CN1800209A - Mermaid photobacterium envelop protein W and coding sequence , its preparation method and uses - Google Patents
Mermaid photobacterium envelop protein W and coding sequence , its preparation method and uses Download PDFInfo
- Publication number
- CN1800209A CN1800209A CN 200510100211 CN200510100211A CN1800209A CN 1800209 A CN1800209 A CN 1800209A CN 200510100211 CN200510100211 CN 200510100211 CN 200510100211 A CN200510100211 A CN 200510100211A CN 1800209 A CN1800209 A CN 1800209A
- Authority
- CN
- China
- Prior art keywords
- sequence
- protein
- ompw
- polynucleotide
- mermaid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Landscapes
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
The invention provides a new mermaid Photobacterium exosporium protein W, a polypeptide's nucleic acid sequence with mermaid Photobacterium exosporium protein W protein activity, an amino acid sequence with mermaid Photobacterium exosporium protein W and the method for using rebuilding technology to prepare for the mermaid Photobacterium exosporium protein W. It also provides a mermaid Photobacterium exosporium protein W and its code sequence applying.
Description
Technical field
The invention belongs to biological technical field, especially relate to a kind of new coding Mermaid luminous bacillus (Photobacteriumdamsela) outer membrane protein W (outer membrane protein W, OmpW) polynucleotide, and the polypeptide of this polynucleotide encoding, also relate to the preparation method and its usage of these polynucleotide and polypeptide.
Background technology
Bacillus is to study maximum a kind of gram negative bacteriums at present, and gram negative bacterium has very strong adaptability and resistance because of its unique cell wall structure.The gram negative bacterium great majority are conditioned pathogen, can cause multiple infection when immunity of organisms is low, have a lot of diseases to be caused by gram negative bacterium in the mankind and the livestock.Main pathogenic bacillus has dysentery bacterium, Corynebacterium diphtheriae, intestinal bacteria, Bacillus proteus, Pseudomonas aeruginosa, bordetella pertussis etc., and they produce intracellular toxin, by intracellular toxin the people is caused a disease.1996 in Japan the maximum in the world eruption and prevalence that is caused by O157:H7 intestinal bacteria have taken place once.(Escherichia coli) is very wide in distributed in nature for intestinal bacteria, is the normal microflora in the humans and animals enteron aisle.Generally not pathogenic under the normal circumstances, but it is a conditioned pathogen.In recent years, worldwide infectation of bacteria type and bacterial infection have considerable change, originally threaten maximum germ to be replaced by nonpathogenic weak toadstool and conditioned pathogen just gradually to the human life.Mermaid luminous bacillus is exactly this bacterioid of relatively paying attention at present.Mermaid luminous bacillus is a kind of Gram-negative, can be luminous, facultative Bacteroides nodosus, it is 1981 at first, from the ulcer wound of the catfish that warm sea water, grows, be separated to, and classification belongs to Vibrio, be called the mermaid vibrios, because people and animals' illness that it can cause is similar to Vibrio, all can cause human gastroenteritis, wound infection and people and animals' septicemia (CURRENT MICROBIOLOGYVol.48 (2004), pp.167-174 Cloning and Characterization of the Gene Encoding forOMP-PD Porin:The Major Photobacterium damsela Outer Membrane Protein).At comparison and chromosomal DNA-DNA hybridization data based on the 16sRNA gene order in 1991 it is referred to Bacillaceae, be called Mermaid luminous bacillus (Shin JH, Shin MG, Suh SP, Ryang DW, Rew JS, Nolte FS.Primary Vibrio damselasepticemia.Clin Infect Dis 1996; 22:856-857.).It is a kind of bacterium that causes the tissue necrosis transmissible disease of tool extreme damage, and it not only can cause pseudotuberculosis and fish hueppe's disease, causes aquatic products to culture loss more than 50%; Can also the people be caused a disease by people's wound or edible underdone sea-food, infect Mermaid luminous bacillus and serious morbific incident with regard to a lot of fishermen are taken place in Japan.More fearful is, increasing report shows that Mermaid luminous bacillus has strong lethality, can be simultaneously so that immune deficiency or healthy factitious host to be arranged, and bring out fast fulminant infection.(Fraser SL，Purcell BK，Delgado B Jr，Baker AE，Whelen AC.Rapidly fatal infectiondue to Photobacterium(Vibrio)damsela.Clin Infect Dis 1997；25：935-936.)
OmpW is an important albumen in the bacterial outer membrane albumen, at present Vibrio parahaemolyticus (The Lacent only in vibrios
Volume 361, and Issue 93591 March 2003, Pages 743-749 Genome sequence of Vibrioparahaemolyticus:a pathogenic mechanism distinct from that of V cholerae) and vibrio cholerae (Nucleic Acids Res.1990 April 25; 18 (8): 2180.Nucleotide sequence of the gene, ompW, encoding a 22kDa immunogenic outer membrane protein of Vibrio cholerae.) measured the nucleotide sequence of this gene, and its function yet there are no elaboration; In intestinal bacteria, also contain the OmpW gene, think that at present this albumen is a polarity albumen (Mol Microbiol 2004 May; 52 (4) 129-44 Proteomic screening and identification ofdifferentially distributed membrane proteins in Escherichia coli), and be or that the acceptor of colicin is main member (J Bacteriol 1999 Jun 181 (11): 3578-81 Characterization of colicin S4 and itsreceptor of acceptor, OmpW, a minor protein of the Escherichia coli outer membrane).So OmpW is an albumen that merits attention very much and further investigate.The inventor has obtained the OmpW gene order of vibrio alginolyticus, NCBI sequence number: AY944132, and find its tool salt tolerant function in vibrios, applied for national inventing patent.
Shang Weijian has any Mermaid luminous bacillus OmpW nucleotide sequence of mentioning that discloses or reported.Do not see yet and reported that bacillus OmpW albumen had the salt tolerant function.
Summary of the invention
The object of the present invention is to provide a kind of new Mermaid photobacterium envelop protein W.
Another object of the present invention provides the nucleotide sequence that a kind of coding has the polypeptide of Mermaid photobacterium envelop protein W protein active.
The 3rd purpose of the present invention provides a kind of method of utilizing recombinant technology to prepare above-mentioned new Mermaid photobacterium envelop protein W.
The present invention also provides the application of this Mermaid photobacterium envelop protein W and encoding sequence, and this proteic a kind of new function promptly is provided, i.e. salt tolerant function is in the application that improves biomass cells salt tolerance.
The said Mermaid photobacterium envelop protein W of the present invention is characterized in that: this polypeptide contains the aminoacid sequence of SEQ ID NO.4,
The aminoacid sequence of above-mentioned Mermaid photobacterium envelop protein W is shown in SEQ ID NO.4, and its relevant information is:
(i) sequence signature:
(A) length: 213 amino acid
(B) type: amino acid
(C) chain: strand
(D) topological framework: linearity
(ii). molecule type: polypeptide
(iii). sequence description:
1 MKKTICSLAV VAALVSPSVF AHKQGDFVLR VGAASVVPND SSDKILGSQE ELKVDSNTQL
61 GLTFGYMFTD NISLELLAAT PFSHDISTDL VGSDIADTKH LPPTLMVQYY FGEPQSKFRP
121 YVGAGLNYTI FFDEGFNSTG KGAGLSDLKL DDSFGLAANV GADYMINDQW FLNASAWYAN
181 IETEATYKAG GAKQKTDVKI NPWVFMISGG YKF-。
The said isolating polynucleotide of the present invention, it is characterized in that: it comprises a nucleotide sequence, and this nucleotide sequence is selected from down group: (a) coding contains the polynucleotide of polypeptide of the aminoacid sequence of SEQ ID NO.4; (b) with polynucleotide (a) complementary polynucleotide.
Above-mentioned polynucleotide encoding has the polypeptide of aminoacid sequence shown in the SEQ ID NO.4.
The sequence of above-mentioned polynucleotide is selected from coding region sequence or the full length sequence of SEQ ID NO.3, and its relevant information is:
(i) sequence signature:
(A) length: 642bp
(B) type: Nucleotide
(C) chain: strand
(D) topological framework: linearity
(ii). molecule type: Nucleotide
(iii). sequence description: SEQ ID NO.3
atgaaaaaaa caatctgcag tctagcagtg gttgctgcac tcgtgtcacc aagtgttttc 60
gctcataaac aaggtgactt cgttcttcgt gttggtgcgg cgtctgtcgt tccaaatgac 120
agcagcgata agattcttgg ttctcaagaa gaattgaaag tggattcaaa tacgcagctt 180
ggtttgacgt ttggctacat gttcacagac aacatcagcc tagagcttct agcagcaaca 240
ccattcagcc acgatatttc tactgattta gtcggtagtg acatcgcgga caccaaacac 300
cttccaccaa cgcttatggt tcagtactac tttggcgagc cacaaagtaa gttccgtcca 360
tacgttggtg caggtctcaa ctacaccatc ttttttgatg aaggctttaa cagcacaggt 420
aaaggcgctg gtttgtcaga cttgaaatta gatgattcat ttggtttagc agcaaacgta 480
ggtgcggact acatgatcaa cgatcaatgg ttccttaacg catcagcgtg gtatgcaaac 540
attgaaacag aagcaactta caaagcaggt ggagcgaagc aaaaaaccga cgtcaaaatt 600
aacccttggg tatttatgat cagcggcggt tacaagttct aa 642
The preparation method of the said Mermaid photobacterium envelop protein W of the present invention, its step is as follows:
(1) nucleotide sequence that coding is had a Mermaid luminous bacillus OmpW protein active polypeptide operationally is connected in expression regulation sequence, forms Mermaid luminous bacillus OmpW protein expression vector;
(2) change the expression vector in the step (1) over to host cell, form the proteic reconstitution cell of Mermaid luminous bacillus OmpW;
(3) be fit to express under the condition of Mermaid luminous bacillus OmpW protein polypeptide, the reconstitution cell in the culturing step (2) is expressed target product;
(4) separation and purification has the polypeptide of Mermaid luminous bacillus OmpW protein-active.
The present invention and Mermaid luminous bacillus OmpW protein polypeptide specificity bonded antibody are polyclonal antibody.
Said " isolating ", " purifying " DNA are meant, this DNA or fragment are separated from the sequence that is arranged in its both sides under native state, also refer to this DNA or fragment with native state under the component of the nucleic acid followed separate, and separate with the protein of in cell, following it.
Said in the present invention carrier can be selected various carrier known in the art for use, and the carrier as commercially available comprises plasmid, clay etc.When producing Mermaid luminous bacillus OmpW polypeptide of the present invention, Mermaid luminous bacillus OmpW encoding sequence operationally can be connected in expression regulation sequence, thereby form Mermaid luminous bacillus OmpW protein expression vector.
Said " operationally being connected in " refers to a kind of like this situation, and promptly some part of linear DNA sequence can influence the activity of same other parts of linear DNA sequence.For example, if signal peptide DNA as precursor expression and participate in the secretion of polypeptide, signal peptide (secretion leader sequence) DNA operationally is connected in polypeptid DNA so; If transcribing of promotor control sequence, it is operationally to be connected in encoding sequence so; When if ribosome bind site is placed in the position that can make its translation, it is operationally to be connected in encoding sequence so.Generally, " operationally being connected in " means adjacent, then means in reading frame adjacent for the secretion leader sequence.
Said " host cell " is prokaryotic cell prokaryocyte.Prokaryotic host cell commonly used is intestinal bacteria (E.coli) or subtilis etc., preferred E.coli DH5 α; E.coli BL21 and E.coli TOP10 etc.
Can also analyze the expression of Mermaid luminous bacillus OmpW gene product with the Western engram analysis of Mermaid luminous bacillus OmpW specific antibody, and confirm its expression in biological specimen.
In addition, according to Mermaid luminous bacillus OmpW nucleotide sequence of the present invention and aminoacid sequence, can be on the homology basis of nucleic acid homology or marking protein, screening Mermaid luminous bacillus OmpW homologous gene or homologous protein.
In addition, proteic salt tolerant function of Mermaid luminous bacillus OmpW according to the present invention and molecular weight can screen Mermaid luminous bacillus OmpW homologous gene or homologous protein under different salinity.
Mermaid luminous bacillus OmpW Nucleotide full length sequence of the present invention or its fragment can use pcr amplification method, recombination method or library screening method to obtain usually.For the pcr amplification method, can be disclosed according to the present invention relevant nucleotide sequence design primer, and with Mermaid luminous bacillus as template, amplification and must be about sequence.
In case obtained relevant sequence, just can obtain relevant sequence in large quantity with recombination method.This normally is cloned into carrier with it, changes cell again over to, separates obtaining relevant sequence then from the host cell after the propagation by ordinary method.
In addition, also the method for available artificial chemosynthesis is synthesized relevant sequence.Before the application, prior art fully can be by first synthetic a plurality of polynucleotide small segments, and then connect and obtain the proteic nucleotide sequence of code book invention Mermaid luminous bacillus OmpW.Then, can be with in various existing dna moleculars (as carrier) and the cell in this nucleotide sequence introducing this area.In addition, also can will suddenly change and introduce in the protein sequence of the present invention by chemosynthesis.
Description of drawings
Fig. 1 is that Mermaid luminous bacillus outer membrane protein SDS-PAGE collection of illustrative plates compares under the different salinity condition.In Fig. 1,1-4 represents that respectively salinity is 0.5%, 1%, 4%, and M represents mark, and KDa represents the size of molecular weight.
Fig. 2 is under different salinity condition (0.5%, 1% and 4%), and Mermaid luminous bacillus outer membrane protein two-dimensional electrophoresis collection of illustrative plates relatively.
Fig. 3 is the abduction delivering of PET-OmpW clone in E.coli BL21.In Fig. 3,2 is the band of expression of institute's cloned genes; 1 is the band of empty carrier.
Fig. 4 identifies for the double digestion of PLLP-OmpA-OmpW clone.In Fig. 4,1,2 expression contrasts, 3,4 is that goal gene is two cuts, mark, unit is Kb.
Embodiment
Below in conjunction with specific embodiment, further set forth the present invention.Should be understood that these embodiment only to be used to the present invention is described and be not used in and limit the scope of the invention.The experimental technique of unreceipted actual conditions in the following example, usually according to normal condition, the condition described in the Sambrook equimolecular cloning experimentation chamber handbook (2001by Cold Spring Harbor Laboratory Press) for example, or the condition of advising according to manufacturer.
The clone of embodiment 1 Mermaid luminous bacillus OmpW gene
1. bacterium obtaining and cultivating
The various bacteriums that obtain from the marine site after simple separation and purification, obtain one with vibrios special culture media TCBS preliminary screening and are green bacterium colony, are decided to be Mermaid luminous bacillus after the VITEK32 of Xiamen City Disease Control and Prevention Center type automatic bacterial assessing instrument is identified.
Picking Mermaid luminous bacillus list bacterium colony adds 20% glycerine-70 ℃ preservation after the LB culture medium culturing is spent the night.
2. the full-length clone of gene (Cloning of full-length DNA)
Because the complete sequence of Mermaid luminous bacillus gene is undetermined also, there is not the gene order report of this bacterium OmpW at present yet.In view of Vibrio parahaemolyticus has been finished complete sequence determination, we by its OmpW sequences Design OmpW gene primer, be used for the pcr amplification of Mermaid luminous bacillus OmpW.Thus, can hold and add restriction enzyme site and two protection bases design primers, R1:5 '-GG according to the 5` end and the 3` of Vibrio parahaemolyticus OmpW sequence
GGATCCATGAAAAAAACAATCTG-3 ' (being designated as SEQ ID NO.1) is a forward primer, oligonucleotide R2:5 '-CC
GAATTCTTAGAACTTGTAACCGC-3 ' (being designated as SEQ ID NO.2) is a reverse primer, with the Mermaid luminous bacillus is template, Mermaid luminous bacillus OmpW albumen is carried out pcr amplification, the PCR condition of R1/R2 be 94 ℃ 5 minutes, carried out 35 circulations in 90 seconds with 94 ℃ 1 minute, 55 ℃ 1 minute and 72 ℃ thereupon, extended 5 minutes with 72 ℃ at last.The electrophoresis detection pcr amplification product, the acquisition expanding fragment length is 642bp.Clone, check order with pcr amplification product according to a conventional method then, obtain the sequence shown in the SEQ ID NO.3.
Above-mentioned SEQ ID NO.1 and SEQ ID NO.2 are respectively:
The information of SEQ ID NO.1:
(i) sequence signature:
(A) length: 25bp
(B) type: Nucleotide
(C) chain: strand
(D) topological framework: linearity
(ii). molecule type: oligonucleotide
(iii). sequence description: the information of GGGGATCCATGAAAAAAACAATCTGSEQ ID NO.2:
(i) sequence signature:
(A) length: 25bp
(B) type: Nucleotide
(C) chain: strand
(D) topological framework: linearity
(ii). molecule type: oligonucleotide
(iii). sequence description: CCGAATTCTTAGAACTTGTAACCGC
The sequence information and the homology analysis of embodiment 2 Mermaid luminous bacillus OmpW genes
The new Mermaid luminous bacillus OmpW full length gene of the present invention is 642bp, and detailed sequence is seen SEQ ID NO.3.Derive the aminoacid sequence of Mermaid luminous bacillus OmpW according to the DNA total length, totally 213 amino-acid residues, molecular weight 22Kd, detailed sequence is designated as SEQ ID NO.4, and its relevant information is:
(i) sequence signature:
(A) length: 213 amino acid
(B) type: amino acid
(C) chain: strand
(D) topological framework: linearity
(ii). molecule type: polypeptide
(iii). sequence description:
1 MKKTICSLAV VAALVSPSVF AHKQGDFVLR VGAASVVPND SSDKILGSQE ELKVDSNTQL
61 GLTFGYMFTD NISLELLAAT PFSHDISTDL VGSDIADTKH LPPTLMVQYY FGEPQSKFRP
121 YVGAGLNYTI FFDEGFNSTG KGAGLSDLKL DDSFGLAANV GADYMINDQW FLNASAWYAN
181 IETEATYKAG GAKQKTDVKI NPWVFMISGG YKF-
Gene order total length and the based encode protein of OmpW are carried out Nucleotide and protein homology retrieval with blast program in ncbi database, found that there are very high homology in it and Vibrio parahaemolyticus OmpW gene.On nucleotide level, the 11-645 sequence in the whole coding sequence (GenBank Accession No.BA000032) of it and Vibrio parahaemolyticus OmpW gene has 94% homogeny (seeing Table 1):
Table 1
Percent Identity：94％in nt overlap
Query：11 caatctgcagtctagcagtggttgctgcaetcgtgtcaccaagtgttttcgcteataaac 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct：11 caatetgcagtctagcagtggttgctgcactcgtgtcaccaagtgttttcgctcataaac 70
Query：71 aaggtgacttcgttcttcgtgttggtgcggcgtctgtcgttccaaatgacagcagcgata 130
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct：71 aaggtgacttcgttcttcgtgttggtgcggcgtctgtcgttccaaatgacagcagcgata 130
Query：131 agattcttggttctcaagaagaattgaaagtggattcaaatacgcagcttggtttgacgt 190
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct：131 agattcttggttctcaagaagaattgaaagtggattcaaatacgcagcttggtttgacgt 190
Query：191 ttggctacatgttcacagacaacatcagcctagagcttctagcagcaacaccattcagcc 250
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct：191 ttggctacatgttcacagacaacatcagcctagagcttctagcagcaacaccattcagcc 250
Query：251 acgatatttctactgatttagtcgg---tagtgacatcgcggacaccaaacaccttccac 307
| |||||||| || || || | || | |||| |||||||||||||||||||||||||
Sbjct：251 atgatatttcaacagacttgttaggtcttggtgatatcgcggacaccaaacaccttccac 310
Query：308 caacgcttatggttcagtactactttggcgagccacaaagtaagttccgtccatacgttg 367
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct：311 caacgcttatggttcagtactactttggcgagccacaaagtaagttccgtccatacgttg 370
Query：368 gtgcaggtctcaactacaccatcttttttgatgaaggctttaacagcacaggtaaaggcg 427
||||||||||||||||||||||||||||||||||||||||||||| || || ||| ||
Sbjct：371 gtgcaggtctcaactacaccatcttttttgatgaaggctttaacaacaaagcgaaaaacg 430
Query：428 ctggtttgtcagacttgaaattagatgattcatttggtttagcagcaaacgtaggtgcgg 487
|| || | || | || |||| ||||||||||||||||||||||||||||| | ||
Sbjct：431 tgggcttaactgatcttaagctagacgattcatttggtttagcagcaaacgtaggcgtgg 490
Query：488 actacatgatcaacgatcaatggttccttaacgcatcagcgtggtatgcaaacattgaaa 547
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct：491 actacatgatcaacgatcaatggttccttaacgcatctgcgtggtatgcaaacattgaaa 550
Query：548 cagaagcaacttacaaagcaggtggagcgaagcaaaaaaccgacgtcaaaattaaccctt 607
|||||||||| |||||| ||||||||||||||||||||||||||||||||||||||||
Sbjct：551 cagaagcaacatacaaatttggtggagcgaagcaaaaaaccgacgtcaaaattaaccctt 610
Query：608 gggtatttatgatcagcggcggttacaagttctaa 642
|||||||||||||||||||||||||||||||||||
Sbjct：611 gggtatttatgatcagcggcggttacaagttctaa 645
Above-listed: the proteic nucleotide sequence of Mermaid luminous bacillus OmpW
Following: the proteic nucleotide sequence of Vibrio parahaemolyticus OmpW (GenBank Accession No.BA000032)
On amino acid levels, the amino-acid residue of it and Vibrio parahaemolyticus OmpW albumen (GenPeptAccession No.BAC61439) has high homogeny and similarity (seeing Table 2).Table 2 is that the homology of Mermaid luminous bacillus OmpW albumen of the present invention and the proteic aminoacid sequence of Vibrio parahaemolyticus OmpW (GenPept Accession No.BAC61439) compares (FASTA) figure.Wherein, identical amino acid marks with the amino acid monocase between two sequences, and similar amino acid marks with "+".
Table 2
Identities＝203/214(94％)，Positives＝206/214(96％)，Gaps＝1/214(0％)
MKKTICSLAVVAALVSPSVFAHKQGDFVLRVGAASVVPNDSSDKILGSQEELKVDSNTQL
Query 61 GLTFGYMFTDNISLELLAATPFSHDISTDLVG-SDIADTKHLPPTLMVQYYFGEPQSKFR 119
GLTFGYMFTDNISLELLAATPFSHDISTDL+G DIADTKHLPPTLMVQYYFGEPQSKFR
Sbjct 61 GLTFGYMFTDNISLELLAATPFSHDISTDLLGLGDIADTKHLPPTLMVQYYFGEPQSKFR 120
Query 120 PYVGAGLNYTIFFDEGFNSTGKGAGLSDLKLDDSFGLAANVGADYMINDQWFLNASAWYA 179
PYVGAGLNYTIFFDEGFN+ K GL+DLKLDDSFGLAANVG DYMINDQWFLNASAWYA
Sbjct 121 PYVGAGLNYTIFFDEGFNNKAKNVGLTDLKLDDSFGLAANVGVDYMINDQWFLNASAWYA 180
Query 180 NIETEATYKAGGAKQKTDVKINPWVFMISGGYKF 213
NIETEATYK GGAKQKTDVKINPWVFMISGGYKF
Sbjct 181 NIETEATYKFGGAKQKTDVKINPWVFMISGGYKF 214
Above-listed: the proteic aminoacid sequence of Mermaid luminous bacillus OmpW
Following: the proteic aminoacid sequence of Vibrio parahaemolyticus OmpW (GenPeptAccession No.BAC61439)
Therefore all there are higher homology in Mermaid luminous bacillus OmpW gene and Vibrio parahaemolyticus OmpW gene on nucleic acid still is protein level, can think that both also have very high similarity on function.
The proteic 26S Proteasome Structure and Function research of embodiment 3 Mermaid luminous bacillus OmpW
Below provide the variation of Mermaid luminous bacillus OmpW under the different salt concentration conditions:
Extracted Mermaid luminous bacillus 0.5%, 1%, and 4% these three kinds of salt concn culture condition under outer membrane protein after, at first their outer membrane protein collection of illustrative plates are compared analysis by SDS-PAGE, the result as shown in Figure 1.From Fig. 1, can be clear that, along with the rising gradually of salinity, have a protein band also respective table reveal the amount on rising gradually, this salt adaptability that shows this protein band and Mermaid luminous bacillus has the property of being closely related.Can know that in conjunction with qualification result this band is OmpW to Mermaid luminous bacillus outer membrane protein.
Below provide the comparison of three kinds of vibrios and Mermaid luminous bacillus to salt tolerance level ability:
Except above Mermaid luminous bacillus and vibrio alginolyticus and Vibrio parahaemolyticus, can add bacterial classification one Vibrio vulnificus highly significant and together analyze.Why saying that Vibrio vulnificus is meaningful, is because of after the genome of Vibrio vulnificus is analyzed, and finds that there is not the OmpW gene in it, it is planted bacterium with first three carry out the salt tolerance relatively, can be clear that the effect of OmpW more.
1%, 2% has inserted this Mermaid luminous bacillus and three kinds of vibrios simultaneously on the LB of 13% salt concn flat board, whether can grow according to bacterium on the different salinity flat board and to judge that the difference of their salt tolerance levels, table 3 are the results that observe after 18 hours in inoculation.
Table 3
| Salinity (%) | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 |
| V.vulnificus | + | + | + | - | - | - | - | - | - | - | - | - |
| V.parahaemolyticus | + | + | + | + | + | + | + | + | ||||
| Photobacterium damsela | + | + | + | + | + | + | + | + | ||||
| V.alginolyticus | + | + | + | + | + | + | + | + | + | + | + | + |
Annotate :+expression has bacterium colony;-expression is not grown
Result from table 3 as can be seen, on the salt tolerance, vibrio alginolyticus＞Vibrio parahaemolyticus=Mermaid luminous bacillus＞Vibrio vulnificus, this situation with whether express the different just in time corresponding mutually of OmpW albumen and expression amount at Mermaid luminous bacillus and three kinds of vibrios, this further shows the dependency of OmpW and vibrios salt tolerance.Below further prove the mutual relationship between OmpW albumen and salt tolerance.
Behind proteic clone of Mermaid luminous bacillus OmpW and the abduction delivering to the influence of thalline salt tolerance:
After by the method among the embodiment 1 Mermaid luminous bacillus OmpW albumen being carried out pcr amplification, be connected respectively among PETHIS and the PLLP-OmpA and finally change over to respectively among E.coli BL21 and the Top10.Fig. 3 is to the SDS-PAGE collection of illustrative plates of E.coli BL21OmpW transformant behind the IPTG abduction delivering.From Fig. 3, can be clear that the proteic expression of OmpW.Through the bacterial strain of abduction delivering and carried out the analysis of salt tolerance through inductive E.coli Top10+PLLP-OmpA-OmpW equally, table 4 is in each the observation on Growth result of salinity plating after 24 hours to this.
Table 4
| Salinity (1%) | 1 | 2 | 3 | 4 | 5 | 6 | 7 |
| E.coli BL21+PET-OmpW | + | + | + | + | + | - | |
| E.coli BL21+PET-OmpW | + | + | + | + | + | - | |
| E.coli Top10+P LLP-OmpA | + | + | + | + | + | - | - |
| E.coli Top10+P LLP-OmpA-OmpW | + | + | + | + | + | + | + |
As can be seen from Table 4, E.coli Top10+PLLP-OmpA-Omp has compared according to height on the tolerance of strain E.coli Top10+PLLP-OmpA salt two salinity, and this has obviously shown the directly related property of Mermaid luminous bacillus OmpW with the salt tolerance.
Simultaneously, can see that E.coli BL21+PET-OmpW and its contrast strain E.coli BL21+PET-OmpW are basic identical on the salt tolerance level, not show OmpW and import the lifting of back its salt resistance ability.Its reason mainly is that OmpW still is present in the born of the same parents after expressing in E.coli BL21+PET-OmpW, is difficult to arrive the adventitia position, thereby can't brings into play its effect aspect the salt tolerance.And after using the PLLP-OmpA carrier, since on the carrier with the effect of OmpA signal peptide, the OmpW albumen of abduction delivering can be secreted into outside the born of the same parents, and OmpW albumen just shows it in the effect that promotes on the salt tolerance after inserting adventitia by certain mode.The Different Results of using these two kinds of carriers to draw further shown, OmpW expresses that to cause the lifting of salt tolerance level be the effect of OmpW albumen self, rather than causes other variation of cell behind its abduction delivering and produce.
The preparation and the purification of embodiment 4 Mermaid luminous bacillus OmpW polypeptide
The Mermaid luminous bacillus OmpW encoding sequence of total length or fragment are built among the Escherichia coli protein prokaryotic expression carrier, express and the purification target protein to reach.
The structure of bacillus coli DH 5 alpha cloning vector, and transform DH5 α competent cell:
According to the above primer that designs, correspond respectively to about 20 Nucleotide of encoding sequence 5 ' and 3 ' end, and on positive anti-primer, introduce restricted endoenzyme site (this decides according to the colibacillus expression plasmid PET-HIS that selects for use) respectively, so that make up clone and expression vector.With the amplified production that obtains among the embodiment 1 is template, behind pcr amplification, with Mermaid luminous bacillus OmpW gene clone to E.coli expression plasmid PET-HIS. with suitable restriction endonuclease with plasmid linearization.Determine the purity and the concentration of plasmid with agarose gel electrophoresis.With linearizing cloned plasmids, be transformed in the cloning vector E.coliDH5 α competence with chemical heat shock method.All be applied on the LB+Amp flat board, cultivated 12～16 hours for 37 ℃.
The clone advances screening, the evaluation of the proteic DH5 α of Mermaid luminous bacillus OmpW positive colony:
Intestinal bacteria bacterium colony on the picking LB+Amp flat board at random, be inoculated on the LB+Amp liquid nutrient medium, inoculation contains simultaneously the DH5 of free PET-HIS plasmid α, incubated overnight, extract plasmid respectively with alkaline lysis, and the plasmid that is extracted is carried out double digestion respectively verify, obtain the double digestion collection of illustrative plates as shown in Figure 4.
The structure of e. coli bl21 expression vector, and transform the BL21 competent cell:
The above plasmid that contains Mermaid luminous bacillus OmpW protein gene that detects is transformed into BL21 competence with same chemical heat shock method.All be applied on the LB+Amp flat board, cultivated 10-16 hour for 37 ℃.
Express screening, the evaluation of the proteic BL21 positive colony of Mermaid luminous bacillus OMPW:
E. coli bl21 bacterium colony on the picking LB+Amp flat board at random, be inoculated on the LB+Amp liquid nutrient medium, inoculate unconverted BL21 and the BL21 that contains the PET-HIS empty plasmid simultaneously, in 30 ℃ of moderate jogs to OD value is 0.6, adding IPTG100g/ml induced two hours for 35 ℃, centrifugal collection thalline, SDS-PAGE detects expression product, and the result is as shown in Figure 2.
Utilize Western blot to detect the expression of OmpW albumen in transgenosis E.coli:
1, proteic obtaining: express Mermaid luminous bacillus OmpW albumen as stated above.
2, the preparation of SDS-PAGE protein isolate: SDS-PAGE is with reference to " molecular cloning " (Sambrook etc., 2001); A) before the application of sample, sample is placed LSB sample loading buffer (2* sample loading buffer: glycerine 2.4g, 1M Tris-HCl pH6.81ml; Bromjophenol blue 0.01%, H2O is settled to 20ml), boiled 3～5 minutes; B) polyacrylamide gel electrophoresis under 4 ℃ of 80V voltage reaches the gel bottom up to indicator (bromjophenol blue) forward position.
3, protein is to shifting on the nitrocellulose membrane: before a) shifting, use transfering buffering liquid (39mmol glycine, 48mmolTris Base, 0.037%SDS, 20% methyl alcohol) balanced gel and nitrocellulose membrane 30 minutes; B) 4 ℃ down with DYY-7B electroporation 50V transferase 12 hour, and 3 layers of Whatman filter paper are respectively filled up in the gel both sides.
4, proteic detection on the film: a) nitrocellulose membrane is immersed in the confining liquid, 60 minutes (confining liquids: get the 5g skim-milk and be dissolved in 100ml TNT are slowly shaken, sealed to room temperature; B) again film is immersed in the lavation buffer solution room temperature washing three times, each 10 minutes; C) add first antibody (antibody of anti-Mermaid luminous bacillus OmpW), room temperature reaction 60 minutes; Same step b) is washed three times; D) add second antibody (anti-mouse two resists the horseradish peroxidase rabbit), room temperature reaction 60 minutes; Same step b) is washed three times; E) add substrate DAB colour developing and observe protein band.
Claims (8)
1, Mermaid photobacterium envelop protein W is characterized in that: this polypeptide contains the aminoacid sequence of SEQ ID NO.4.
2, Mermaid photobacterium envelop protein W as claimed in claim 1 is characterized in that: this amino acid sequence of polypeptide is shown in SEQ ID NO.4.
3, a kind of isolating polynucleotide, it is characterized in that: it comprises a nucleotide sequence, and this nucleotide sequence is selected from down group:
(a) polynucleotide of polypeptide according to claim 1 of encoding;
(b) with polynucleotide (a) complementary polynucleotide.
4, polynucleotide as claimed in claim 3 is characterized in that: this polynucleotide encoding has the polypeptide of aminoacid sequence shown in the SEQ ID NO.4.
5, polynucleotide as claimed in claim 3 is characterized in that: the sequence of these polynucleotide is selected from coding region sequence or the full length sequence of SEQ ID NO.3.
6, the preparation method of fish luminous bacillus outer membrane protein W goes in U.S.A, it is characterized in that comprising following steps:
(1) nucleotide sequence that coding is had a Mermaid photobacterium envelop protein W protein active polypeptide operationally is connected in expression regulation sequence, forms the Mermaid photobacterium envelop protein W protein expression vector;
(2) change the expression vector in the step (1) over to host cell, form the reconstitution cell of Mermaid photobacterium envelop protein W;
(3) be fit to express under the condition of Mermaid photobacterium envelop protein W polypeptide, the reconstitution cell in the culturing step (2) is expressed target product;
(4) separation and purification has the active polypeptide of Mermaid photobacterium envelop protein W.
7, Mermaid photobacterium envelop protein W as claimed in claim 1 is in the application that improves biomass cells salt tolerance.
8, polynucleotide as claimed in claim 3 are in the application that improves biomass cells salt tolerance.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNB2005101002113A CN100357318C (en) | 2005-10-11 | 2005-10-11 | Mermaid photobacterium envelop protein W and coding sequence , its preparation method and uses |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNB2005101002113A CN100357318C (en) | 2005-10-11 | 2005-10-11 | Mermaid photobacterium envelop protein W and coding sequence , its preparation method and uses |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN1800209A true CN1800209A (en) | 2006-07-12 |
| CN100357318C CN100357318C (en) | 2007-12-26 |
Family
ID=36810453
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CNB2005101002113A Expired - Fee Related CN100357318C (en) | 2005-10-11 | 2005-10-11 | Mermaid photobacterium envelop protein W and coding sequence , its preparation method and uses |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN100357318C (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108330142A (en) * | 2018-02-09 | 2018-07-27 | 河北科技师范学院 | A kind of Mermaid luminous bacillus hemolysin Hly with immanoprotection actionchAlbumen |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6335018B1 (en) * | 1995-05-01 | 2002-01-01 | Aventis Pasteur Limited | High molecular weight major outer membrane protein of moraxella |
| GB9513074D0 (en) * | 1995-06-27 | 1995-08-30 | Cortecs Ltd | Novel anigen |
| US7341727B1 (en) * | 1996-05-03 | 2008-03-11 | Emergent Product Development Gaithersburg Inc. | M. catarrhalis outer membrane protein-106 polypeptide, methods of eliciting an immune response comprising same |
| WO2001004317A1 (en) * | 1999-07-14 | 2001-01-18 | Institute Of Molecular Agrobiology | Ompa gene for an outer membrane protein of riemerella anatipestifer and methods of use |
-
2005
- 2005-10-11 CN CNB2005101002113A patent/CN100357318C/en not_active Expired - Fee Related
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108330142A (en) * | 2018-02-09 | 2018-07-27 | 河北科技师范学院 | A kind of Mermaid luminous bacillus hemolysin Hly with immanoprotection actionchAlbumen |
| CN108330142B (en) * | 2018-02-09 | 2021-09-17 | 河北科技师范学院 | Mermaid photorhabditis hemolysin Hly with immune protection effectchProtein |
Also Published As
| Publication number | Publication date |
|---|---|
| CN100357318C (en) | 2007-12-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Killer et al. | Lactobacillus bombi sp. nov., from the digestive tract of laboratory-reared bumblebee queens (Bombus terrestris) | |
| CN1193094C (en) | Antigenic proteins of shrimp white spot syndrome virus uses thereof | |
| CN1699573A (en) | V. alginolyticus outer-membrane protein W gene, process for preparing the same and uses thereof | |
| CN1142280C (en) | Improved prokaryotic expression of protein | |
| Kumari et al. | Vibrio panuliri sp. nov., a marine bacterium isolated from spiny lobster, Panulirus penicillatus and transfer of Vibrio ponticus from Scophthalmi clade to the newly proposed Ponticus clade | |
| Augustine et al. | Four novel strains of cellulolytic symbiotic bacteria isolated and characterized from GI tract of marine fishes of various feeding habits | |
| CN1834236A (en) | Lipase A variant of wild Bacillus subtilis and application thereof | |
| CN1654656A (en) | FenneropenaeusChinensis Crustin gene and coded protein and cloning method therefor | |
| CN1800209A (en) | Mermaid photobacterium envelop protein W and coding sequence , its preparation method and uses | |
| CN1434859A (en) | Processes and organisms for the production of anti-freeze proteins | |
| CN1786022A (en) | Mermaid luminous bacillus outer membrane protein V and coding sequence, its preparation method and application | |
| CN101063113A (en) | Clone and expression for novel phytase | |
| CN1904036A (en) | Method of producing three kinds of human alpha alexins by gene engineering bacteria mixed culture | |
| CN1800398A (en) | Prunus necrotic ring spot virus coat protein gene and its special primer for checking | |
| CN1181199C (en) | Lichenized bacillus L-25 keratinase and its encoding DNA | |
| CN1236059C (en) | Grouper insulin-like growth factor II gene, carrier and recombinant strain containing the gene and application thereof | |
| CN1298840C (en) | Bacilluscoli 0157 gene deficiency bacterin of intestinal hemorrhage | |
| CN1306038C (en) | Rapid detection of bacterial fruit spot germ of melon seed | |
| CN1234726C (en) | Nucleic acid, expression carrier and application of steady wheat high molecular gluten Dtx1, 5 subunit coding gene | |
| CN100351378C (en) | Aldehyde-alcohol dehydrogenase gene | |
| CN1807633A (en) | Bacillus fungus-suppressing peptide expression regulating gene yxlC | |
| CN1516735A (en) | Method to generate non-virulent microorganism from pathogenic ones trough permanent genetic modification of their biological membrane for vaccine production | |
| CN1480464A (en) | Ethane cyclic amp receptor protein of wheat and its coding sequence | |
| CN1821384A (en) | Mycobactrium tuberculosis protein for diagnosing rifampicin dependent mycobacterium tuberculosis | |
| CN1366051A (en) | Modifying method and application of exilis protein gene |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| C19 | Lapse of patent right due to non-payment of the annual fee | ||
| CF01 | Termination of patent right due to non-payment of annual fee |