA
CCATGGTAA TGCGTATGGTAGATTTG3 ' (drawing the horizontal line place is the restriction enzyme site of Nco I)
5 ' CCG
TCTAGAAATTGAATGACAGC GTGGAC ' 3 ' (drawing the horizontal line place is the restriction enzyme site of Xba I)
The reaction conditions of PCR is: 94 ℃ of pre-sex change 2min, carry out 35 circulations with 94 ℃ of 30s, 55-63 ℃ 30s, 72 ℃ of 90s subsequently, and extend 10min at 72 ℃ at last;
(2) take out the PCR reaction product, after the weight percent through containing the pyridine of bromination second was the 0.6-1.5% agarose gel electrophoresis, the DNA that cuts the about 1.3kb of size that pcr amplification produced with blade under ultraviolet lamp was with, and carried out DNA and reclaimed;
(3) DNA that recovery is obtained uses Nco I and Xba I at 37 ℃ of complete degestions, and 65 ℃ of heating bath 10-15min finish reaction, the centrifugal 2min of 12,000 * g; Handle pBAD g III/A carrier with quadrat method;
(4) with above-mentioned DNA and pBAD g III/A vector construction recombinant clone plasmid, its reaction system is: the DNA 15 μ L of recovery, pMD18-T carrier 0.5 μ L, T4DNA ligase enzyme 1-2 μ L, cumulative volume 30 μ L; Reaction system at 16 ℃ of reaction 2-16h, is formed recombinant plasmid;
(5) with recombinant plasmid transformed competence colibacillus intestinal bacteria Top 10F ', said recombinant plasmid is selected 10 μ L for use, and said competence intestinal bacteria are selected 50-150 μ L for use;
(6) converted product that step (5) is obtained is coated on the LB solid medium that contains penbritin 50-100 μ g/mL and cultivates 15-24h, select single bacterium colony, in containing the LB liquid nutrient medium of same concentrations penbritin, cultivate 12-24h, through alkaline lysis method of extracting recombinant plasmid wherein;
(7) use restriction endonuclease Nco I to cut recombinant plasmid 1.0-4h at 37 ℃ of enzymes, 65 ℃ of heating bath 10-15min finish reaction, weight percent through containing the pyridine of bromination second is the 0.6-1.5% agarose gel electrophoresis, the discovery enzyme is cut product only the DNA band of 1 size greater than 5kb, illustrates that pyrimidine nucleoside phosphorylase gene has correctly inserted the downstream of pectinose inducible promoter in this recombinant plasmid;
(8) the intestinal bacteria Top10F ' that will contain above-mentioned recombinant plasmid cultivates in the LB liquid nutrient medium, and shaking culture is to OD under 37 ℃ of environment
600Be 0.6, add L-arabinose to final concentration and be between the 0.5-2.0mmol/L, continue to cultivate 3h, 4 ℃ of centrifugal 30min of 5000 * g collect thalline, are resuspended in 12mL binding buffer liquid (20mmol/L phosphate buffered saline buffer, pH7.8/0.5M NaCl);
(9) with above-mentioned bacterium liquid ultrasonication 15min under the ice bath environment, every effect 10s suspends 10s;
(10) the centrifugal 30min of 12000 * g removes cell debris under 4 ℃ of environment, and supernatant liquor is through 0.22 μ m filtering with microporous membrane, the Ni ion affinity chromatography post on the filtrate behind the damping fluid pre-equilibration, the preferred Invitrogen of said Ni ion affinity chromatography post company product;
(11) wash pillar to elutant OD with binding buffer liquid and dcq buffer liquid (20mmol/L phosphate buffered saline buffer, pH7.8/0.5M NaCl)
280＜0.01, last is that 5mL and pH value are respectively 4～6 damping fluid (20mmol/L phosphate buffered saline buffer/0.5M NaCl) and carry out wash-out with volume successively, the protein that SDS-PAGE detects in the elutriant distributes, merge the elutriant of the single protein band that contains the about 46kD of molecular weight, think that this protein is the coded reorganization pyrimidine-nucleoside phosphorylase of above-mentioned pyrimidine nucleoside phosphorylase gene.
(12) measure the protein concn of above-mentioned reorganization pyrimidine-nucleoside phosphorylase preparation with standard Lowry method, frozen after the packing in-80 ℃.
Among the preparation method of described pyrimidine nucleoside phosphorylase gene, after the protein concn of the said definite reorganization pyrimidine-nucleoside phosphorylase preparation of step (12), continue to take following steps to measure the phosphorylation activity and the transferase active of the coded reorganization pyrimidine-nucleoside phosphorylase of above-mentioned pyrimidine nucleoside phosphorylase gene:
(1) in dry sterile chamber, in potassium phosphate salt concentration is that 25-40mmol/L, beta-mercaptoethanol concentration are that 5mmol/L, EDTA concentration are that 1-10mmol/L, uridine concentration are in the mixed solution reaction system of 10-100mmol/L, add above-mentioned reorganization pyrimidine-nucleoside phosphorylase preparation to final concentration 0.1-20 μ g/mL, 3-12h under 37-60 ℃ of environment reaction, the HCl that adds 1mol/L is to final concentration 0.1mol/L termination reaction; Under the same operation condition, the reaction system that does not add above-mentioned recombinase preparation is a control group.
(2) reaction solution is put on the GF254 silica-gel plate, launch with methylene dichloride/tetrahydrofuran solvent system, the spot of detection compound under the 254nm UV-light, the result is scanned into image and analyzes, show that considerable change has taken place the substrate uridine in the above-mentioned reaction system that has added the reorganization pyrimidine-nucleoside phosphorylase, and produced new compound uridylic, and the substrate in the control group is without any considerable change; Think that this is the exercising result of the phosphorylation activity of reorganization pyrimidine-nucleoside phosphorylase.
(3) in dry sterile chamber, when potassium phosphate salt concentration is 15-40mmol/L, uridine/when 5 FU 5 fluorouracil ratio is 2.4-3.1, add above-mentioned reorganization pyrimidine-nucleoside phosphorylase preparation to final concentration 0.1-10 μ g/mL, 3-12h under 50-65 ℃ of environment reaction; The HCl that adds 1mol/L is to final concentration 0.1mol/L termination reaction; Under the same operation condition, the reaction system that does not add above-mentioned recombinase preparation is a control group.
(4) reaction solution is put on the GF254 silica-gel plate, launch with methylene dichloride/tetrahydrofuran solvent system, the spot of detection compound under the 254nm UV-light, the result carries out computational analysis after being scanned into image, show that substrate 5 FU 5 fluorouracil and uridine in the above-mentioned reaction system that has added the reorganization pyrimidine-nucleoside phosphorylase have been generated 5-floxuridine and uridylic by the part conversion, and control group thinks that without any considerable change this is the exercising result of the transferase active of reorganization pyrimidine-nucleoside phosphorylase.
Described bacterium Exiguobacterium sp.MY02 bacterial strain, the gene order of its 16S rRNA is included by GenBank, and the number of including is DQ083948; This bacterial strain is collected by China Committee for Culture Collection of Microorganisms common micro-organisms center on October 8th, 2005, its address is a No. 13, North No.1 Row, Zhongguancun, Haidian District, Beijing City Institute of Microorganism, Academia Sinica, and its deposit number is: CGMCC No.1473.
In the step among the preparation method of described pyrimidine nucleoside phosphorylase gene (4), high molecular genomic dna with the Exiguobacterium sp.MY02 bacterial strain of conventional SDS-phenol method preparation, detect through agarose gel electrophoresis, whether prepared genomic dna molecular weight is more than or equal to 21kb, if more than or equal to 21kb then enter next step, otherwise should prepare DNA again, until more than or equal to 21kb.
Among the preparation method of described pyrimidine nucleoside phosphorylase gene, the database of the said U.S. is GenBank in the step (10).
The structure gene input U.S. GenBank database of said gene of the present invention and Exiguobacterium sp.255-15 bacterial strain pyrimidine-nucleoside phosphorylase carries out nucleotide homology relatively, and the result is as follows:
Query：1 atgcgtatggtagatttgattgcaacaaaacgagacggtggcgaactcgcaacagctgat?60
||||||||||||||||||||||||||||||||||||||?||||||?| ||?||||||
Sbjct：1 atgcgtatggtagatttgattgcaacaaaacgagacggcggcgaattacagactgctgat?60
Query：61 attcaagcaatggtagaaggattcacgaatggtgagattccagattaccaaatgtcagcg?120
|||?||||||||||?|||||?||||||||?||?||?|||||||||||?||?||||||||
Sbjct：61 attaaagcaatggttgaaggcttcacgaacggcgatattccagattatcagatgtcagca?120
Query：121 atgtcgatggcgattttctatcaaggaatgtcagatcgtgaaatcgctgatttgacgatg?180
||||||||||||||||||||||||||?||||||||?|||||||||||?|||||?||||||
Sbjct：121 atgtcgatggcgattttctatcaaggcatgtcagaccgtgaaatcgcggatttaacgatg?180
Query：181 gcgatggtcaactcgggcgacgtgatcgacctttcacgtatccacggtaaaaaagtcgat?240
|||||||||?|?|||||?|||||?||||||?|?||?|||||||||||||||||||||||
Sbjct：181 gcgatggtcgagtcgggtgacgtcatcgacttgtcccgtatccacggtaaaaaagtcgac?240
Query：241 aaacgctcgacaggcggtgttggtgacaagatcagtctgatcgtcgcaccgctcgttgcg?300
||||?|||?||||||||?||?||?||?||?||||||||||||||?|||||?|||||?|||
Sbjct：241 aaacactcaacaggcggcgtcggcgataaaatcagtctgatcgttgcaccactcgtcgcg?300
Query：301 tcaatcggcattccggttgcgaagatgagcggtcgtggactcggtcatacaggtggaacc?360
||||||||?|||||?||?|||||?||||||||?||?||?||?|||||?|||||?|||||
Sbjct：301 tcaatcggaattcctgtcgcgaaaatgagcggacgcggtcttggtcacacaggcggaacg?360
Query：361 atcgacaaactcgaagcgttccctggttttgacgtcgagctttctgaagaagcgttcgtc?420
||||||||?|||||||||||||||||?|||||?||?|| |?||?||||||||?|||?|
Sbjct：361 atcgacaagctcgaagcgttccctggatttgatgtggaattgtcggaagaagcattcgtt?420
Query：421 tcacaagtcaacgacatcaagatggcgatcatcggtcaaacgggtaacctgacgcctgca?480
||?|||||||||||||||||||||||?|||||||||||?||?||?||||||||?|||||
Sbjct：421 tctcaagtcaacgacatcaagatggccatcatcggtcagacaggcaacctgacacctgcc?480
Query：481 gacaaaaaactctacgcattacgtgacgtcacggcgacggtcaactcgatcccattgatc?540
||||||||||||||||||||||||||?||?||?||?||||||||||||||?||?|||||
Sbjct：481 gacaaaaaactctacgcattacgtgatgtgacagcaacggtcaactcgattccgttgatt?540
Query：541 gcaagttcaatcatgtcgnnnnnnntcgcagcaggagcagacagcatcgtactcgacgtc?600
|||||?|||||||||||| |||||||?||?||?|||||?|||||?||||||||
Sbjct：541 gcaagctcaatcatgtcgaaaaaaatcgcagccggtgctgacagtatcgtcctcgacgtg 600
Query：601 aagacaggttctggtgccttcatgaaatcgtttgaagatgcaaaagcactcgcgacagag 660
||?||||||||?||?||?|||||||||||?||||||||?||?|||||||||||||||||
Sbjct：601 aaaacaggttcaggcgcgttcatgaaatcatttgaagacgcgaaagcactcgcgacagaa 660
Query：661 atggtttcaatcggtaagagtgtcaaccgtaagacggttgctatcattacagacatggat 720
|||||?||?||||||||?|||||?|||||?||||||?|||| |||||||?|||||||||
Sbjct：661 atggtgtcgatcggtaaaagtgtgaaccggaagacgattgccgtcattacggacatggat 720
Query：721 cagccgctcggctttgaaatcggaaacgcaaacgaagtcaaggaagcgatcgaagtcctt 780
||||||||||| ||||||||||||?||?||||||||||||||||||||?||||||||
Sbjct：721 cagccgctcggaaatgaaatcggaaatgcgaacgaagtcaaggaagcgattgaagtcctg 780
Query：781 caagggaaagatgtccgtgacttgaaagtcatcgccttgacgattgcatcacacatggcg 840
|||||?|||||||||||||||||||||||||||||||||||||||||?|||||||||||
Sbjct：781 caaggaaaagatgtccgtgacttgaaagtcatcgccttgacgattgcgtcacacatggca 840
Query：841 gtcctcggtgatttctacccgacattcgacgaagcatatgcggatctcgaaacacgtctc 900
||||||||?||?|||||||||||?||?||||||||?||?|||||||||||?|||||||||
Sbjct：841 gtcctcggggagttctacccgacgtttgacgaagcgtacgcggatctcgagacacgtctc 900
Query：901 ggtaacggagcagcacttgacgtcttcaagaagttcatcgcagcgcaaggtggcgacgcg 960
| ||||||||||||||||||||?||||||||?||||||||?||?|||||?|||||?|||
Sbjct：901 gcgaacggagcagcacttgacgtattcaagaaattcatcgcggcacaaggcggcgatgcg 960
Query：961 tcactcgttgacgatatgacaaaagcacttgaaacgaaatacgaaaaaacattcgtcgct 1020
||||||||?||||||||||||||||||||?||||||||||?||||||| ||||||||
Sbjct：961 tcactcgtcgacgatatgacaaaagcactcgaaacgaaattcgaaaaagatttcgtcgca 1020
Qucry：1021 tcaaaagcaggttatgtctctgaaatcatcgctgacgaagtcggtgttgcagcaatgatc 1080
||?||||||||?||?||?||?|||||||||||?||?||||||||||?||||||?||||||
Sbjct：1021 tcgaaagcaggatacgtttcggaaatcatcgcggatgaagtcggtgtcgcagccatgatc?1080
Query：1081 ctcggtgcaggacgcgtgacgaaagcagatgagatcgatcacgcagcaagcgttacgctg?1140
||||||||?||?||?| ||||| |?|||| |||||||||||||||||?|||||?|||
Sbjct：1081 ctcggtgccggtcgtgcaacgaagaccgatgtcatcgatcacgcagcaagtgttaccctg?1140
Query：1141 cacaagaaagtcggcgatcgtgtcgaagtcggtgatgtcatcgcaacacttcgttcaaac?1200
|||?|||||||||||| |||||||||||||||||||||||?|||||?|||||?|||
Sbjct：1141 ttcaaaaaagtcggcgataaagtcgaagtcggtgatgtcatcgcgacactccgttcgaac?1200
Query：1201 aaagatacactcgatcaagcaatcgaaaaaatggatcacgcgtaccacatcagtgaaacg?1260
|||||?||||||||||||||?|||||?|||||||||||||||||?||||||||?||?||
Sbjct：1201 aaagaaacactcgatcaagccatcgagaaaatggatcacgcgtatcacatcagcgagaca?1260
Query：1261 aaaccggaagcacgtccgctcgtccacgctgtcattcaataa?1302
||||||||||||||||||||?|||||||||||||||||||||
Sbjct：1261 aaaccggaagcacgtccgcttgtccacgctgtcattcaataa?1302
Wherein, Query is the structure gene of clone's Exiguobacterium sp.MY02 bacterial strain pyrimidine-nucleoside phosphorylase; Sbjct is the structure gene of the pyrimidine-nucleoside phosphorylase of Exiguobacterium sp.255-15 bacterial strain.
Above-mentioned relatively demonstration, the consistence of these two genes reaches 86% (1128/1302), shows that the structure gene of the pyrimidine-nucleoside phosphorylase of the Exiguobacterium sp.MY02 bacterial strain of being cloned is different from the structure gene of the pyrimidine-nucleoside phosphorylase of Exiguobacterium sp.255-15 bacterial strain.
This gene is included by U.S.'s GenBank database, and the number of including is: AY736134.
Exiguobacterium sp.MY02 bacterial strain pyrimidine nucleoside phosphorylase gene according to the clone, infer according to common triplet code rule and its coded zymoprotein sequence, pyrimidine nucleoside phosphorylase gene with the Exiguobacteriumsp.255-15 bacterial strain carries out homology relatively again, and the result is as follows:
Query：1 MRMVDLIATKRDGGELATADIQAMVEGFTNGEIPDYQMSAMSMAIFYQGMSDREIADLTM?60
MRMVDLIATKRDGGEL?TADI+AMVEGFTNG+IPDYQMSAMSMAIFYQGMSDREIADLTM
Sbjct：1 MRMVDLIATKRDGGELQTADIKAMVEGFTNGDIPDYQMSAMSMAIFYQGMSDREIADLTM?60
Query：61 AMVNSGDVIDLSRIHGKKVDKRSTGGVGDKISLIVAPLVASIGIPVAKMSGRGLGHTGGT?120
AMV?SGDVIDLSRIHGKKVDK?STGGVGDKISLIVAPLVASIGIPVAKMSGRGLGHTGGT
Sbjct：61 AMVESGDVIDLSRIHGKKVDKHSTGGVGDKISLIVAPLVASIGIPVAKMSGRGLGHTGGT?120
Query：121 IDKLEAFPGFDVELSEEAFVSQVNDIKMAIIGQTGNLTPADKKLYALRDVTATVNSIPLI?180
IDKLEAFPGFDVELSEEAFVSQVNDIKMAIIGQTGNLTPADKKLYALRDVTATVNSIPLI
Sbjct：121 IDKLEAFPGFDVELSEEAFVSQVNDIKMAIIGQTGNLTPADKKLYALRDVTATVNSIPLI?180
Query：181 ASSIMSKKIAAGADSIVLDVKTGSGAFMKSFEDAKALATEMVSIGKSVNRKTVAIITDMD?240
ASSIMSKKIAAGADSIVLDVKTGSGAFMKSFEDAKALATEMVSIGKSVNRKT+A+ITDMD
Sbjct：181 ASSIMSKKIAAGADSIVLDVKTGSGAFMKSFEDAKALATEMVSIGKSVNRKTIAVITDMD?240
Query：241 QPLGFEIGNANEVKEAIEVLQGKDVRDLKVIALTIASHMAVLGDFYPTFDEAYADLETRL?300
QPLG?EIGNANEVKEAIEVLQGKDVRDLKVIALTIASHMAVLG+FYPTFDEAYADLETRL
Sbjct：241 QPLGNEIGNANEVKEAIEVLQGKDVRDLKVIALTIASHMAVLGEFYPTFDEAYADLETRL?300
Query：301 GNGAALDVFKKFIAAQGGDASLVDDMTKALETKYEKTFVASKAGYVSEIIADEVGVAAMI?360
NGAALDVFKKFIAAQGGDASLVDDMTKALETK+EK?FVASKAGYVSEIIADEVGVAAMI
Sbjct：301 ANGAALDVFKKFIAAQGGDASLVDDMTKALETKFEKDFVASKAGYVSEIIADEVGVAAMI?360
Query：361 LGAGRVTKADEIDHAASVTLHKKVGDRVEVGDVIATLRSNKDTLDQAIEKMDHAYHISET?420
LGAGR?TK?D?IDHAASVTL?KKVGD+VEVGDVIATLRSNK+TLDQAIEKMDHAYHISET
Sbjct：361 LGAGRATKTDVIDHAASVTLFKKVGDKVEVGDVIATLRSNKETLDQAIEKMDHAYHISET?420
Query：421 KPEARPLVHAVIQ?433
KPEARPLVHAVIQ
Sbjct：421 KPEARPLVHAVIQ?433
Wherein, Query is the aminoacid sequence of clone's Exiguobacterium sp.MY02 bacterial strain pyrimidine nucleoside phosphorylase gene supposition; Sbjct is the aminoacid sequence that the pyrimidine nucleoside phosphorylase gene of Exiguobacterium sp.255-15 bacterial strain is inferred; Identical amino acid is with letter representation.
Above-mentionedly show that relatively the similarity of two aminoacid sequences is 95% (415/433), show that the coded aminoacid sequence of Exiguobacterium sp.MY02 bacterial strain pyrimidine nucleoside phosphorylase gene is different from the coded aminoacid sequence of pyrimidine nucleoside phosphorylase gene that Sbjct is an Exiguobacterium sp.255-15 bacterial strain.
Said structure gene and expression vector are connected to form recombinant vectors, transformed acceptor cell, behind the abduction delivering, the purification of Recombinant pyrimidine-nucleoside phosphorylase, recombinant protein molecular weight in the polyacrylamide denaturing gel electrophoresis of finding this genetic expression is approximately 46kD, conforms to theoretical guess value.
Pyrimidine-nucleoside phosphorylase is the key enzyme in the pyrimidine nucleoside salvage metabolic pathway.In the presence of ortho-phosphoric acid, this fermentoid reversibly catalysis pyrimidine nucleoside phosphorylase turns to free base and ribose-1-phosphoric acid, the source of the pyrimidine bases during these degraded products are synthesized as carbon source, the energy and nucleic acid by organism.Pyrimidine-nucleoside phosphorylase is contained in minority Institute of Micro-biology can show as transferase active, as: can be substrate with 5 FU 5 fluorouracil, uridine and phosphate buffered saline buffer etc., by the synthetic compound 5-floxuridine of single step reaction method catalysis with strong antitumour activity.Therefore, the pyrimidine-nucleoside phosphorylase with transferase active has higher potential using value.
Pyrimidine nucleoside phosphorylase gene provided by the present invention, the transferase active height of coded pyrimidine-nucleoside phosphorylase, value with industrial applications can remedy the not high deficiency of transferase active of the coded pyrimidine-nucleoside phosphorylase of existing isoformgene.
Description of drawings
Accompanying drawing 1 is the DNA band of the pyrimidine nucleoside phosphorylase gene of said 1.3kb in the described step of claim 3 (2);
Accompanying drawing 2 is the reorganization pyrimidine-nucleoside phosphorylase of the single band of the coded about 36kD size of said Exiguobacterium sp.MY02 bacterial strain pyrimidine nucleoside phosphorylase gene in the described step of claim 3 (11);
The image that accompanying drawing 3 is scanned into for said result in the described step of claim 4 (2), wherein " 1 " swimming lane is the tomographic results of the standard substance of uridylic, " 2 " swimming lane is the tomographic results of said control group, and " 3 " swimming lane is the said tomographic results that has added the reaction system of reorganization pyrimidine-nucleoside phosphorylase;
The image that accompanying drawing 4 is scanned into for said result in the described step of claim 4 (4), wherein " 1 " swimming lane is the tomographic results of 5 FU 5 fluorouracil standard substance, " 2 " swimming lane is the tomographic results of uridylic standard substance, " 3 " swimming lane is the tomographic results of 5-floxuridine standard substance, " 4 " swimming lane is the tomographic results of uridine standard substance, " 5 " swimming lane is the tomographic results of said control group, and " 6 " swimming lane is the said tomographic results that has added the reaction system of reorganization pyrimidine-nucleoside phosphorylase.
Embodiment
Following examples will help those of ordinary skill in the art further to understand the present invention, but not limit the present invention in any form.
Embodiment 1: the clone of pyrimidine nucleoside phosphorylase gene and order-checking
Screen by the genome dna library of round pcr Exiguobacterium sp.MY02 bacterial strain, the pyrimidine nucleoside phosphorylase gene that the clone is unknown, concrete operations are: containing the NaCl concentration expressed in percentage by weight is to cultivate Exiguobacterium sp.MY02 in 1% Luria-Bertani (LB) substratum to logarithm latter stage, extracts genomic dna.Use Sau3A I that this genomic dna is carried out enzyme and cut, agarose gel electrophoresis reclaims the segment of 5～8kb, and is connected with BamH I complete degestion and through the pUC18 plasmid fragment of dephosphorylation processing.To connect product then and change in the competent cell of bacillus coli DH 5 alpha, and go up at LB solid medium (containing penbritin, X-gal, IPTG) and cultivate according to the Calcium Chloride Method of standard.Picking hickie reorganization bacterium colony, after in LB liquid nutrient medium (containing penbritin), cultivating, corresponding each hickie bacterium colony is numbered, get 1 μ L bacterium liquid respectively and carry out the PCR reaction as template, use specific primer to UpperA (5 ' ATGCGTATGGTAGATTTGAT 3 ') and LowerA (5 ' TTATTGAATGACAGCGTGGA 3 '), condition is: 94 ℃ of pre-sex change 2min, carry out 35 circulations with 94 ℃ of 30s, 60 ℃ of 30s, 72 ℃ of 90s subsequently, and extend 10min at 72 ℃ at last.The product of PCR reaction shows a specific band through agarose gel electrophoresis at the 1.3kb place.Then determine to contain the positive transformant of pyrimidine nucleoside phosphorylase gene gene according to above-mentioned numbering.A large amount of cultivation positive transformants also use standard alkaline lysis method of extracting recombinant plasmid, the terminal cessation method order-checking of the two deoxidations of Sanger.Final by bioinformatic analysis, determine the wherein nucleotide sequence of the pyrimidine nucleoside phosphorylase gene of the Exiguobacterium sp.MY02 bacterial strain of existence, sequence total length 1302bp encodes one and contains 433 amino acid whose protein sequences.
Embodiment 2: the structure of coli expression carrier
According to resulting pyrimidine nucleoside phosphorylase gene sequences Design upstream primer (5 ' GCACCATGGTAA TGCGTATGGTAGATTTG3 ') and downstream primer (5 ' CCGTCTAGAAATTGAATGACAGCGTGGAC '), obtain the pyrimidine nucleoside phosphorylase gene complete sequence by pcr amplification.The condition of this PCR is: 94 ℃ of pre-sex change 2min, carry out 30 circulations with 94 ℃ of 30s, 60 ℃ of 30s, 72 ℃ of 90s subsequently, and extend 10min at 72 ℃ at last.Agarose gel electrophoresis shows that there is a specific band at the 1.3kb place, and it is downcut from sepharose, cuts with Nco I and Xba I enzyme, reclaims the dna segment of 1.3kb behind the agarose gel electrophoresis.
Coli expression carrier pBAD gIII/A is cut with Nco I and Xba I enzyme equally, agarose electrophoresis is separated, reclaim the dna fragmentation of 4.1kb, after its dna fragmentation with above-mentioned gained 1.3kp is connected, Calcium Chloride Method according to standard changes in the bacillus coli DH 5 alpha, and screening has the transformant of amicillin resistance.Alkaline lysis method of extracting plasmid with standard, cut through NcoI and Xba I enzyme and to obtain 1.3kb and two fragments of 4.1kb, identical with pyrimidine nucleoside phosphorylase gene respectively with expression vector pBADgIII/A size, proof pyrimidine nucleoside phosphorylase gene pynp has been cloned among the expression vector pBAD gIII/A, with this recombinant plasmid called after pPNP-A.
Embodiment 3: the structure that can efficiently express the colibacillus engineering strain of pyrimidine-nucleoside phosphorylase
Expression vector pPNP-A is changed among the intestinal bacteria Top10F ' according to the Calcium Chloride Method of standard, and screening has the transformant of amicillin resistance.Alkaline lysis method of extracting plasmid with standard, cut through NcoI and Xba I enzyme and to obtain 1.3kb and two fragments of 4.1kb, identical with pyrimidine nucleoside phosphorylase gene respectively with expression vector pBAD gIII/A size, prove the intestinal bacteria recombinant strain pLyase-A/Top10F ' that has obtained to efficiently express pyrimidine-nucleoside phosphorylase.
Embodiment 4: utilize intestinal bacteria recombinant strain production reorganization pyrimidine-nucleoside phosphorylase
Picking intestinal bacteria recombinant strain pPNP-A/Top10F ' mono-clonal is seeded in the liquid LB substratum that 2mL contains 100 μ g/mL penbritins, and 37 ℃ of 200r/min shaking culture are spent the night.By being seeded at 1: 50 in the liquid LB substratum that 100mL contains 100 μ g/mL penbritins, 37 ℃ of 200r/min shaking culture are to OD
600Be 0.6, add L-arabinose to final concentration and be between the 0.5-2.0mmol/L, continue to cultivate 3h, 4 ℃ of centrifugal 30min of 5000 * g collect thalline, are resuspended in 12mL binding buffer liquid (20mmol/L phosphate buffered saline buffer, pH7.8/0.5mol/L NaCl).In ultrasonication cell 15min on ice, every effect 10s suspends 10s with bacteria suspension.The centrifugal 30min of 4 ℃ of 12000 * g remove cell debriss, and supernatant liquor is through 0.22 μ m filtering with microporous membrane, the PreBondTM column on the filtrate behind the damping fluid pre-equilibration (Invitrogen commodity).Wash pillar to elutant OD with binding buffer liquid and dcq buffer liquid (20mmol/L phosphate buffered saline buffer, pH7.8/0.5mol/L NaCl)
280＜0.01, last is that the damping fluid (20mmol/L phosphate buffered saline buffer/0.5mol/L NaCl) of 6,4 equivalences carries out wash-out with 5mL pH successively, and SDS-PAGE detects that albumen distributes in the elutriant, and merging contains the elutriant of single purpose band.Measure target protein concentration with standard Lowry method, frozen after the packing in-80 ℃.
Embodiment 5 utilizes the reorganization pyrimidine-nucleoside phosphorylase to produce the 5-floxuridine
In containers such as glass test tube, when phosphate concn is 15-40mmol/L, uridine/5 FU 5 fluorouracil ratio is between 2.4-3.1 the time, add the foregoing description 4 resulting reorganization pyrimidine-nucleoside phosphorylase preparations to final concentration 0.1-10 μ g/mL, 3-12h under 50-65 ℃ of environment reaction, detect and carry out computational analysis by the high performance liquid phase instrument, the maximum output of conversion reaction resultant 5-floxuridine is 68%.
Claims (7)
1, a kind of pyrimidine nucleoside phosphorylase gene is characterized in that it is the structure gene of Exiguobacterium sp.MY02 bacterial strain pyrimidine-nucleoside phosphorylase, and nucleotides sequence is classified as:
1 atgcgtatgg?tagatttgat?tgcaacaaaa?cgagacggtg?gcgaactcgc?aacagctgat?60
61 attcaagcaa?tggtagaagg?attcacgaat?ggtgagattc?cagattacca?aatgtcagcg?120
121 atgtcgatgg?cgattttcta?tcaaggaatg?tcagatcgtg?aaatcgctga?tttgacgatg?180
181 gcgatggtca?actcgggcga?cgtgatcgac?ctttcacgta?tccacggtaa?aaaagtcgat?240
241 aaacgctcga?caggcggtgt?tggtgacaag?atcagtctga?tcgtcgcacc?gctcgttgcg?300
301 tcaatcggca?ttccggttgc?gaagatgagc?ggtcgtggac?tcggtcatac?aggtggaacc?360
361 atcgacaaac?tcgaagcgtt?ccctggtttt?gacgtcgagc?tttctgaaga?agcgttcgtc?420
421 tcacaagtca?acgacatcaa?gatggcgatc?atcggtcaaa?cgggtaacct?gacgcctgca?480
481 gacaaaaaac?tctacgcatt?acgtgacgtc?acggcgacgg?tcaactcgat?cccattgatc?540
541 gcaagttcaa?tcatgtcgaa?aaaaatcgca?gcaggagcag?acagcatcgt?actcgacgtc?600
601 aagacaggtt?ctggtgcctt?catgaaatcg?tttgaagatg?caaaagcact?cgcgacagag?660
661 atggtttcaa?tcggtaagag?tgtcaaccgt?aagacggttg?ctatcattac?agacatggat?720
721 cagccgctcg?gctttgaaat?cggaaacgca?aacgaagtca?aggaagcgat?cgaagtcctt?780
781 caagggaaag?atgtccgtga?cttgaaagtc?atcgccttga?cgattgcatc?acacatggcg?840
841 gtcctcggtg?atttctaccc?gacattcgac?gaagcatatg?cggatctcga?aacacgtctc?900
901 ggtaacggag?cagcacttga?cgtcttcaag?aagttcatcg?cagcgcaagg?tggcgacgcg?960
961 tcactcgttg?acgatatgac?aaaagcactt?gaaacgaaat?acgaaaaaac?attcgtcgct?1020
1021?tcaaaagcag?gttatgtctc?tgaaatcatc?gctgacgaag?tcggtgttgc?agcaatgatc?1080
1081?ctcggtgcag?gacgcgtgac?gaaagcagat?gagatcgatc?acgcagcaag?cgttacgctg?1140
1141?cacaagaaag?tcggcgatcg?tgtcgaagtc?ggtgatgtca?tcgcaacact?tcgttcaaac?1200
1201?aaagatacac?tcgatcaagc?aatcgaaaaa?atggatcacg?cgtaccacat?cagtgaaacg?1260
1261?aaaccggaag?cacgtccgct?cgtccacgct?gtcattcaat?aa 1302
" pyrimidine nucleoside phosphorylase gene " length overall 1302bp of Exiguobacterium sp.MY02 bacterial strain, judge according to procaryotic gene expression characteristics, preceding 3 characters " atg " are the initiator codons of this gene, calculate successively according to the triplet code rule, last 3 characters " taa " are the terminator codons of this gene.
2, the preparation method of the described pyrimidine nucleoside phosphorylase gene of claim 1 is characterized in that taking following steps:
(1) for cloning the pyrimidine nucleoside phosphorylase gene that obtains unknown Exiguobacterium sp.MY02 bacterial strain, this bacterial strain is cultivated in containing Luria-Bertani (LB) substratum that NaCl 0.1-0.2mol/L and extractum carnis weight concentration are 0.5-1.0%, temperature is 18-37 ℃, shakes with the speed of 100-150r/min to be cultured to the exponential growth later stage;
(2) according to the centrifugal thalline that obtains of ordinary method, working concentration is that 10mmol/L, pH value are 8.0 the resuspended thalline of Tris-EDTA damping fluid, wash 2 times after, use the resuspended thalline of this damping fluid equally and place 4 ℃, time 6-8h;
(3) continuing to add N,O-Diacetylmuramidase to final concentration is 10-150mg/mL, and the concussion mixing, 37 ℃ of incubation 1-6h;
(4) continue to be equipped with the high molecular genomic dna, detect purity, its OD through UV spectrum according to conventional SDS-phenol legal system
260/ OD
280Ratio should be greater than 1.8;
(5) continuing with the high molecular genomic dna is material, use restriction endonuclease Sau3A I to cut at 37 ℃ of incomplete enzymes that carry out 30-120min, the weight percent of total DNA after enzyme is cut through containing the pyridine of bromination second is 0.8% agarose gel electrophoresis, finding molecular weight under ultraviolet lamp is the product zone of 5-10kb, use blade to cut out the gel in this product zone, reclaim dna segment wherein;
(6) handle the multiple clone site of commercial artificial cloning vector pUC18 with restriction endonuclease BamH I under aseptic condition, its complete degestion is linear, and dephosphorylation is handled;
(7) dna segment that reclaims is mixed with linear carrier, add the T4DNA ligase enzyme and connect 10-14h at 16 ℃, form recombinant plasmid and transformed competence colibacillus bacterial cell, obtain the genome dna library of Exiguobacterium sp.MY02 bacterial strain, the preferred intestinal bacteria of said competence bacterial cell, said conversion, conversion method preferably shocks by electricity;
(8) use penbritin concentration to cultivate mono-clonal in the said gene group DNA library respectively as the Luria-Bertani liquid nutrient medium of 100mg/mL, temperature is 37 ℃, speed concussion with 100-150r/min is cultured to the exponential growth later stage, be template with each monoclonal 1 μ L bacterium liquid respectively, use the degenerated primer of conjecture property to carry out conventional pcr amplification, primer sequence is as follows:
5’-GGYGTKCCAGTKGCSAAGATG-3’
5’-GAASGCRCCSGCGACCSGTCTT-3
Carry out conventional pcr amplification reaction, PCR reaction system and the mono-clonal reference numeral that is used as template, wherein the condition of PCR reaction is:
94 ℃ of pre-sex change 2min carry out 35 circulations with 94 ℃ of 30s, 55-63 ℃ 30s, 72 ℃ of 30s subsequently, extend 10min at 72 ℃ at last;
(9) weight percent that the product of above-mentioned different PCR reaction is contained the pyridine of bromination second respectively is 1.5% agarose gel electrophoresis, determine the PCR reaction system of the about 400bp of product size in electrophoresis result, determine to be used as the mono-clonal of this PCR reaction system template according to the described reference numeral of step (8), think and contain pyrimidine nucleoside phosphorylase gene in this monoclonal recombinant plasmid, measure the nucleotide sequence of foreign gene;
(10) by using BLAST software, information in resulting gene order of aforesaid method and the biometric database is carried out gene and the comparison of proteinic homology, the pyrimidine nucleoside phosphorylase gene that preliminary judgement wherein exists, the database of the preferred U.S. in said biological data storehouse.
3, as the preparation method of claim 2 described pyrimidine nucleoside phosphorylase genes, it is characterized in that after said preliminary judgement wherein exists in the step (10) the pyrimidine nucleoside phosphorylase gene, continue to take following steps to have the function of coding pyrimidine-nucleoside phosphorylase to confirm this gene:
(1) according to a pair of primer of two ends sequences Design of this gene, comprising the restriction endonuclease recognition site identical with next step, be that template is carried out conventional pcr amplification with former reorganization plasmid, the sequence of primer is as follows:
5 ' GCA
CCATGGTAA TGCGTATGGTAGATTTG3 ' (drawing the horizontal line place is the restriction enzyme site of Nco I)
5 ' CCG
TCTAGAAATTGAATGACAGC GTGGAC ' 3 ' (drawing the horizontal line place is the restriction enzyme site of Xba I)
The reaction conditions of PCR is: 94 ℃ of pre-sex change 2min, carry out 35 circulations with 94 ℃ of 30s, 55-63 ℃ 30s, 72 ℃ of 90s subsequently, and extend 10min at 72 ℃ at last;
(2) take out the PCR reaction product, after the weight percent through containing the pyridine of bromination second was the 0.6-1.5% agarose gel electrophoresis, the DNA that cuts the about 1.3kb of size that pcr amplification produced with blade under ultraviolet lamp was with, and carried out DNA and reclaimed;
(3) DNA that recovery is obtained uses Nco I and Xba I at 37 ℃ of complete degestions, and 65 ℃ of heating bath 10-15min finish reaction, the centrifugal 2min of 12,000 * g; Handle pBAD gIII/A carrier with quadrat method;
(4) with above-mentioned DNA and pBAD g III/A vector construction recombinant clone plasmid, its reaction system is: the DNA 15 μ L of recovery, pMD18-T carrier 0.5 μ L, T4DNA ligase enzyme 1-2 μ L, cumulative volume 30 μ L; Reaction system at 16 ℃ of reaction 2-16h, is formed recombinant plasmid;
(5) with recombinant plasmid transformed competence colibacillus intestinal bacteria Top 10F ', said recombinant plasmid is selected 10 μ L for use, and said competence intestinal bacteria are selected 50-150 μ L for use;
(6) converted product that step (5) is obtained is coated on the LB solid medium that contains penbritin 50-100 μ g/mL and cultivates 15-24h, select single bacterium colony, in containing the LB liquid nutrient medium of same concentrations penbritin, cultivate 12-24h, through alkaline lysis method of extracting recombinant plasmid wherein;
(7) use restriction endonuclease Nco I to cut recombinant plasmid 1.0-4h at 37 ℃ of enzymes, 65 ℃ of heating bath 10-15min finish reaction, weight percent through containing the pyridine of bromination second is the 0.6-1.5% agarose gel electrophoresis, the discovery enzyme is cut product only the DNA band of 1 size greater than 5kb, illustrates that pyrimidine nucleoside phosphorylase gene has correctly inserted the downstream of pectinose inducible promoter in this recombinant plasmid;
(8) the intestinal bacteria Top10F ' that will contain above-mentioned recombinant plasmid cultivates in the LB liquid nutrient medium, and shaking culture is to OD under 37 ℃ of environment
600Be 0.6, add L-arabinose to final concentration and be between the 0.5-2.0mmol/L, continue to cultivate 3h, 4 ℃ of centrifugal 30min of 5000 * g collect thalline, are resuspended in 12mL binding buffer liquid (20mmol/L phosphate buffered saline buffer, pH 7.8/0.5M NaCl);
(9) with above-mentioned bacterium liquid ultrasonication 15min under the ice bath environment, every effect 10s suspends 10s;
(10) the centrifugal 30min of 12000 * g removes cell debris under 4 ℃ of environment, and supernatant liquor is through 0.22 μ m filtering with microporous membrane, the Ni ion affinity chromatography post on the filtrate behind the damping fluid pre-equilibration, the preferred Invitrogen of said Ni ion affinity chromatography post company product;
(11) wash pillar to elutant OD with binding buffer liquid and dcq buffer liquid (20mmol/L phosphate buffered saline buffer, pH7.8/0.5M NaCl)
280＜0.01, last is that 5mL and pH value are respectively 4～6 damping fluid (20mmol/L phosphate buffered saline buffer/0.5M NaCl) and carry out wash-out with volume successively, the protein that SDS-PAGE detects in the elutriant distributes, merge the elutriant of the single protein band that contains the about 46kD of molecular weight, think that this protein is the coded reorganization pyrimidine-nucleoside phosphorylase of above-mentioned pyrimidine nucleoside phosphorylase gene;
(12) measure the protein concn of above-mentioned reorganization pyrimidine-nucleoside phosphorylase preparation with standard Lowry method, frozen after the packing in-80 ℃.
4, the preparation method of pyrimidine nucleoside phosphorylase gene as claimed in claim 3, it is characterized in that after the protein concn of the said definite reorganization pyrimidine-nucleoside phosphorylase preparation of step (12), continue to take following steps to measure the phosphorylation activity and the transferase active of the coded reorganization pyrimidine-nucleoside phosphorylase of above-mentioned pyrimidine nucleoside phosphorylase gene:
(1) in dry sterile chamber, in potassium phosphate salt concentration is that 25-40mmol/L, beta-mercaptoethanol concentration are that 5mmol/L, EDTA concentration are that 1-10mmol/L, uridine concentration are in the mixed solution reaction system of 10-100mmol/L, add above-mentioned reorganization pyrimidine-nucleoside phosphorylase preparation to final concentration 0.1-20 μ g/mL, 3-12h under 37-60 ℃ of environment reaction, the HCl that adds 1mol/L is to final concentration 0.1mol/L termination reaction; Under the same operation condition, the reaction system that does not add above-mentioned recombinase preparation is a control group;
(2) reaction solution is put on the GF254 silica-gel plate, launch with methylene dichloride/tetrahydrofuran solvent system, the spot of detection compound under the 254nm UV-light, the result is scanned into image and analyzes, show that considerable change has taken place the substrate uridine in the above-mentioned reaction system that has added the reorganization pyrimidine-nucleoside phosphorylase, and produced new compound uridylic, and the substrate in the control group is without any considerable change; Think that this is the exercising result of the phosphorylation activity of reorganization pyrimidine-nucleoside phosphorylase;
(3) in dry sterile chamber, when potassium phosphate salt concentration is 15-40mmol/L, uridine/when 5 FU 5 fluorouracil ratio is 2.4-3.1, add above-mentioned reorganization pyrimidine-nucleoside phosphorylase preparation to final concentration 0.1-10 μ g/mL, 3-12h under 50-65 ℃ of environment reaction; The HCl that adds 1mol/L is to final concentration 0.1mol/L termination reaction; Under the same operation condition, the reaction system that does not add above-mentioned recombinase preparation is a control group;
(4) reaction solution is put on the GF254 silica-gel plate, launch with methylene dichloride/tetrahydrofuran solvent system, the spot of detection compound under the 254nm UV-light, the result carries out computational analysis after being scanned into image, show that substrate 5 FU 5 fluorouracil and uridine in the above-mentioned reaction system that has added the reorganization pyrimidine-nucleoside phosphorylase have been generated 5-floxuridine and uridylic by the part conversion, and control group thinks that without any considerable change this is the exercising result of the transferase active of reorganization pyrimidine-nucleoside phosphorylase.
5, the described bacterium Exiguobacterium of claim 1 sp.MY02 bacterial strain is characterized in that being collected by China Committee for Culture Collection of Microorganisms common micro-organisms center on October 8th, 2005, and deposit number is: CGMCC No.1473.
6, the preparation method of pyrimidine nucleoside phosphorylase gene as claimed in claim 2, it is characterized in that in the step (4), high molecular genomic dna with the Exiguobacterium sp.MY02 bacterial strain of conventional SDS-phenol method preparation, detect through agarose gel electrophoresis, whether prepared genomic dna molecular weight is more than or equal to 21kb, if more than or equal to 21kb then enter next step, otherwise should prepare DNA again, until more than or equal to 21kb.
7, the preparation method of the pyrimidine nucleoside phosphorylase gene described in claim 2, the database that it is characterized in that the said U.S. in the step (10) is GenBank.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNB2005100218290A CN100363493C (en) | 2005-10-09 | 2005-10-09 | Exiguobacterium sp. MY02 strain pyrimidine nucleoside phosphorylase gene and its preparation method |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNB2005100218290A CN100363493C (en) | 2005-10-09 | 2005-10-09 | Exiguobacterium sp. MY02 strain pyrimidine nucleoside phosphorylase gene and its preparation method |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN1800409A true CN1800409A (en) | 2006-07-12 |
| CN100363493C CN100363493C (en) | 2008-01-23 |
Family
ID=36810619
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CNB2005100218290A Expired - Fee Related CN100363493C (en) | 2005-10-09 | 2005-10-09 | Exiguobacterium sp. MY02 strain pyrimidine nucleoside phosphorylase gene and its preparation method |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN100363493C (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103509837A (en) * | 2012-06-28 | 2014-01-15 | 张金荣 | Method for preparing capecitabine intermediate 2', 3'-di-O-acetyl-5'-deoxy-5-fluorocytidine by enzymatic composite chemical method |
| CN111471621A (en) * | 2020-04-20 | 2020-07-31 | 河北萌帮水溶肥料股份有限公司 | Microbacterium MB338 and application thereof |
-
2005
- 2005-10-09 CN CNB2005100218290A patent/CN100363493C/en not_active Expired - Fee Related
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103509837A (en) * | 2012-06-28 | 2014-01-15 | 张金荣 | Method for preparing capecitabine intermediate 2', 3'-di-O-acetyl-5'-deoxy-5-fluorocytidine by enzymatic composite chemical method |
| CN103509837B (en) * | 2012-06-28 | 2016-03-09 | 张金荣 | A kind of enzyme process composite chemical legal system is for capecitabine intermediate 2 ', 3 '-two-O-ethanoyl-5 'the method of-deoxidation-5-fluorine cytidine |
| CN111471621A (en) * | 2020-04-20 | 2020-07-31 | 河北萌帮水溶肥料股份有限公司 | Microbacterium MB338 and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN100363493C (en) | 2008-01-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN1229500C (en) | Alkaline cellulase and method for producing same | |
| CN105441403B (en) | Transaminase for producing C4H9NO2 | |
| CN108315288B (en) | Recombinant escherichia coli for expressing formamide enzyme and phosphite dehydrogenase fusion protein and construction method and application thereof | |
| Meng et al. | Enhancement of heterologous protein production in Corynebacterium glutamicum via atmospheric and room temperature plasma mutagenesis and high-throughput screening | |
| CN1699577A (en) | Beta-mannase gene and preparation thereof | |
| CN1244697C (en) | Reforming composite insecticidal crystalline gene Cry2A of bacillus thuringiensis | |
| CN113308453B (en) | Amidohydrolase SaAH, and coding gene and application thereof | |
| WO2022143761A1 (en) | Recombinant strain for producing l-glutamic acid by means of modifying gene bbd29_04920, and construction method and use thereof | |
| CN104212757A (en) | Method for high-efficiently producing L-theanine through production of coli [gamma]-glutamylmethylamine synthetase with escherichia coli | |
| CN1699424A (en) | Heparinase I fusion protein and genes encoding same and expression method thereof | |
| CN1800409A (en) | Exiguobacterium sp. MY02 strain pyrimidine nucleoside phosphorylase gene and its preparation method | |
| CN1884501A (en) | Glutamine synthetase and its dedicated expression engineered bacteria and uses | |
| CN110592109B (en) | Recombinant strain modified by spoT gene and construction method and application thereof | |
| CN109182319B (en) | Threonine deaminase mutant and preparation method and application thereof | |
| CN110592084B (en) | Recombinant strain transformed by rhtA gene promoter, construction method and application thereof | |
| US20240076701A1 (en) | Recombinant strain with modified gene bbd29_14900, and method for constructing the same and use thereof | |
| CN113481233B (en) | Method for constructing ectoin producing strain | |
| WO2022143639A1 (en) | Recombinant strain for producing l-glutamic acid by means of modifying gene bbd29_11265, and construction method and use thereof | |
| CN104130998B (en) | Pseudomonas putida nitrilase mutant strain obtained by site-directed mutagenesis and construction method thereof | |
| WO2022143646A1 (en) | Recombinant strain for producing l-glutamic acid by modifying gene bbd29_09525, and construction method therefor and application thereof | |
| EP3550014B1 (en) | Directed evolution of cyp52a12 gene and its use in dicarboxylic acid production | |
| CN112779200A (en) | Genetically engineered bacterium for high yield of L-methionine and construction and application thereof | |
| CN114990082A (en) | Mutant and construction method and application thereof | |
| EP2254994A1 (en) | Compositions and methods for amino acid biosynthesis | |
| CN105039366A (en) | Codon optimized phosphocholine cytidylyltransferase gene and expression thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| C17 | Cessation of patent right | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20080123 Termination date: 20091109 |